Symbol:
Usp48
Name:
ubiquitin specific peptidase 48
RGD ID:
735213
Description:
Predicted to enable cysteine-type deubiquitinase activity. Predicted to be involved in regulation of protein stability. Located in postsynaptic membrane. Human ortholog(s) of this gene implicated in autosomal dominant nonsyndromic deafness 85. Orthologous to human USP48 (ubiquitin specific peptidase 48); INTERACTS WITH 1,3-dinitrobenzene; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
deubiquitinating enzyme 48; LOC100911993; synaptic ubiquitin-specific protease; synUSP; ubiquitin carboxyl-terminal hydrolase 48; ubiquitin carboxyl-terminal hydrolase 48-like; ubiquitin specific protease 31; ubiquitin specific protease 48; ubiquitin thioesterase 48; ubiquitin thiolesterase 48; ubiquitin-specific-processing protease 48; Usp31
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 155,083,520 - 155,151,208 (+) NCBI GRCr8 mRatBN7.2 5 149,800,189 - 149,867,838 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 149,800,179 - 149,867,719 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 152,496,642 - 152,563,755 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 154,270,935 - 154,338,044 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 154,252,948 - 154,320,051 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 155,935,102 - 156,002,722 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 155,934,490 - 156,002,721 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 159,690,824 - 159,758,706 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 156,351,117 - 156,418,283 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 156,361,155 - 156,428,321 (+) NCBI Celera 5 148,196,521 - 148,263,977 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Usp48 Rat 1,2-dimethylhydrazine decreases expression ISO Usp48 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of USP48 mRNA CTD PMID:22206623 Usp48 Rat 1,3-dinitrobenzene increases expression EXP 6480464 3-dinitrobenzene results in increased expression of USP48 mRNA CTD PMID:24140754 Usp48 Rat 17alpha-ethynylestradiol increases expression ISO Usp48 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of USP48 mRNA CTD PMID:17942748 Usp48 Rat 17alpha-ethynylestradiol multiple interactions ISO Usp48 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of USP48 mRNA CTD PMID:17942748 Usp48 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Usp48 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Usp48 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Usp48 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of USP48 mRNA CTD PMID:17942748 Usp48 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of USP48 mRNA CTD PMID:33387578 Usp48 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of USP48 mRNA CTD PMID:34747641 Usp48 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Usp48 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of USP48 mRNA CTD PMID:21570461 Usp48 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Usp48 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of USP48 mRNA CTD PMID:19770486 Usp48 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of USP48 mRNA CTD PMID:21346803 Usp48 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Usp48 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of USP48 mRNA CTD PMID:26251327 Usp48 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of USP48 mRNA CTD PMID:24780913 Usp48 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of USP48 mRNA CTD PMID:31881176 Usp48 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of USP48 mRNA CTD PMID:28959563 Usp48 Rat aflatoxin B1 increases expression ISO Usp48 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of USP48 mRNA CTD PMID:19770486 Usp48 Rat all-trans-retinoic acid decreases expression ISO USP48 (Homo sapiens) 6480464 Tretinoin results in decreased expression of USP48 mRNA CTD PMID:33167477 Usp48 Rat antirheumatic drug increases expression ISO USP48 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of USP48 mRNA CTD PMID:24449571 Usp48 Rat apigenin increases expression ISO Usp48 (Mus musculus) 6480464 Apigenin results in increased expression of USP48 mRNA CTD PMID:22359648 Usp48 Rat aristolochic acid A decreases expression ISO USP48 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of USP48 mRNA CTD PMID:33212167 Usp48 Rat arsenite(3-) multiple interactions ISO USP48 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to USP48 mRNA] CTD PMID:32406909 Usp48 Rat arsenous acid increases response to substance ISO USP48 (Homo sapiens) 6480464 USP48 protein results in increased susceptibility to Arsenic Trioxide CTD PMID:20707922 Usp48 Rat atrazine decreases expression ISO USP48 (Homo sapiens) 6480464 Atrazine results in decreased expression of USP48 mRNA CTD PMID:22378314 Usp48 Rat benzo[a]pyrene diol epoxide I increases expression ISO USP48 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Usp48 Rat bisphenol A increases expression ISO Usp48 (Mus musculus) 6480464 bisphenol A results in increased expression of USP48 mRNA CTD PMID:26063408 Usp48 Rat bisphenol A decreases expression ISO Usp48 (Mus musculus) 6480464 bisphenol A results in decreased expression of USP48 mRNA CTD PMID:32156529 Usp48 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of USP48 mRNA CTD PMID:30816183 and PMID:32528016 Usp48 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of USP48 mRNA CTD PMID:25181051 Usp48 Rat cadmium dichloride decreases expression ISO USP48 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of USP48 mRNA CTD PMID:38568856 Usp48 Rat CGP 52608 multiple interactions ISO USP48 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to USP48 gene] CTD PMID:28238834 Usp48 Rat copper(II) sulfate increases expression ISO USP48 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of USP48 mRNA CTD PMID:20599845 Usp48 Rat copper(II) sulfate decreases expression ISO USP48 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of USP48 mRNA CTD PMID:19549813 and PMID:20599845 Usp48 Rat diarsenic trioxide increases response to substance ISO USP48 (Homo sapiens) 6480464 USP48 protein results in increased susceptibility to Arsenic Trioxide CTD PMID:20707922 Usp48 Rat Dibutyl phosphate affects expression ISO USP48 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of USP48 mRNA CTD PMID:37042841 Usp48 Rat dorsomorphin multiple interactions ISO USP48 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of USP48 mRNA CTD PMID:27188386 Usp48 Rat enzyme inhibitor multiple interactions ISO USP48 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of USP48 protein CTD PMID:23301498 Usp48 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of USP48 mRNA CTD PMID:24793618 Usp48 Rat folic acid decreases expression ISO Usp48 (Mus musculus) 6480464 Folic Acid results in decreased expression of USP48 mRNA CTD PMID:25629700 Usp48 Rat FR900359 increases phosphorylation ISO USP48 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of USP48 protein CTD PMID:37730182 Usp48 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of USP48 mRNA CTD PMID:22061828 Usp48 Rat ivermectin decreases expression ISO USP48 (Homo sapiens) 6480464 Ivermectin results in decreased expression of USP48 protein CTD PMID:32959892 Usp48 Rat methamphetamine affects response to substance ISO USP48 (Homo sapiens) 6480464 USP48 gene SNP affects the susceptibility to Methamphetamine CTD PMID:18316681 Usp48 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of USP48 gene CTD PMID:35440735 Usp48 Rat methylparaben increases expression ISO USP48 (Homo sapiens) 6480464 methylparaben results in increased expression of USP48 mRNA CTD PMID:31745603 Usp48 Rat paracetamol decreases expression ISO USP48 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of USP48 mRNA CTD PMID:21420995 Usp48 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of USP48 mRNA CTD PMID:33387578 Usp48 Rat paracetamol increases expression ISO USP48 (Homo sapiens) 6480464 Acetaminophen results in increased expression of USP48 mRNA CTD PMID:22230336 Usp48 Rat perfluorohexanesulfonic acid decreases expression ISO Usp48 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of USP48 mRNA CTD PMID:37995155 Usp48 Rat resveratrol multiple interactions ISO USP48 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of USP48 mRNA CTD PMID:23557933 Usp48 Rat rimonabant multiple interactions ISO Usp48 (Mus musculus) 6480464 Rimonabant inhibits the reaction [Dietary Fats results in increased expression of USP48 mRNA] CTD PMID:19030233 Usp48 Rat rotenone increases expression ISO USP48 (Homo sapiens) 6480464 Rotenone results in increased expression of USP48 mRNA CTD PMID:32368861 Usp48 Rat SB 431542 multiple interactions ISO USP48 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of USP48 mRNA CTD PMID:27188386 Usp48 Rat titanium dioxide decreases methylation ISO Usp48 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of USP48 gene CTD PMID:35295148 Usp48 Rat tungsten decreases expression ISO Usp48 (Mus musculus) 6480464 Tungsten results in decreased expression of USP48 mRNA CTD PMID:30912803 Usp48 Rat valproic acid increases expression ISO USP48 (Homo sapiens) 6480464 Valproic Acid results in increased expression of USP48 mRNA CTD PMID:23179753 more ... Usp48 Rat valproic acid multiple interactions ISO USP48 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of USP48 mRNA CTD PMID:27188386 Usp48 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of USP48 mRNA CTD PMID:23034163
1,2-dimethylhydrazine (ISO) 1,3-dinitrobenzene (EXP) 17alpha-ethynylestradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) antirheumatic drug (ISO) apigenin (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) CGP 52608 (ISO) copper(II) sulfate (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dorsomorphin (ISO) enzyme inhibitor (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) gentamycin (EXP) ivermectin (ISO) methamphetamine (ISO) methoxychlor (EXP) methylparaben (ISO) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) resveratrol (ISO) rimonabant (ISO) rotenone (ISO) SB 431542 (ISO) titanium dioxide (ISO) tungsten (ISO) valproic acid (ISO) vinclozolin (EXP)
Usp48 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 155,083,520 - 155,151,208 (+) NCBI GRCr8 mRatBN7.2 5 149,800,189 - 149,867,838 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 149,800,179 - 149,867,719 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 152,496,642 - 152,563,755 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 154,270,935 - 154,338,044 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 154,252,948 - 154,320,051 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 155,935,102 - 156,002,722 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 155,934,490 - 156,002,721 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 159,690,824 - 159,758,706 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 156,351,117 - 156,418,283 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 156,361,155 - 156,428,321 (+) NCBI Celera 5 148,196,521 - 148,263,977 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
USP48 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 21,678,298 - 21,783,149 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 21,678,298 - 21,783,606 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 22,004,791 - 22,109,642 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 21,877,378 - 21,982,275 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 21,750,393 - 21,854,960 NCBI Celera 1 20,327,493 - 20,432,623 (-) NCBI Celera Cytogenetic Map 1 p36.12 NCBI HuRef 1 20,248,246 - 20,353,123 (-) NCBI HuRef CHM1_1 1 22,116,743 - 22,222,156 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 21,502,254 - 21,607,091 (-) NCBI T2T-CHM13v2.0
Usp48 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 137,321,079 - 137,385,842 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 137,321,066 - 137,385,848 (+) Ensembl GRCm39 Ensembl GRCm38 4 137,594,120 - 137,658,537 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 137,593,755 - 137,658,537 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 137,150,104 - 137,214,452 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 135,261,884 - 135,263,495 (+) NCBI MGSCv36 mm8 MGSCv36 4 136,929,110 - 136,930,605 (+) NCBI MGSCv36 mm8 Celera 4 135,805,168 - 135,866,736 (+) NCBI Celera Cytogenetic Map 4 D3 NCBI cM Map 4 70.0 NCBI
Usp48 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 1,959,396 - 2,031,829 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 1,959,396 - 2,031,829 (-) NCBI ChiLan1.0 ChiLan1.0
USP48 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 205,156,524 - 205,262,860 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 204,268,387 - 204,374,735 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 20,870,023 - 20,974,251 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 21,834,330 - 21,939,250 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 21,834,638 - 21,939,250 (-) Ensembl panpan1.1 panPan2
USP48 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 77,401,101 - 77,484,139 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 77,379,440 - 77,484,089 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 73,903,899 - 73,988,493 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 77,959,166 - 78,043,360 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 77,933,330 - 78,043,356 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 74,778,845 - 74,862,587 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 75,788,846 - 75,873,345 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 76,791,995 - 76,876,474 (+) NCBI UU_Cfam_GSD_1.0
Usp48 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 41,483,213 - 41,551,300 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 7,307,439 - 7,376,074 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 7,307,475 - 7,376,086 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
USP48
USP48 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 110,854,966 - 110,958,140 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 110,854,758 - 110,960,529 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 5,331,713 - 5,436,227 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Usp48
.
Predicted Target Of
Count of predictions: 556 Count of miRNA genes: 255 Interacting mature miRNAs: 334 Transcripts: ENSRNOT00000031855 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 2302369 Scl60 Serum cholesterol level QTL 60 3.13 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 143608201 161165651 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 1300119 Bp180 Blood pressure QTL 180 3.82 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 144358090 157869054 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631263 Cm24 Cardiac mass QTL 24 3.5 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 5 143799107 158428037 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 2313096 Bmd78 Bone mineral density QTL 78 3.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 5 144377876 161317411 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat
D5Got89
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 149,802,648 - 149,802,819 (+) MAPPER mRatBN7.2 Rnor_6.0 5 155,937,541 - 155,937,711 NCBI Rnor6.0 Rnor_5.0 5 159,693,508 - 159,693,678 UniSTS Rnor5.0 RGSC_v3.4 5 156,353,104 - 156,353,274 UniSTS RGSC3.4 RGSC_v3.4 5 156,353,103 - 156,353,274 RGD RGSC3.4 RGSC_v3.4 5 156,311,849 - 156,312,022 RGD RGSC3.4 RGSC_v3.4 5 156,311,850 - 156,312,022 UniSTS RGSC3.4 RGSC_v3.1 5 156,363,142 - 156,363,313 RGD Celera 5 148,198,502 - 148,198,672 UniSTS RH 3.4 Map 5 1013.2 UniSTS RH 3.4 Map 5 1013.2 RGD Cytogenetic Map 5 q36 UniSTS
D5Kyo1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 149,859,140 - 149,859,339 (-) MAPPER mRatBN7.2 Rnor_6.0 18 73,418,416 - 73,418,614 NCBI Rnor6.0 Rnor_6.0 5 155,994,039 - 155,994,223 NCBI Rnor6.0 Rnor_5.0 5 159,750,008 - 159,750,206 UniSTS Rnor5.0 Rnor_5.0 18 73,094,373 - 73,094,571 UniSTS Rnor5.0 RGSC_v3.4 5 156,409,585 - 156,409,783 UniSTS RGSC3.4 Celera 5 148,255,284 - 148,255,468 UniSTS Cytogenetic Map 5 q36 UniSTS
RH128097
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 149,867,608 - 149,867,824 (-) MAPPER mRatBN7.2 mRatBN7.2 5 149,867,608 - 149,867,824 (+) MAPPER mRatBN7.2 Rnor_6.0 5 156,002,493 - 156,002,708 NCBI Rnor6.0 Rnor_6.0 18 73,409,930 - 73,410,145 NCBI Rnor6.0 Rnor_5.0 5 159,758,477 - 159,758,692 UniSTS Rnor5.0 Rnor_5.0 18 73,085,887 - 73,086,102 UniSTS Rnor5.0 RGSC_v3.4 5 156,418,054 - 156,418,269 UniSTS RGSC3.4 Celera 5 148,263,748 - 148,263,963 UniSTS RH 3.4 Map 5 1009.7 UniSTS Cytogenetic Map 5 q36 UniSTS
AW533548
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 149,865,636 - 149,865,843 (+) MAPPER mRatBN7.2 mRatBN7.2 5 149,865,636 - 149,865,843 (-) MAPPER mRatBN7.2 Rnor_6.0 18 73,411,911 - 73,412,117 NCBI Rnor6.0 Rnor_6.0 5 156,000,521 - 156,000,727 NCBI Rnor6.0 Rnor_5.0 5 159,756,505 - 159,756,711 UniSTS Rnor5.0 Rnor_5.0 18 73,087,868 - 73,088,074 UniSTS Rnor5.0 RGSC_v3.4 5 156,416,082 - 156,416,288 UniSTS RGSC3.4 Celera 5 148,261,776 - 148,261,982 UniSTS RH 3.4 Map 5 1010.8 UniSTS Cytogenetic Map 5 q36 UniSTS
rs66001705
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 149,810,483 - 149,810,483 RGD mRatBN7.2 Rnor_6.0 5 155,945,375 - 155,945,375 RGD Rnor6.0
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000031855 ⟹ ENSRNOP00000030008
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 149,800,657 - 149,867,719 (+) Ensembl Rnor_6.0 Ensembl 5 155,935,554 - 156,002,721 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000077933 ⟹ ENSRNOP00000069188
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 149,800,179 - 149,867,454 (+) Ensembl Rnor_6.0 Ensembl 5 155,934,490 - 156,000,528 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000112285 ⟹ ENSRNOP00000095844
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 149,800,657 - 149,867,719 (+) Ensembl
RefSeq Acc Id:
NM_198785 ⟹ NP_942080
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 155,084,038 - 155,151,208 (+) NCBI mRatBN7.2 5 149,800,662 - 149,867,838 (+) NCBI Rnor_6.0 5 155,935,554 - 156,002,722 (+) NCBI Rnor_5.0 5 159,690,824 - 159,758,706 (+) NCBI RGSC_v3.4 5 156,351,117 - 156,418,283 (+) RGD Celera 5 148,196,521 - 148,263,977 (+) RGD
Sequence:
CAGCTGGGCGCGGGCGGGAGGGTGCGGCGGCTGTGGCGCGCGCAGGTGATTGACTGGTCCCTTGGCTGAGGGGAGCGCTTGGTTCTTTCGGCTGGCAGGTGCCAGTGCCCGTTCGGGCGGAGACGGAG
hide sequence
RefSeq Acc Id:
XM_006239234 ⟹ XP_006239296
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 155,083,520 - 155,151,208 (+) NCBI mRatBN7.2 5 149,800,189 - 149,867,838 (+) NCBI Rnor_6.0 5 155,935,103 - 156,002,722 (+) NCBI Rnor_5.0 5 159,690,824 - 159,758,706 (+) NCBI
Sequence:
AGAGAGCACGGGAAGGGAGCCGGAACCGGTCCAGGCTCAAGTTAAATCATCCTCCAGGGATCCGACTCTGGAGTTCTGGCTGACCCGGTTTCTACTATTAACAGGTCCCACCCACAGTCCCGGCAGCC
hide sequence
RefSeq Acc Id:
XM_006239235 ⟹ XP_006239297
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 155,083,520 - 155,151,208 (+) NCBI mRatBN7.2 5 149,800,189 - 149,867,838 (+) NCBI Rnor_6.0 5 155,935,103 - 156,002,722 (+) NCBI Rnor_5.0 5 159,690,824 - 159,758,706 (+) NCBI
Sequence:
AGAGAGCACGGGAAGGGAGCCGGAACCGGTCCAGGCTCAAGTTAAATCATCCTCCAGGGATCCGACTCTGGAGTTCTGGCTGACCCGGTTTCTACTATTAACAGGTCCCACCCACAGTCCCGGCAGCC
hide sequence
RefSeq Acc Id:
XM_006239236 ⟹ XP_006239298
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 155,083,520 - 155,151,208 (+) NCBI mRatBN7.2 5 149,800,189 - 149,867,838 (+) NCBI Rnor_6.0 5 155,935,103 - 156,002,722 (+) NCBI Rnor_5.0 5 159,690,824 - 159,758,706 (+) NCBI
Sequence:
AGAGAGCACGGGAAGGGAGCCGGAACCGGTCCAGGCTCAAGTTAAATCATCCTCCAGGGATCCGACTCTGGAGTTCTGGCTGACCCGGTTTCTACTATTAACAGGTCCCACCCACAGTCCCGGCAGCC
hide sequence
RefSeq Acc Id:
XM_006239237 ⟹ XP_006239299
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 155,083,520 - 155,151,208 (+) NCBI mRatBN7.2 5 149,800,189 - 149,867,838 (+) NCBI Rnor_6.0 5 155,935,103 - 156,002,722 (+) NCBI Rnor_5.0 5 159,690,824 - 159,758,706 (+) NCBI
Sequence:
AGAGAGCACGGGAAGGGAGCCGGAACCGGTCCAGGCTCAAGTTAAATCATCCTCCAGGGATCCGACTCTGGAGTTCTGGCTGACCCGGTTTCTACTATTAACAGGTCCCACCCACAGTCCCGGCAGCC
hide sequence
RefSeq Acc Id:
XM_039110421 ⟹ XP_038966349
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 155,083,520 - 155,113,275 (+) NCBI mRatBN7.2 5 149,800,189 - 149,829,903 (+) NCBI
RefSeq Acc Id:
XR_592739
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 155,083,520 - 155,129,724 (+) NCBI mRatBN7.2 5 149,800,189 - 149,853,702 (+) NCBI Rnor_6.0 5 155,935,102 - 155,988,600 (+) NCBI
Sequence:
CAGAGAGCACGGGAAGGGAGCCGGAACCGGTCCAGGCTCAAGTTAAATCATCCTCCAGGGATCCGACTCTGGAGTTCTGGCTGACCCGGTTTCTACTATTAACAGGTCCCACCCACAGTCCCGGCAGC
hide sequence
RefSeq Acc Id:
NP_942080 ⟸ NM_198785
- UniProtKB:
Q76LT8 (UniProtKB/Swiss-Prot)
- Sequence:
MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCRGNPNCLVGIGEHIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGASCYVNTFLQVWFLNLELRQALYLCPSTCSDYT
hide sequence
RefSeq Acc Id:
XP_006239298 ⟸ XM_006239236
- Peptide Label:
isoform X3
- UniProtKB:
Q76LT8 (UniProtKB/Swiss-Prot)
- Sequence:
MVCQCPFGRRRRRRRRPPGSASAISVKAMAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWL
hide sequence
RefSeq Acc Id:
XP_006239299 ⟸ XM_006239237
- Peptide Label:
isoform X4
- UniProtKB:
Q76LT8 (UniProtKB/Swiss-Prot)
- Sequence:
MVCQCPFGRRRRRRRRPPGSASAISVKAMAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCRGNPNCLVGIGEHIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYV
hide sequence
RefSeq Acc Id:
XP_006239296 ⟸ XM_006239234
- Peptide Label:
isoform X1
- UniProtKB:
Q76LT8 (UniProtKB/Swiss-Prot), A0A0G2JUQ8 (UniProtKB/TrEMBL)
- Sequence:
MVCQCPFGRRRRRRRRPPGSASAISVKAMAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWL
hide sequence
RefSeq Acc Id:
XP_006239297 ⟸ XM_006239235
- Peptide Label:
isoform X2
- UniProtKB:
Q76LT8 (UniProtKB/Swiss-Prot)
- Sequence:
MVCQCPFGRRRRRRRRPPGSASAISVKAMAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCRGNPNCLVGIGEHIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYV
hide sequence
Ensembl Acc Id:
ENSRNOP00000030008 ⟸ ENSRNOT00000031855
Ensembl Acc Id:
ENSRNOP00000069188 ⟸ ENSRNOT00000077933
RefSeq Acc Id:
XP_038966349 ⟸ XM_039110421
- Peptide Label:
isoform X5
Ensembl Acc Id:
ENSRNOP00000095844 ⟸ ENSRNOT00000112285
RGD ID: 13694181 Promoter ID: EPDNEW_R4706 Type: initiation region Name: Usp48_1 Description: ubiquitin specific peptidase 48 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 155,935,534 - 155,935,594 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Usp48
ubiquitin specific peptidase 48
LOC100911993
ubiquitin carboxyl-terminal hydrolase 48-like
Data merged from RGD:6489246
737654 PROVISIONAL
2012-07-05
LOC100911993
ubiquitin carboxyl-terminal hydrolase 48-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2010-05-07
Usp48
ubiquitin specific peptidase 48
Usp48
ubiquitin specific protease 48
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Usp48
ubiquitin specific protease 48
Usp31
ubiquitin specific protease 31
Symbol and Name updated
1299863 APPROVED
