Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThought to catalyze the reversible oxidation of ethanol to acetaldehyde with the concomitant reduction of NAD. Probably acts on primary or secondary alcohols or hemiacetals [catalytic activity: an alcohol + NAD+ = an aldehyde or ketone + NADH].
ProductPossible zinc-containing alcohol dehydrogenase NAD dependent AdhB
CommentsRv0761c, (MTCY369.06c), len: 375 aa. Possible adhB, zinc-containing alcohol dehydrogenase NAD-dependent, similar to others e.g. AAC15839.1|AF060871_4 hypothetical alcohol dehydrogenase from Rhodococcus rhodochrous (370 aa), FASTA scores: opt: 1234, E(): 0, (46.8% identity in 370 aa overlap); P80468|ADH2_STRCA alcohol dehydrogenase II from Struthio camelus (Ostrich) (379 aa); Q03505|ADH1_RABIT alcohol dehydrogenase alpha chain from Oryctolagus cuniculus (Rabbit) (374 aa), FASTA scores: opt: 872, E(): 0, (39.1% identity in 379 aa overlap); etc. Also similar to adhD alcohol dehydrogenase from Mycobacterium tuberculosis (368 aa). Contains PS00059 Zinc-containing alcohol dehydrogenases signature. Belongs to the zinc-containing alcohol dehydrogenase family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS854699855826-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
>Mycobacterium tuberculosis H37Rv|CDS|Rv0761c|854699-855826|-|adhB|downstream:0|upstream:0
gtgaagaccaagggcgcactgatctgggagttcaaccagccatggtccgtcgaagagatcgaaatcggcgacccgcgcaaggacgaagtcaagatccagatggaagcggctgggatgtgccgctccgaccatcacctggtgacgggcgacatcccgatggcgggctttcccgttctgggcggacacgagggcgcgggcatcgtcaccgaggtcggcccgggagtcgacgacttcgccccgggcgatcacgtggtgttggcattcatcccgtcctgcggcaagtgtccgtcctgccaggctggaatgcggaatctgtgcgacctgggggcggggctgctcgccggggaatctgtgacggacggctccttccggattcaggctcgcggccagaacgtctacccgatgaccctgctcggaacgttttcaccgtacatggtggtgcaccgcagctcggtggtgaagatcgacccgtcggtgcccttcgaagtcgcctgcctggttggttgcggcgtcaccaccggctatggttcggcggtccgcacggccgacgtccggccgggcgacgacgtggccatcgtcggcttgggtggggtcggcatggcggcgttgcagggcgcggtcagcgcgggcgcccgctacgtcttcgcggtggagccggtggaatggaaacgtgatcaggctctgaaattcggtgccacccacgtctacccggacatcaacgccgcgctgatgggcattgccgaggtcacctacggcctgatggcgcagaaggtgatcatcaccgtcggcaagctcgatggcgccgacgtcgacagctatctgaccatcacggccaagggcggcacctgcgtgctgacggccatcggcagcctggtcgacacccaggtgacgctgaacctcgcgatgttgaccctgctgcaaaagaacatccagggcaccatcttcggcggcggcaacccgcactacgacattccgaagctgttgtcgatgtataaggccggcaaactcaacctcgacgacatggtgaccactgcgtacaagctggagcagatcaacgacggataccaggacatgctgaacggcaagaacattcgcggcgtgatccggtacacggacgacgaccgctag
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0761c|adhB
VKTKGALIWEFNQPWSVEEIEIGDPRKDEVKIQMEAAGMCRSDHHLVTGDIPMAGFPVLGGHEGAGIVTEVGPGVDDFAPGDHVVLAFIPSCGKCPSCQAGMRNLCDLGAGLLAGESVTDGSFRIQARGQNVYPMTLLGTFSPYMVVHRSSVVKIDPSVPFEVACLVGCGVTTGYGSAVRTADVRPGDDVAIVGLGGVGMAALQGAVSAGARYVFAVEPVEWKRDQALKFGATHVYPDINAALMGIAEVTYGLMAQKVIITVGKLDGADVDSYLTITAKGGTCVLTAIGSLVDTQVTLNLAMLTLLQKNIQGTIFGGGNPHYDIPKLLSMYKAGKLNLDDMVTTAYKLEQINDGYQDMLNGKNIRGVIRYTDDDR