Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionBIRA acts both as a biotin-operon repressor and as the enzyme that synthesizes the corepressor, acetyl-CoA:carbon-dioxide ligase. This protein also activates biotin to form biotinyl-5'-adenylate and transfers the biotin moiety to biotin-accepting proteins [catalytic activity: ATP + biotin + APO-[acetyl-CoA:carbon-dioxide ligase (ADP forming)] = AMP + pyrophosphate + [acetyl-CoA:carbon-dioxide ligase (ADP forming)]].
ProductPossible bifunctional protein BirA: biotin operon repressor + biotin--[acetyl-CoA-carboxylase] synthetase (biotin--protein ligase)
CommentsRv3279c, (MTCY71.19c), len: 266 aa. Possible birA, bifunctional protein: biotin operon repressor and biotin--[acetyl-CoA-carboxylase] synthetase, equivalent to Q9CCL3|BIRA|ML0732 biotin APO-protein ligase from Mycobacterium leprae (274 aa), FASTA scores: opt: 1189, E(): 2.3e-66, (71.2% identity in 271 aa overlap). But as it lacks a BirA h-t-h domain at N-terminus, may simply be biotin apo-protein ligase. Also similar to others e.g. Q9CNX6|BIRA|PM0296 from Pasteurella multocida (312 aa), FASTA scores: opt: 347, E(): 2.7e-14, (32.95% identity in 270 aa overlap); Q9HWC0|BIRA|PA4280 from Pseudomonas aeruginosa (312 aa), FASTA scores: opt: 335, E(): 1.5e-13, (34.2% identity in 272 aa overlap); Q9A6Z0|CC1936 from Caulobacter crescentus (250 aa), FASTA scores: opt: 332, E(): 1.9e-13, (33.6% identity in 238 aa overlap); P06709|BIRA_ECOLI (321 aa), FASTA scores: opt: 314, E(): 3.1e-12, (34.15% identity in 249 aa overlap); etc. Similar with other bacterial BIRA and with eukaryotic biotin APO-protein ligase.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by proteomics at the Statens Serum Institute (Denmark) (See Rosenkrands et al., 2000). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsDNA microarrays detect expression in M. tuberculosis H37Rv in vivo (in BALB/c and SCID mice) but not in vitro (in 7H9 medium) (See Talaat et al., 2004).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS36612123662012-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
>Mycobacterium tuberculosis H37Rv|CDS|Rv3279c|3661212-3662012|-|birA|downstream:0|upstream:0
gtgaccgaccgcgatcggctcaggccgcctttggacgaacgctcactgcgcgaccagctgatcggtgctggatccgggtggcgccaacttgacgtcgtggcccaaaccggttccaccaacgccgacttgctggcccgggcggcatccggggccgatatcgacggggtggtgttgatcgccgagcatcagaccgctgggcgggggcgtcatggccgcggctgggcggccactgcccgagcgcagatcatcctgtcggtcggtgtgcgtgtggtcgacgtcccggtgcaagcgtggggctggctgtcactggccgcgggtctggcggtgctcgattcggtggcccccctgattgcagtcccgccggccgaaacgggcctcaagtggcccaatgacgtgctggcccggggtggcaagttagccggcatcctggccgaggtcgcgcagccgtttgtggtactcggtgtgggactcaacgtcacccaggcccccgaagaggttgatcccgacgcgacctcattgctggacctcggagtggcggcaccggaccgcaaccgcatagccagcaggctgttgcgcgagctcgaagctcggatcatccagtggcgcaacgccaacccacaactggcggccgactaccgtgctcgcagcctgaccattgggtcgcgcgtgcgcgtcgagctccccggtggccaggacgtcgtcgggatcgcgcgtgacatcgatgaccagggtcggctgtgtctggacgtcggcggtcgaacggtagttgtttcagcgggcgacgtggtgcatttgcgttaa
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3279c|birA
VTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR