Symbol:
Gstk1
Name:
glutathione S-transferase kappa 1
RGD ID:
735188
Description:
Predicted to enable glutathione peroxidase activity and glutathione transferase activity. Predicted to be involved in epithelial cell differentiation and glutathione metabolic process. Located in mitochondrial matrix. Orthologous to human GSTK1 (glutathione S-transferase kappa 1); PARTICIPATES IN glutathione conjugation pathway; glutathione metabolic pathway; phase I biotransformation pathway via cytochrome P450; INTERACTS WITH 1,3-dinitrobenzene; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
glutathione S-transferase subunit 13; glutathione S-transferase, mitochondrial; GST 13-13; GST class-kappa; GST13-13; GSTK1-1; GSTkappa; rGSTK1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 72,085,532 - 72,089,934 (+) NCBI GRCr8 mRatBN7.2 4 71,118,979 - 71,123,298 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 71,118,896 - 71,123,292 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 76,038,785 - 76,043,096 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 71,952,032 - 71,956,343 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 70,371,499 - 70,375,808 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 71,621,777 - 71,626,096 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 71,621,729 - 71,626,107 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 136,427,328 - 136,431,713 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 69,999,767 - 70,004,086 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 70,275,896 - 70,280,216 (+) NCBI Celera 4 66,050,514 - 66,054,833 (+) NCBI Celera Cytogenetic Map 4 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gstk1 Rat (+)-dexrazoxane multiple interactions ISO Gstk1 (Mus musculus) 6480464 [Doxorubicin co-treated with Dexrazoxane] results in increased expression of GSTK1 mRNA CTD PMID:26873546 Gstk1 Rat (S)-nicotine decreases expression ISO Gstk1 (Mus musculus) 6480464 Nicotine results in decreased expression of GSTK1 mRNA CTD PMID:17997037 Gstk1 Rat 1,3-dinitrobenzene increases oxidation EXP 6480464 3-dinitrobenzene results in increased oxidation of GSTK1 protein CTD PMID:25716674 Gstk1 Rat 1-naphthyl isothiocyanate multiple interactions ISO GSTK1 (Homo sapiens) 6480464 [1-Naphthylisothiocyanate co-treated with Cholic Acids] affects the expression of GSTK1 mRNA CTD PMID:27344345 Gstk1 Rat 17beta-estradiol decreases expression ISO GSTK1 (Homo sapiens) 6480464 Estradiol results in decreased expression of GSTK1 mRNA CTD PMID:23019147 Gstk1 Rat 17beta-estradiol decreases expression ISO Gstk1 (Mus musculus) 6480464 Estradiol results in decreased expression of GSTK1 mRNA CTD PMID:39298647 Gstk1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of GSTK1 mRNA CTD PMID:32145629 Gstk1 Rat 1H-pyrazole decreases expression ISO Gstk1 (Mus musculus) 6480464 pyrazole results in decreased expression of GSTK1 mRNA CTD PMID:17945193 Gstk1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Gstk1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Gstk1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO GSTK1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Gstk1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Gstk1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GSTK1 mRNA CTD PMID:19770486 Gstk1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GSTK1 mRNA CTD PMID:18796159 more ... Gstk1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Gstk1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GSTK1 mRNA CTD PMID:21570461 Gstk1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Gstk1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to GSTK1 promoter] CTD PMID:19654925 Gstk1 Rat 2,4,6-tribromophenol decreases expression ISO GSTK1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Gstk1 Rat 3-methylcholanthrene increases expression EXP 6480464 Methylcholanthrene results in increased expression of GSTK1 mRNA CTD PMID:23273579 Gstk1 Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of GSTK1 mRNA CTD PMID:19162173 Gstk1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Gstk1 (Mus musculus) 6480464 bisphenol S results in decreased expression of GSTK1 mRNA CTD PMID:39298647 Gstk1 Rat 4,4'-sulfonyldiphenol increases expression ISO GSTK1 (Homo sapiens) 6480464 bisphenol S results in increased expression of GSTK1 protein CTD PMID:34186270 Gstk1 Rat 4-nitrophenol decreases expression ISO Gstk1 (Mus musculus) 6480464 4-nitrophenol results in decreased expression of GSTK1 mRNA CTD PMID:34673133 Gstk1 Rat 5-aza-2'-deoxycytidine multiple interactions ISO Gstk1 (Mus musculus) 6480464 [Decitabine co-treated with trichostatin A] results in increased expression of GSTK1 mRNA CTD PMID:19444856 Gstk1 Rat 8'-apo-beta,psi-caroten-8'-al decreases expression ISO GSTK1 (Homo sapiens) 6480464 apocarotenal results in decreased expression of GSTK1 mRNA CTD PMID:17034753 Gstk1 Rat aflatoxin B1 affects expression ISO GSTK1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of GSTK1 protein CTD PMID:20106945 Gstk1 Rat aflatoxin B1 decreases expression ISO Gstk1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of GSTK1 mRNA CTD PMID:19770486 Gstk1 Rat AICA ribonucleotide increases expression ISO Gstk1 (Mus musculus) 6480464 AICA ribonucleotide results in increased expression of GSTK1 protein CTD PMID:20980258 Gstk1 Rat alpha-hexachlorocyclohexane increases expression EXP 6480464 alpha-hexachlorocyclohexane results in increased expression of GSTK1 mRNA CTD PMID:16940010 Gstk1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GSTK1 mRNA CTD PMID:16483693 Gstk1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of GSTK1 mRNA CTD PMID:30779732 Gstk1 Rat arsane multiple interactions EXP 6480464 [sodium arsenite results in increased abundance of Arsenic] which affects the expression of GSTK1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GSTK1 mRNA CTD PMID:33127376 and PMID:33171135 Gstk1 Rat arsane multiple interactions ISO GSTK1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of GSTK1 mRNA CTD PMID:39836092 Gstk1 Rat arsenic atom multiple interactions EXP 6480464 [sodium arsenite results in increased abundance of Arsenic] which affects the expression of GSTK1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GSTK1 mRNA CTD PMID:33127376 and PMID:33171135 Gstk1 Rat arsenic atom multiple interactions ISO GSTK1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of GSTK1 mRNA CTD PMID:39836092 Gstk1 Rat atrazine increases expression EXP 6480464 Atrazine results in increased expression of GSTK1 mRNA CTD PMID:28882082 Gstk1 Rat Azoxymethane multiple interactions ISO Gstk1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of GSTK1 mRNA CTD PMID:29950665 Gstk1 Rat azoxystrobin multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of GSTK1 mRNA CTD PMID:33854195 Gstk1 Rat benzo[a]pyrene affects expression ISO Gstk1 (Mus musculus) 6480464 Benzo(a)pyrene affects the expression of GSTK1 mRNA CTD PMID:20127859 Gstk1 Rat benzo[a]pyrene decreases expression ISO GSTK1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of GSTK1 mRNA CTD PMID:32234424 Gstk1 Rat beta-carotene decreases expression ISO GSTK1 (Homo sapiens) 6480464 beta Carotene results in decreased expression of GSTK1 mRNA CTD PMID:17034753 Gstk1 Rat beta-lapachone increases expression ISO GSTK1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of GSTK1 mRNA CTD PMID:38218311 Gstk1 Rat beta-lapachone decreases expression ISO GSTK1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of GSTK1 mRNA CTD PMID:38218311 Gstk1 Rat bilirubin IXalpha decreases expression ISO GSTK1 (Homo sapiens) 6480464 Bilirubin results in decreased expression of GSTK1 mRNA CTD PMID:20196124 Gstk1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Gstk1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of GSTK1 mRNA CTD PMID:19850644 Gstk1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Gstk1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of GSTK1 mRNA CTD PMID:34319233 Gstk1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO GSTK1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of GSTK1 protein CTD PMID:31163220 Gstk1 Rat bis(2-ethylhexyl) phthalate increases expression ISO GSTK1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of GSTK1 mRNA CTD PMID:31163220 Gstk1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Gstk1 (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of GSTK1 mRNA] CTD PMID:19850644 Gstk1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GSTK1 mRNA CTD PMID:25181051 Gstk1 Rat bisphenol A increases expression ISO GSTK1 (Homo sapiens) 6480464 bisphenol A results in increased expression of GSTK1 protein CTD PMID:37567409 Gstk1 Rat bisphenol A decreases expression ISO GSTK1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of GSTK1 protein CTD PMID:31675489 Gstk1 Rat bisphenol A increases expression ISO Gstk1 (Mus musculus) 6480464 bisphenol A results in increased expression of GSTK1 mRNA CTD PMID:33221593 Gstk1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GSTK1 mRNA CTD PMID:32145629 Gstk1 Rat bisphenol A affects expression ISO GSTK1 (Homo sapiens) 6480464 bisphenol A affects the expression of GSTK1 mRNA CTD PMID:30903817 Gstk1 Rat bisphenol AF increases expression ISO GSTK1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of GSTK1 protein CTD PMID:34186270 Gstk1 Rat Bisphenol B increases expression ISO GSTK1 (Homo sapiens) 6480464 bisphenol B results in increased expression of GSTK1 protein CTD PMID:34186270 Gstk1 Rat bleomycin A5 decreases expression ISO GSTK1 (Homo sapiens) 6480464 bleomycetin results in decreased expression of GSTK1 mRNA CTD PMID:21040473 Gstk1 Rat cadmium dichloride decreases expression ISO Gstk1 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of GSTK1 mRNA CTD PMID:20061341 Gstk1 Rat chenodeoxycholic acid multiple interactions ISO GSTK1 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of GSTK1 mRNA CTD PMID:32152650 Gstk1 Rat chlordecone increases expression ISO Gstk1 (Mus musculus) 6480464 Chlordecone results in increased expression of GSTK1 mRNA CTD PMID:33711761 Gstk1 Rat chloropicrin increases expression ISO GSTK1 (Homo sapiens) 6480464 chloropicrin results in increased expression of GSTK1 mRNA CTD PMID:26352163 Gstk1 Rat chlorpyrifos affects expression EXP 6480464 Chlorpyrifos affects the expression of GSTK1 mRNA CTD PMID:19440498 Gstk1 Rat chlorpyrifos multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of GSTK1 mRNA CTD PMID:33854195 Gstk1 Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of GSTK1 mRNA CTD PMID:19440498 Gstk1 Rat ciprofibrate increases expression ISO Gstk1 (Mus musculus) 6480464 ciprofibrate results in increased expression of GSTK1 mRNA CTD PMID:18723825 Gstk1 Rat cisplatin decreases expression ISO Gstk1 (Mus musculus) 6480464 Cisplatin results in decreased expression of GSTK1 mRNA CTD PMID:24865317 Gstk1 Rat cisplatin multiple interactions ISO Gstk1 (Mus musculus) 6480464 [Cisplatin co-treated with Lutein] results in decreased expression of GSTK1 mRNA CTD PMID:24865317 Gstk1 Rat clofibrate multiple interactions ISO Gstk1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of GSTK1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of GSTK1 mRNA] CTD PMID:17585979 Gstk1 Rat clofibrate increases expression ISO Gstk1 (Mus musculus) 6480464 Clofibrate results in increased expression of GSTK1 mRNA CTD PMID:18723825 Gstk1 Rat cobalt dichloride decreases expression ISO GSTK1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of GSTK1 mRNA CTD PMID:19320972 and PMID:19376846 Gstk1 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of GSTK1 mRNA CTD PMID:22465980 Gstk1 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of GSTK1 mRNA CTD PMID:22465980 Gstk1 Rat copper(II) sulfate decreases expression ISO GSTK1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of GSTK1 mRNA CTD PMID:19549813 Gstk1 Rat curcumin multiple interactions ISO GSTK1 (Homo sapiens) 6480464 Curcumin inhibits the reaction [Hydrogen Peroxide results in decreased expression of GSTK1 mRNA] CTD PMID:31521693 Gstk1 Rat cyclosporin A decreases expression ISO Gstk1 (Mus musculus) 6480464 Cyclosporine results in decreased expression of GSTK1 mRNA CTD PMID:19770486 and PMID:23830897 Gstk1 Rat cyclosporin A multiple interactions ISO GSTK1 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of GSTK1 mRNA CTD PMID:32152650 Gstk1 Rat cyclosporin A decreases expression ISO GSTK1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of GSTK1 mRNA CTD PMID:20106945 more ... Gstk1 Rat cypermethrin increases expression ISO Gstk1 (Mus musculus) 6480464 cypermethrin results in increased expression of GSTK1 mRNA CTD PMID:21142847 Gstk1 Rat deoxycholic acid multiple interactions ISO GSTK1 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of GSTK1 mRNA CTD PMID:32152650 Gstk1 Rat dextran sulfate multiple interactions ISO Gstk1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of GSTK1 mRNA and evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of GSTK1 protein] CTD PMID:29950665 and PMID:35362542 Gstk1 Rat dextran sulfate increases expression ISO Gstk1 (Mus musculus) 6480464 Dextran Sulfate results in increased expression of GSTK1 protein CTD PMID:35362542 Gstk1 Rat diazinon decreases expression EXP 6480464 Diazinon results in decreased expression of GSTK1 mRNA CTD PMID:19440498 Gstk1 Rat dichlorine increases expression EXP 6480464 Chlorine results in increased expression of GSTK1 mRNA CTD PMID:18636392 Gstk1 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of GSTK1 mRNA CTD PMID:18636392 Gstk1 Rat diethyl maleate multiple interactions ISO Gstk1 (Mus musculus) 6480464 [diethyl maleate results in decreased abundance of Glutathione] which results in decreased expression of GSTK1 mRNA CTD PMID:22564015 Gstk1 Rat dimethyl sulfoxide affects expression ISO GSTK1 (Homo sapiens) 6480464 Dimethyl Sulfoxide affects the expression of GSTK1 mRNA CTD PMID:24834073 Gstk1 Rat dinophysistoxin 1 decreases expression ISO GSTK1 (Homo sapiens) 6480464 dinophysistoxin 1 results in decreased expression of GSTK1 mRNA CTD PMID:28939011 Gstk1 Rat dioxygen multiple interactions ISO Gstk1 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of GSTK1 mRNA CTD PMID:30529165 Gstk1 Rat disodium selenite increases expression ISO GSTK1 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of GSTK1 mRNA CTD PMID:18175754 Gstk1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of GSTK1 mRNA CTD PMID:21551480 Gstk1 Rat dorsomorphin multiple interactions ISO Gstk1 (Mus musculus) 6480464 dorsomorphin inhibits the reaction [Resveratrol results in increased expression of GSTK1 protein] CTD PMID:20980258 Gstk1 Rat doxorubicin decreases expression ISO Gstk1 (Mus musculus) 6480464 Doxorubicin results in decreased expression of GSTK1 mRNA CTD PMID:26873546 Gstk1 Rat doxorubicin affects expression ISO GSTK1 (Homo sapiens) 6480464 Doxorubicin affects the expression of GSTK1 protein CTD PMID:29385562 Gstk1 Rat doxorubicin multiple interactions ISO Gstk1 (Mus musculus) 6480464 [Doxorubicin co-treated with Dexrazoxane] results in increased expression of GSTK1 mRNA CTD PMID:26873546 Gstk1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of GSTK1 mRNA CTD PMID:29391264 Gstk1 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of GSTK1 mRNA CTD PMID:23273579 Gstk1 Rat ethanol increases expression ISO Gstk1 (Mus musculus) 6480464 Ethanol results in increased expression of GSTK1 mRNA CTD PMID:30319688 Gstk1 Rat Evodiamine multiple interactions ISO Gstk1 (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of GSTK1 protein] CTD PMID:35362542 Gstk1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of GSTK1 mRNA CTD PMID:24793618 Gstk1 Rat genistein multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in decreased expression of GSTK1 mRNA CTD PMID:21782745 Gstk1 Rat glutathione multiple interactions ISO Gstk1 (Mus musculus) 6480464 [diethyl maleate results in decreased abundance of Glutathione] which results in decreased expression of GSTK1 mRNA CTD PMID:22564015 Gstk1 Rat glycidyl methacrylate decreases expression ISO GSTK1 (Homo sapiens) 6480464 glycidyl methacrylate results in decreased expression of GSTK1 protein CTD PMID:36641056 Gstk1 Rat glycochenodeoxycholic acid multiple interactions ISO GSTK1 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of GSTK1 mRNA CTD PMID:32152650 Gstk1 Rat glycocholic acid multiple interactions ISO GSTK1 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of GSTK1 mRNA CTD PMID:32152650 Gstk1 Rat glycodeoxycholic acid multiple interactions ISO GSTK1 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of GSTK1 mRNA CTD PMID:32152650 Gstk1 Rat glyphosate multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of GSTK1 mRNA CTD PMID:33854195 Gstk1 Rat hydrogen peroxide multiple interactions ISO GSTK1 (Homo sapiens) 6480464 4-((alpha-L-rhamnosyloxy)benzyl)isothiocyanate inhibits the reaction [Hydrogen Peroxide results in decreased expression of GSTK1 mRNA] and Curcumin inhibits the reaction [Hydrogen Peroxide results in decreased expression of GSTK1 mRNA] CTD PMID:31521693 Gstk1 Rat hydrogen peroxide decreases expression ISO GSTK1 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of GSTK1 mRNA CTD PMID:31521693 Gstk1 Rat imidacloprid multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of GSTK1 mRNA CTD PMID:33854195 Gstk1 Rat isoflavones increases expression ISO GSTK1 (Homo sapiens) 6480464 Isoflavones results in increased expression of GSTK1 mRNA CTD PMID:17374662 Gstk1 Rat ivermectin decreases expression ISO GSTK1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of GSTK1 protein CTD PMID:32959892 Gstk1 Rat lead diacetate decreases expression ISO Gstk1 (Mus musculus) 6480464 lead acetate results in decreased expression of GSTK1 mRNA CTD PMID:29746905 Gstk1 Rat lutein multiple interactions ISO Gstk1 (Mus musculus) 6480464 [Cisplatin co-treated with Lutein] results in decreased expression of GSTK1 mRNA CTD PMID:24865317 Gstk1 Rat methoxychlor multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in decreased expression of GSTK1 mRNA CTD PMID:21782745 Gstk1 Rat methylmercury chloride decreases expression ISO Gstk1 (Mus musculus) 6480464 methylmercuric chloride results in decreased expression of GSTK1 mRNA CTD PMID:20061341 Gstk1 Rat methylmercury chloride decreases expression ISO GSTK1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of GSTK1 mRNA CTD PMID:23179753 Gstk1 Rat microcystin affects expression EXP 6480464 Microcystins affects the expression of GSTK1 mRNA CTD PMID:19790251 Gstk1 Rat microcystin increases expression EXP 6480464 Microcystins results in increased expression of GSTK1 mRNA CTD PMID:19790251 Gstk1 Rat microcystin-LR decreases expression ISO Gstk1 (Mus musculus) 6480464 cyanoginosin LR results in decreased expression of GSTK1 mRNA CTD PMID:17654400 Gstk1 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of GSTK1 mRNA CTD PMID:28659758 Gstk1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 caffeic acid phenethyl ester inhibits the reaction [Diethylnitrosamine results in increased expression of GSTK1 mRNA] CTD PMID:20360939 Gstk1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of GSTK1 mRNA CTD PMID:20360939 Gstk1 Rat naphthalene decreases expression ISO Gstk1 (Mus musculus) 6480464 naphthalene results in decreased expression of GSTK1 mRNA CTD PMID:31020322 Gstk1 Rat nickel atom decreases expression EXP 6480464 Nickel results in decreased expression of GSTK1 mRNA CTD PMID:19440498 Gstk1 Rat nicotine decreases expression ISO Gstk1 (Mus musculus) 6480464 Nicotine results in decreased expression of GSTK1 mRNA CTD PMID:17997037 Gstk1 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of GSTK1 mRNA CTD PMID:33484710 Gstk1 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of GSTK1 mRNA CTD PMID:23358140 Gstk1 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of GSTK1 mRNA CTD PMID:18636392 Gstk1 Rat paracetamol multiple interactions ISO Gstk1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of GSTK1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of GSTK1 mRNA] CTD PMID:17585979 Gstk1 Rat paracetamol decreases expression ISO GSTK1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of GSTK1 mRNA CTD PMID:29067470 Gstk1 Rat paracetamol increases expression ISO GSTK1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of GSTK1 mRNA CTD PMID:25704631 Gstk1 Rat paracetamol affects expression ISO Gstk1 (Mus musculus) 6480464 Acetaminophen affects the expression of GSTK1 mRNA CTD PMID:17562736 Gstk1 Rat perfluorooctanoic acid affects expression ISO Gstk1 (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of GSTK1 mRNA CTD PMID:18281256 Gstk1 Rat permethrin multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of GSTK1 mRNA CTD PMID:28659758 Gstk1 Rat phenethyl caffeate multiple interactions EXP 6480464 caffeic acid phenethyl ester inhibits the reaction [Diethylnitrosamine results in increased expression of GSTK1 mRNA] CTD PMID:20360939 Gstk1 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of GSTK1 mRNA CTD PMID:16940010 more ... Gstk1 Rat phenylephrine decreases expression EXP 6480464 Phenylephrine results in decreased expression of GSTK1 mRNA CTD PMID:18158353 Gstk1 Rat phenytoin decreases expression ISO GSTK1 (Homo sapiens) 6480464 Phenytoin results in decreased expression of GSTK1 mRNA CTD PMID:14741686 Gstk1 Rat PhIP decreases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in decreased expression of GSTK1 mRNA CTD PMID:33945839 Gstk1 Rat phlorizin decreases expression ISO Gstk1 (Mus musculus) 6480464 Phlorhizin results in decreased expression of GSTK1 mRNA CTD PMID:22538082 Gstk1 Rat pirinixic acid increases expression ISO Gstk1 (Mus musculus) 6480464 pirinixic acid results in increased expression of GSTK1 mRNA CTD PMID:17426115 more ... Gstk1 Rat pravastatin decreases expression EXP 6480464 Pravastatin results in decreased expression of GSTK1 mRNA CTD PMID:27225895 Gstk1 Rat pravastatin decreases expression ISO Gstk1 (Mus musculus) 6480464 Pravastatin results in decreased expression of GSTK1 mRNA CTD PMID:27225895 Gstk1 Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of GSTK1 mRNA CTD PMID:20726854 Gstk1 Rat Pyridostigmine bromide multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of GSTK1 mRNA CTD PMID:28659758 Gstk1 Rat quercetin decreases expression ISO Gstk1 (Mus musculus) 6480464 Quercetin results in decreased expression of GSTK1 mRNA CTD PMID:16455785 Gstk1 Rat quercetin decreases expression ISO GSTK1 (Homo sapiens) 6480464 Quercetin results in decreased expression of GSTK1 mRNA CTD PMID:21632981 Gstk1 Rat resveratrol multiple interactions ISO Gstk1 (Mus musculus) 6480464 dorsomorphin inhibits the reaction [Resveratrol results in increased expression of GSTK1 protein] more ... CTD PMID:20980258 Gstk1 Rat resveratrol increases expression ISO Gstk1 (Mus musculus) 6480464 resveratrol results in increased expression of GSTK1 mRNA and resveratrol results in increased expression of GSTK1 protein CTD PMID:20980258 Gstk1 Rat resveratrol affects response to substance ISO Gstk1 (Mus musculus) 6480464 GSTK1 protein affects the susceptibility to resveratrol CTD PMID:20980258 Gstk1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of GSTK1 mRNA CTD PMID:28374803 Gstk1 Rat SB 431542 increases expression ISO GSTK1 (Homo sapiens) 6480464 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide results in increased expression of GSTK1 protein CTD PMID:25670856 Gstk1 Rat silicon dioxide increases expression ISO GSTK1 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of GSTK1 mRNA CTD PMID:32600046 Gstk1 Rat silver atom increases expression ISO Gstk1 (Mus musculus) 6480464 Silver results in increased expression of GSTK1 mRNA CTD PMID:19429238 and PMID:27131904 Gstk1 Rat silver(0) increases expression ISO Gstk1 (Mus musculus) 6480464 Silver results in increased expression of GSTK1 mRNA CTD PMID:19429238 and PMID:27131904 Gstk1 Rat sodium arsenite affects expression ISO GSTK1 (Homo sapiens) 6480464 sodium arsenite affects the expression of GSTK1 mRNA CTD PMID:29319823 Gstk1 Rat sodium arsenite multiple interactions ISO GSTK1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of GSTK1 mRNA CTD PMID:39836092 Gstk1 Rat sodium arsenite decreases expression ISO GSTK1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of GSTK1 mRNA CTD PMID:38568856 Gstk1 Rat sodium arsenite multiple interactions EXP 6480464 [sodium arsenite results in increased abundance of Arsenic] which affects the expression of GSTK1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GSTK1 mRNA CTD PMID:33127376 and PMID:33171135 Gstk1 Rat sodium fluoride decreases expression EXP 6480464 Sodium Fluoride results in decreased expression of GSTK1 protein CTD PMID:28089781 Gstk1 Rat tert-butyl hydroperoxide decreases expression ISO GSTK1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of GSTK1 mRNA CTD PMID:15336504 Gstk1 Rat tetrachloromethane decreases expression ISO Gstk1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of GSTK1 mRNA CTD PMID:27339419 and PMID:31919559 Gstk1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of GSTK1 mRNA CTD PMID:31150632 Gstk1 Rat thiabendazole multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of GSTK1 mRNA CTD PMID:33854195 Gstk1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of GSTK1 mRNA CTD PMID:34492290 Gstk1 Rat thiram decreases expression ISO GSTK1 (Homo sapiens) 6480464 Thiram results in decreased expression of GSTK1 mRNA CTD PMID:38568856 Gstk1 Rat titanium dioxide multiple interactions ISO Gstk1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of GSTK1 mRNA CTD PMID:29950665 Gstk1 Rat triazines multiple interactions ISO Gstk1 (Mus musculus) 6480464 Triazines inhibits the reaction [IDH2 protein mutant form results in decreased expression of GSTK1 mRNA] CTD PMID:27469509 Gstk1 Rat trichostatin A multiple interactions ISO Gstk1 (Mus musculus) 6480464 [decitabine co-treated with trichostatin A] results in increased expression of GSTK1 mRNA CTD PMID:19444856 Gstk1 Rat triphenyl phosphate affects expression ISO GSTK1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of GSTK1 mRNA CTD PMID:37042841 Gstk1 Rat tunicamycin decreases expression ISO Gstk1 (Mus musculus) 6480464 Tunicamycin results in decreased expression of GSTK1 mRNA CTD PMID:17127020 Gstk1 Rat vancomycin increases expression ISO Gstk1 (Mus musculus) 6480464 Vancomycin results in increased expression of GSTK1 mRNA CTD PMID:18930951 Gstk1 Rat vitamin E increases expression ISO GSTK1 (Homo sapiens) 6480464 Vitamin E results in increased expression of GSTK1 mRNA CTD PMID:19244175 Gstk1 Rat XL147 multiple interactions ISO Gstk1 (Mus musculus) 6480464 XL147 inhibits the reaction [N-nitroso-tris-chloroethylurea results in increased expression of GSTK1 mRNA] CTD PMID:29891994 Gstk1 Rat zaragozic acid A increases expression EXP 6480464 squalestatin 1 results in increased expression of GSTK1 mRNA CTD PMID:27225895 Gstk1 Rat zaragozic acid A affects expression ISO Gstk1 (Mus musculus) 6480464 squalestatin 1 affects the expression of GSTK1 mRNA CTD PMID:27225895
Imported Annotations - KEGG (archival)
(+)-dexrazoxane (ISO) (S)-nicotine (ISO) 1,3-dinitrobenzene (EXP) 1-naphthyl isothiocyanate (ISO) 17beta-estradiol (EXP,ISO) 1H-pyrazole (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 3-methylcholanthrene (EXP) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-nitrophenol (ISO) 5-aza-2'-deoxycytidine (ISO) 8'-apo-beta,psi-caroten-8'-al (ISO) aflatoxin B1 (ISO) AICA ribonucleotide (ISO) alpha-hexachlorocyclohexane (EXP) ammonium chloride (EXP) amphetamine (EXP) arsane (EXP,ISO) arsenic atom (EXP,ISO) atrazine (EXP) Azoxymethane (ISO) azoxystrobin (EXP) benzo[a]pyrene (ISO) beta-carotene (ISO) beta-lapachone (ISO) bilirubin IXalpha (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bleomycin A5 (ISO) cadmium dichloride (ISO) chenodeoxycholic acid (ISO) chlordecone (ISO) chloropicrin (ISO) chlorpyrifos (EXP) ciprofibrate (ISO) cisplatin (ISO) clofibrate (ISO) cobalt dichloride (ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) curcumin (ISO) cyclosporin A (ISO) cypermethrin (ISO) deoxycholic acid (ISO) dextran sulfate (ISO) diazinon (EXP) dichlorine (EXP) diethyl maleate (ISO) dimethyl sulfoxide (ISO) dinophysistoxin 1 (ISO) dioxygen (ISO) disodium selenite (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) ethanol (EXP,ISO) Evodiamine (ISO) flutamide (EXP) genistein (EXP) glutathione (ISO) glycidyl methacrylate (ISO) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) glyphosate (EXP) hydrogen peroxide (ISO) imidacloprid (EXP) isoflavones (ISO) ivermectin (ISO) lead diacetate (ISO) lutein (ISO) methoxychlor (EXP) methylmercury chloride (ISO) microcystin (EXP) microcystin-LR (ISO) N,N-diethyl-m-toluamide (EXP) N-nitrosodiethylamine (EXP) naphthalene (ISO) nickel atom (EXP) nicotine (ISO) nitrofen (EXP) ochratoxin A (EXP) ozone (EXP) paracetamol (ISO) perfluorooctanoic acid (ISO) permethrin (EXP) phenethyl caffeate (EXP) phenobarbital (EXP) phenylephrine (EXP) phenytoin (ISO) PhIP (EXP) phlorizin (ISO) pirinixic acid (ISO) pravastatin (EXP,ISO) progesterone (EXP) Pyridostigmine bromide (EXP) quercetin (ISO) resveratrol (ISO) rotenone (EXP) SB 431542 (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (EXP,ISO) sodium fluoride (EXP) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP,ISO) thiabendazole (EXP) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) triazines (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) tunicamycin (ISO) vancomycin (ISO) vitamin E (ISO) XL147 (ISO) zaragozic acid A (EXP,ISO)
Gstk1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 72,085,532 - 72,089,934 (+) NCBI GRCr8 mRatBN7.2 4 71,118,979 - 71,123,298 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 71,118,896 - 71,123,292 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 76,038,785 - 76,043,096 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 71,952,032 - 71,956,343 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 70,371,499 - 70,375,808 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 71,621,777 - 71,626,096 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 71,621,729 - 71,626,107 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 136,427,328 - 136,431,713 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 69,999,767 - 70,004,086 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 70,275,896 - 70,280,216 (+) NCBI Celera 4 66,050,514 - 66,054,833 (+) NCBI Celera Cytogenetic Map 4 q24 NCBI
GSTK1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 143,263,441 - 143,269,115 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 143,244,093 - 143,270,854 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 142,960,534 - 142,966,208 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 142,670,686 - 142,676,328 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 7 137,797,393 - 137,803,091 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI HuRef 7 137,297,887 - 137,303,587 (+) NCBI HuRef CHM1_1 7 142,897,388 - 142,903,108 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 144,618,862 - 144,624,534 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 142,362,642 - 142,368,342 (+) NCBI
Gstk1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 42,222,869 - 42,227,375 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 42,222,869 - 42,227,381 (+) Ensembl GRCm39 Ensembl GRCm38 6 42,245,935 - 42,250,441 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 42,245,935 - 42,250,447 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 42,195,934 - 42,200,440 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 42,175,542 - 42,180,048 (+) NCBI MGSCv36 mm8 Celera 6 42,190,122 - 42,194,626 (+) NCBI Celera Cytogenetic Map 6 B2.1 NCBI cM Map 6 20.52 NCBI
Gstk1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955494 383,341 - 387,630 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955494 383,107 - 387,483 (-) NCBI ChiLan1.0 ChiLan1.0
GSTK1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 180,116,341 - 180,122,050 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 32,126,607 - 32,136,166 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 135,258,184 - 135,267,254 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 147,749,461 - 147,755,158 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 147,749,461 - 147,755,158 (+) Ensembl panpan1.1 panPan2
GSTK1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 16 6,411,678 - 6,416,135 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 16 7,400,563 - 7,405,021 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 16 6,265,390 - 6,269,847 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 16 6,265,390 - 6,269,842 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 16 6,212,775 - 6,217,230 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 16 6,064,698 - 6,069,155 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 16 6,140,101 - 6,144,565 (-) NCBI UU_Cfam_GSD_1.0
Gstk1
GSTK1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 18 6,992,647 - 6,999,068 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 18 6,992,623 - 6,999,068 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 18 7,234,405 - 7,239,989 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GSTK1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 112,149,949 - 112,155,579 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 112,149,970 - 112,155,300 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666072 8,874,033 - 8,879,741 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gstk1
.
Predicted Target Of
Count of predictions: 34 Count of miRNA genes: 33 Interacting mature miRNAs: 34 Transcripts: ENSRNOT00000022275 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1549843 Bw53 Body weight QTL 53 0.0001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 61697658 103194791 Rat 61445 Strs3 Sensitivity to stroke QTL 3 3 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 4 40433388 85433388 Rat 6893678 Bw108 Body weight QTL 108 2.6 0.006 body mass (VT:0001259) body weight (CMO:0000012) 4 43457976 88457976 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1358363 Sradr3 Stress Responsive Adrenal Weight QTL 3 6.19 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 4 57486946 102486946 Rat 61330 Eau1 Experimental allergic uveoretinitis QTL 1 0.0003 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 4 70362013 132642728 Rat 61336 Bp21 Blood pressure QTL 21 4.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 57114705 78881294 Rat 1549839 Bw52 Body weight QTL 52 0.0001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 61697658 115089733 Rat 6909128 Pancm4 Pancreatic morphology QTL 4 11.35 pancreas mass (VT:0010144) pancreas wet weight (CMO:0000626) 4 26907285 75585128 Rat 61475 Aia2 Adjuvant induced arthritis QTL 2 5.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 39505275 73892441 Rat 8694439 Bw168 Body weight QTL 168 9.57 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 4 40433414 85433414 Rat 8655906 Rf60 Renal function QTL 60 3.8 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 4 29494195 81006281 Rat 2317577 Eae24 Experimental allergic encephalomyelitis QTL 24 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 4 66993185 72752834 Rat 6909122 Insul22 Insulin level QTL 22 4.63 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 4 26907285 75585128 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 2300179 Bmd50 Bone mineral density QTL 50 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 4 60928534 105928534 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 70192 BpQTLcluster5 Blood pressure QTL cluster 5 4.183 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 4 62933508 114921294 Rat 1300139 Hrtrt6 Heart rate QTL 6 2.85 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 39524264 116179656 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1578657 Bss12 Bone structure and strength QTL 12 8.9 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 4 60220938 105220938 Rat 1578658 Bss13 Bone structure and strength QTL 13 8 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 4 60220938 105220938 Rat 4889969 Bss96 Bone structure and strength QTL 96 4.9 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 4 56647776 78882945 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 4889972 Bss97 Bone structure and strength QTL 97 5.6 tibia size trait (VT:0100001) tibia total bone volume (CMO:0001724) 4 56647776 78882945 Rat 6478684 Anxrr30 Anxiety related response QTL 30 0.00087 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 5685012 Bmd87 Bone mineral density QTL 87 5.1 tibia mineral mass (VT:1000283) bone mineral content (CMO:0001554) 4 56647776 78882945 Rat 5685009 Bmd86 Bone mineral density QTL 86 3.7 tibia mineral mass (VT:1000283) bone mineral density (CMO:0001226) 4 56647776 78882945 Rat 1331807 Rf31 Renal function QTL 31 2.988 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 4 39524264 74726312 Rat 8552782 Vie1 Viral induced encephalitis QTL 1 26.4 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 34430484 82490359 Rat 634311 Sach7 Saccharin preference QTL 7 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 57114432 81266970 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 631261 Tcas3 Tongue tumor susceptibility QTL 3 6.88 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 4 10814170 91360527 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 6478772 Anxrr49 Anxiety related response QTL 49 0.15488 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 2312569 Pur19 Proteinuria QTL 19 3.4 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 4 65882107 96130297 Rat 8655961 Kidm43 Kidney mass QTL 43 18 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 36303261 103194984 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 634344 Hcar7 Hepatocarcinoma resistance QTL 7 7.8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 4 70808386 115808386 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 8552801 Bw143 Body weight QTL 143 7.3 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 4 34430484 82490359 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 8552807 Vie4 Viral induced encephalitis QTL 4 7.3 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 62933508 82490359 Rat 619616 Bp79 Blood pressure QTL 79 0.0292 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 5214602 78882945 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 61418 Pia5 Pristane induced arthritis QTL 5 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 62277855 128289560 Rat 631651 Bp124 Blood pressure QTL 124 3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 62879517 107879517 Rat 8552809 Vie5 Viral induced encephalitis QTL 5 25.3 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 34430484 82490359 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1558651 Swd3 Spike wave discharge measurement QTL 3 4.62 0.000024 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 4 58432133 92991462 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 631546 Bp86 Blood pressure QTL 86 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 57114432 91360801 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 6478743 Anxrr40 Anxiety related response QTL 40 0.83076 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 7394826 Bw126 Body weight QTL 126 0.002 body mass (VT:0001259) body weight gain (CMO:0000420) 4 62933269 87483707 Rat 12798520 Anxrr55 Anxiety related response QTL 55 4.45 0.01 locomotor behavior trait (VT:0001392) number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715) 4 32583980 114627242 Rat 631671 Iddm11 Insulin dependent diabetes mellitus QTL 11 3.6 0.0012 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 58635877 78886137 Rat
RH128940
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 71,123,128 - 71,123,286 (+) MAPPER mRatBN7.2 Rnor_6.0 4 71,625,927 - 71,626,084 NCBI Rnor6.0 Rnor_5.0 4 136,431,543 - 136,431,700 UniSTS Rnor5.0 RGSC_v3.4 4 70,003,917 - 70,004,074 UniSTS RGSC3.4 Celera 4 66,054,664 - 66,054,821 UniSTS RH 3.4 Map 4 434.82 UniSTS Cytogenetic Map 4 q23 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000022275 ⟹ ENSRNOP00000022275
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 71,118,896 - 71,123,292 (+) Ensembl Rnor_6.0 Ensembl 4 71,621,729 - 71,626,107 (+) Ensembl
RefSeq Acc Id:
NM_181371 ⟹ NP_852036
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 72,085,614 - 72,089,933 (+) NCBI mRatBN7.2 4 71,118,979 - 71,123,298 (+) NCBI Rnor_6.0 4 71,621,777 - 71,626,096 (+) NCBI Rnor_5.0 4 136,427,328 - 136,431,713 (+) NCBI RGSC_v3.4 4 69,999,767 - 70,004,086 (+) RGD Celera 4 66,050,514 - 66,054,833 (+) RGD
Sequence:
GCGGCTTCACGTTCGCTTCTCTCTCCACTACAGTATGGGGCCGGCGCCGCGCGTCCTGGAACTGTTCTACGATGTGCTGTCCCCCTACTCCTGGCTGGGCTTTGAGGTCCTATGCAGATACCAACACC
hide sequence
RefSeq Acc Id:
XM_063285766 ⟹ XP_063141836
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 72,085,532 - 72,089,934 (+) NCBI
RefSeq Acc Id:
NP_852036 ⟸ NM_181371
- UniProtKB:
O09034 (UniProtKB/Swiss-Prot), P24473 (UniProtKB/Swiss-Prot), B6DYQ0 (UniProtKB/TrEMBL)
- Sequence:
MGPAPRVLELFYDVLSPYSWLGFEVLCRYQHLWNIKLKLRPALLAGIMKDSGNQPPAMVPHKGQYILKEIPLLKQLFQVPMSVPKDFFGEHVKKGTVNAMRFLTAVSMEQPEMLEKVSRELWMRIWSR
hide sequence
Ensembl Acc Id:
ENSRNOP00000022275 ⟸ ENSRNOT00000022275
RefSeq Acc Id:
XP_063141836 ⟸ XM_063285766
- Peptide Label:
isoform X1
RGD ID: 13693007 Promoter ID: EPDNEW_R3530 Type: initiation region Name: Gstk1_1 Description: glutathione S-transferase kappa 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 71,621,761 - 71,621,821 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-07-08
Gstk1
glutathione S-transferase kappa 1
GST13-13
glutathione S-transferase, mitochondrial
Symbol and Name updated
1299863 APPROVED
