Gene Rv0458
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Interconversion aldehyde and acid [catalytic activity: an aldehyde + NAD+ + H2O = an acid + NADH]. |
| Product | Probable aldehyde dehydrogenase |
| Comments | Rv0458, (MTV038.02), len: 507 aa. Probable aldehyde dehydrogenase, highly similar to many, closest to P46369|THCA_RHOER EPTC-inducible aldehyde dehydrogenase from Rhodococcus erythropolis (506 aa), FASTA scores: opt: 2767, E(): 0, (79.7% identity in 507 aa overlap); AAC13641.1|AF029733 chloroacetaldehyde dehydrogenase from Xanthobacter autotrophicus (505 aa), FASTA scores: opt: 2563, E(): 0, (75.4% identity in 492 aa overlap); Q9RJZ6|DHAL_STRCO probable aldehyde dehydrogenase from Streptomyces coelicolor (507 aa). Also similar to other semialdehyde dehydrogenases in Mycobacterium tuberculosis e.g. Rv0768, Rv2858c. Belongs to the aldehyde dehydrogenases family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 549675 | 551198 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
>Mycobacterium tuberculosis H37Rv|CDS|Rv0458|549675-551198|+|Rv0458|downstream:0|upstream:0 atgactgtcttttcccgtcccggttccgccggggcgctgatgtcctatgaatcccggtaccaaaacttcatcgggggccagtgggtcgcgccggtccatgggcgctacttcgagaacccgacgccggtgaccggccagccgttctgcgaggtgccgcgctccgacgcggccgacatcgacaaggcgctcgacgccgcgcacgcggcggcgccggggtggggcaagaccgcaccggccgaacgggcggcgatcctcaacatgattgccgaccgcatcgacaagaacgccgccgcgctggcggtggccgaggtctgggacaacgggaaaccggtccgggaagcgctggccgccgatatcccgttggcggtcgatcacttccggtacttcgccgcggcgattcgcgcccaggagggcgcgctgagccagatcgacgaggacaccgtggcctaccacttccacgagccgctcggcgtggtgggccagatcattccgtggaacttccccatcctgatggcggcctggaagctggcgccggcgttggcggccggcaacacggcggtgctcaaacccgccgagcagacacccgcttcggtgctctacctgatgtcgctgatcggtgatctgttgccgcccggggtggtcaacgtggtcaacggattcggcgccgaggccggcaagccgttggcctccagcgaccgcatcgccaaggtcgcgttcaccggggaaaccaccacggggcggctgatcatgcaatacgcctcgcacaacctgatcccggtcaccctggaactcggcggcaagagccccaacatcttcttcgccgacgtgctggccgcccacgacgacttctgcgacaaggcgctggaaggcttcaccatgttcgccctcaaccagggcgaggtgtgcacctgcccgtcgcgcagtctgatccaggccgacatctacgacgagttcctggagctggcggcgatccggaccaaggcggtccggcagggcgacccgctggacaccgaaaccatgctgggttcccaggcctccaacgaccagctggaaaaggtgttgtcctacatcgaaatcggcaagcaagagggtgcggtgattatcgccggaggcgagcgcgccgaactaggcggcgacctgtccggcggttattacatgcagccgacgatcttcaccggcaccaacaacatgcggattttcaaggaggagatcttcgggccggtggtcgcggtgacgtcgttcaccgattacgacgacgcgatcggcatcgccaacgacaccctctacggcttgggtgccggtgtgtggagccgcgacggcaacactgcctatcgggccgggcgggacatccaggccggccgggtgtgggtcaactgctaccacctctaccccgcgcacgcggcgttcggcggctacaagcagtccggcatcggccgggagggccaccagatgatgctgcagcactaccagcacaccaagaacctgctggtgtcctactcggataaggcgctggggttcttctga
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0458|Rv0458
MTVFSRPGSAGALMSYESRYQNFIGGQWVAPVHGRYFENPTPVTGQPFCEVPRSDAADIDKALDAAHAAAPGWGKTAPAERAAILNMIADRIDKNAAALAVAEVWDNGKPVREALAADIPLAVDHFRYFAAAIRAQEGALSQIDEDTVAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALAAGNTAVLKPAEQTPASVLYLMSLIGDLLPPGVVNVVNGFGAEAGKPLASSDRIAKVAFTGETTTGRLIMQYASHNLIPVTLELGGKSPNIFFADVLAAHDDFCDKALEGFTMFALNQGEVCTCPSRSLIQADIYDEFLELAAIRTKAVRQGDPLDTETMLGSQASNDQLEKVLSYIEIGKQEGAVIIAGGERAELGGDLSGGYYMQPTIFTGTNNMRIFKEEIFGPVVAVTSFTDYDDAIGIANDTLYGLGAGVWSRDGNTAYRAGRDIQAGRVWVNCYHLYPAHAAFGGYKQSGIGREGHQMMLQHYQHTKNLLVSYSDKALGFF
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant