Symbol:
Eif3h
Name:
eukaryotic translation initiation factor 3, subunit H
RGD ID:
735178
Description:
Predicted to enable metal-dependent deubiquitinase activity. Predicted to contribute to translation initiation factor activity. Predicted to be involved in negative regulation of proteasomal ubiquitin-dependent protein catabolic process and translational initiation. Predicted to be part of eukaryotic 43S preinitiation complex and eukaryotic translation initiation factor 3 complex, eIF3m. Human ortholog(s) of this gene implicated in breast cancer; prostate cancer; and prostate carcinoma. Orthologous to human EIF3H (eukaryotic translation initiation factor 3 subunit H); PARTICIPATES IN translation initiation pathway; measles pathway; RNA transport pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; benzo[a]pyrene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
eIF-3 gamma; eIF-3-gamma; eIF3 p40 subunit; Eif3s3; eukaryotic translation initiation factor 3 subunit 3; eukaryotic translation initiation factor 3 subunit H; eukaryotic translation initiation factor 3, subunit 3 gamma; eukaryotic translation initiation factor 3, subunit 3 gamma, 40kDa; LOC108348062; MGC72941
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
EIF3H (eukaryotic translation initiation factor 3 subunit H) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Eif3h (eukaryotic translation initiation factor 3, subunit H) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Eif3h (eukaryotic translation initiation factor 3 subunit H) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
EIF3H (eukaryotic translation initiation factor 3 subunit H) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
EIF3H (eukaryotic translation initiation factor 3 subunit H) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Eif3h (eukaryotic translation initiation factor 3 subunit H) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
EIF3H (eukaryotic translation initiation factor 3 subunit H) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
EIF3H (eukaryotic translation initiation factor 3 subunit H) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Eif3h (eukaryotic translation initiation factor 3 subunit H) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
EIF3H (eukaryotic translation initiation factor 3 subunit H)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Eif3h (eukaryotic translation initiation factor 3, subunit H)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
eif3hb (eukaryotic translation initiation factor 3, subunit H, b)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
eif3ha (eukaryotic translation initiation factor 3, subunit H, a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
eIF3h
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
eif-3.H
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
eif3h
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 84,980,891 - 85,064,284 (-) NCBI GRCr8 mRatBN7.2 7 83,091,037 - 83,174,451 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 83,091,039 - 83,174,451 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 84,986,868 - 85,070,126 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 87,188,085 - 87,271,343 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 87,015,192 - 87,098,341 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 10,151,732 - 10,236,677 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 10,151,729 - 10,236,695 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 10,151,729 - 10,236,695 (+) NCBI Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 108,745,895 - 108,756,130 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 116,798,908 - 116,803,475 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 6 116,806,338 - 116,856,511 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 88,069,668 - 88,154,285 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 88,090,397 - 88,175,015 (-) NCBI Celera 7 79,969,394 - 80,052,871 (-) NCBI Celera Cytogenetic Map 7 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Eif3h Rat (1->4)-beta-D-glucan multiple interactions ISO Eif3h (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of EIF3H mRNA CTD PMID:36331819 Eif3h Rat 1,2-dimethylhydrazine multiple interactions ISO Eif3h (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of EIF3H mRNA CTD PMID:22206623 Eif3h Rat 17alpha-ethynylestradiol increases expression ISO Eif3h (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of EIF3H mRNA CTD PMID:17942748 Eif3h Rat 17alpha-ethynylestradiol multiple interactions ISO Eif3h (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of EIF3H mRNA CTD PMID:17942748 Eif3h Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Eif3h (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Eif3h Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO EIF3H (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Eif3h Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Eif3h (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of EIF3H mRNA CTD PMID:21570461 Eif3h Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of EIF3H mRNA CTD PMID:34747641 Eif3h Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of EIF3H mRNA CTD PMID:21215274 Eif3h Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Eif3h (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of EIF3H mRNA CTD PMID:17942748 Eif3h Rat 2,4,6-tribromophenol decreases expression ISO EIF3H (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Eif3h Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO EIF3H (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of EIF3H protein CTD PMID:31675489 Eif3h Rat 4,4'-diaminodiphenylmethane increases expression ISO Eif3h (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of EIF3H mRNA CTD PMID:18648102 Eif3h Rat 4,4'-sulfonyldiphenol increases expression ISO Eif3h (Mus musculus) 6480464 bisphenol S results in increased expression of EIF3H mRNA CTD PMID:39298647 Eif3h Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of EIF3H mRNA CTD PMID:36041667 Eif3h Rat 5-fluorouracil increases expression ISO EIF3H (Homo sapiens) 6480464 Fluorouracil results in increased expression of EIF3H protein CTD PMID:15585135 and PMID:16803524 Eif3h Rat Aflatoxin B2 alpha decreases methylation ISO EIF3H (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of EIF3H intron CTD PMID:30157460 Eif3h Rat all-trans-retinoic acid decreases expression ISO EIF3H (Homo sapiens) 6480464 Tretinoin results in decreased expression of EIF3H mRNA CTD PMID:33167477 Eif3h Rat antirheumatic drug increases expression ISO EIF3H (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of EIF3H mRNA CTD PMID:24449571 Eif3h Rat aristolochic acid A decreases expression ISO EIF3H (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of EIF3H mRNA CTD PMID:33212167 Eif3h Rat benzatropine decreases expression ISO EIF3H (Homo sapiens) 6480464 Benztropine results in decreased expression of EIF3H protein CTD PMID:34122009 Eif3h Rat benzo[a]pyrene increases expression ISO Eif3h (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of EIF3H mRNA CTD PMID:22228805 and PMID:35678645 Eif3h Rat benzo[a]pyrene affects methylation ISO EIF3H (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of EIF3H intron CTD PMID:30157460 Eif3h Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of EIF3H mRNA CTD PMID:21839799 Eif3h Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of EIF3H mRNA CTD PMID:25181051 more ... Eif3h Rat bisphenol A increases expression ISO Eif3h (Mus musculus) 6480464 bisphenol A results in increased expression of EIF3H mRNA CTD PMID:32156529 Eif3h Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of EIF3H mRNA CTD PMID:36041667 Eif3h Rat bisphenol A decreases expression ISO Eif3h (Mus musculus) 6480464 bisphenol A results in decreased expression of EIF3H mRNA CTD PMID:33221593 Eif3h Rat bisphenol AF increases expression ISO EIF3H (Homo sapiens) 6480464 bisphenol AF results in increased expression of EIF3H protein CTD PMID:34186270 Eif3h Rat Bisphenol B increases expression ISO EIF3H (Homo sapiens) 6480464 bisphenol B results in increased expression of EIF3H protein CTD PMID:34186270 Eif3h Rat bisphenol F increases expression ISO EIF3H (Homo sapiens) 6480464 bisphenol F results in increased expression of EIF3H protein CTD PMID:34186270 Eif3h Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of EIF3H mRNA CTD PMID:36041667 Eif3h Rat caffeine increases phosphorylation ISO EIF3H (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of EIF3H protein CTD PMID:35688186 Eif3h Rat CGP 52608 multiple interactions ISO EIF3H (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to EIF3H gene] CTD PMID:28238834 Eif3h Rat chloropicrin affects expression ISO EIF3H (Homo sapiens) 6480464 chloropicrin affects the expression of EIF3H mRNA CTD PMID:26352163 Eif3h Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of EIF3H mRNA CTD PMID:17602206 Eif3h Rat cyclosporin A increases expression ISO EIF3H (Homo sapiens) 6480464 Cyclosporine results in increased expression of EIF3H mRNA CTD PMID:25562108 Eif3h Rat D-glucitol decreases expression ISO Eif3h (Mus musculus) 6480464 Sorbitol results in decreased expression of EIF3H mRNA CTD PMID:35678645 Eif3h Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of EIF3H mRNA CTD PMID:21266533 Eif3h Rat disodium selenite increases expression ISO EIF3H (Homo sapiens) 6480464 Sodium Selenite results in increased expression of EIF3H mRNA CTD PMID:18175754 Eif3h Rat doxorubicin increases expression ISO EIF3H (Homo sapiens) 6480464 Doxorubicin results in increased expression of EIF3H mRNA CTD PMID:29803840 Eif3h Rat ethanol affects splicing ISO Eif3h (Mus musculus) 6480464 Ethanol affects the splicing of EIF3H mRNA CTD PMID:30319688 Eif3h Rat folic acid multiple interactions ISO Eif3h (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of EIF3H mRNA CTD PMID:22206623 Eif3h Rat FR900359 increases phosphorylation ISO EIF3H (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of EIF3H protein CTD PMID:37730182 Eif3h Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of EIF3H protein CTD PMID:22061828 Eif3h Rat ivermectin decreases expression ISO EIF3H (Homo sapiens) 6480464 Ivermectin results in decreased expression of EIF3H protein CTD PMID:32959892 Eif3h Rat Mesaconitine increases expression EXP 6480464 mesaconitine results in increased expression of EIF3H protein CTD PMID:37182599 Eif3h Rat methylmercury chloride decreases expression ISO EIF3H (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of EIF3H mRNA CTD PMID:28001369 Eif3h Rat methylparaben decreases expression ISO EIF3H (Homo sapiens) 6480464 methylparaben results in decreased expression of EIF3H mRNA CTD PMID:31745603 Eif3h Rat N-methyl-4-phenylpyridinium decreases expression ISO Eif3h (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of EIF3H protein CTD PMID:26558463 Eif3h Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of EIF3H mRNA CTD PMID:17602206 Eif3h Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of EIF3H protein CTD PMID:19716841 Eif3h Rat nickel subsulfide decreases expression EXP 6480464 nickel subsulfide results in decreased expression of EIF3H mRNA CTD PMID:21086188 Eif3h Rat nitrates multiple interactions ISO Eif3h (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of EIF3H mRNA CTD PMID:35964746 Eif3h Rat parathion increases expression ISO Eif3h (Mus musculus) 6480464 Parathion results in increased expression of EIF3H mRNA CTD PMID:34813904 Eif3h Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Eif3h (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of EIF3H mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of EIF3H mRNA CTD PMID:36331819 Eif3h Rat perfluorooctanoic acid increases expression ISO Eif3h (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of EIF3H mRNA CTD PMID:35678645 Eif3h Rat pregnenolone 16alpha-carbonitrile increases expression ISO Eif3h (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of EIF3H mRNA CTD PMID:28903501 Eif3h Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of EIF3H protein CTD PMID:35544339 Eif3h Rat SB 431542 multiple interactions ISO EIF3H (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of EIF3H protein CTD PMID:37664457 Eif3h Rat serpentine asbestos increases expression ISO EIF3H (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of EIF3H mRNA CTD PMID:21148743 Eif3h Rat sodium arsenite decreases expression ISO EIF3H (Homo sapiens) 6480464 sodium arsenite results in decreased expression of EIF3H protein CTD PMID:30528433 Eif3h Rat sunitinib increases expression ISO EIF3H (Homo sapiens) 6480464 Sunitinib results in increased expression of EIF3H mRNA CTD PMID:31533062 Eif3h Rat titanium dioxide decreases methylation ISO Eif3h (Mus musculus) 6480464 titanium dioxide results in decreased methylation of EIF3H gene and titanium dioxide results in decreased methylation of EIF3H promoter CTD PMID:35295148 Eif3h Rat triphenyl phosphate affects expression ISO EIF3H (Homo sapiens) 6480464 triphenyl phosphate affects the expression of EIF3H mRNA CTD PMID:37042841 Eif3h Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of EIF3H mRNA CTD PMID:23034163
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 5-fluorouracil (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) benzatropine (ISO) benzo[a]pyrene (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) caffeine (ISO) CGP 52608 (ISO) chloropicrin (ISO) clofibric acid (EXP) cyclosporin A (ISO) D-glucitol (ISO) dibutyl phthalate (EXP) disodium selenite (ISO) doxorubicin (ISO) ethanol (ISO) folic acid (ISO) FR900359 (ISO) gentamycin (EXP) ivermectin (ISO) Mesaconitine (EXP) methylmercury chloride (ISO) methylparaben (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) N-nitrosomorpholine (EXP) nickel subsulfide (EXP) nitrates (ISO) parathion (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) pregnenolone 16alpha-carbonitrile (ISO) rotenone (EXP) SB 431542 (ISO) serpentine asbestos (ISO) sodium arsenite (ISO) sunitinib (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) vinclozolin (EXP)
1.
Structure of initiation factor eIF-3 from rat liver. Hydrodynamic and electron microscopic investigations.
Behlke J, etal., Eur J Biochem. 1986 Jun 16;157(3):523-30.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
The scanning mechanism of eukaryotic translation initiation.
Hinnebusch AG Annu Rev Biochem. 2014;83:779-812. doi: 10.1146/annurev-biochem-060713-035802. Epub 2014 Jan 29.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Amplification and overexpression of p40 subunit of eukaryotic translation initiation factor 3 in breast and prostate cancer.
Nupponen NN, etal., Am J Pathol. 1999 Jun;154(6):1777-83.
7.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
8.
GOA pipeline
RGD automated data pipeline
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Comprehensive gene review and curation
RGD comprehensive gene curation
11.
Information Derived from GenBank Report
RGD, Sept. 2003
12.
Amplification of EIF3S3 gene is associated with advanced stage in prostate cancer.
Saramaki O, etal., Am J Pathol. 2001 Dec;159(6):2089-94.
13.
Expression and copy number analysis of TRPS1, EIF3S3 and MYC genes in breast and prostate cancer.
Savinainen KJ, etal., Br J Cancer. 2004 Mar 8;90(5):1041-6.
14.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Eif3h Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 84,980,891 - 85,064,284 (-) NCBI GRCr8 mRatBN7.2 7 83,091,037 - 83,174,451 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 83,091,039 - 83,174,451 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 84,986,868 - 85,070,126 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 87,188,085 - 87,271,343 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 87,015,192 - 87,098,341 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 10,151,732 - 10,236,677 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 10,151,729 - 10,236,695 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 10,151,729 - 10,236,695 (+) NCBI Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 108,745,895 - 108,756,130 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 116,798,908 - 116,803,475 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 6 116,806,338 - 116,856,511 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 88,069,668 - 88,154,285 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 88,090,397 - 88,175,015 (-) NCBI Celera 7 79,969,394 - 80,052,871 (-) NCBI Celera Cytogenetic Map 7 q31 NCBI
EIF3H Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 116,642,130 - 116,766,374 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 116,642,130 - 116,766,925 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 117,654,369 - 117,768,062 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 117,726,236 - 117,837,243 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 117,726,266 - 117,837,222 NCBI Celera 8 113,843,130 - 113,956,776 (-) NCBI Celera Cytogenetic Map 8 q23.3-q24.11 NCBI HuRef 8 112,983,503 - 113,094,395 (-) NCBI HuRef CHM1_1 8 117,697,603 - 117,808,219 (-) NCBI CHM1_1 T2T-CHM13v2.0 8 117,769,451 - 117,883,944 (-) NCBI T2T-CHM13v2.0
Eif3h Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 51,649,956 - 51,728,901 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 51,649,954 - 51,728,919 (-) Ensembl GRCm39 Ensembl GRCm38 15 51,786,563 - 51,865,461 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 51,786,558 - 51,865,523 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 51,618,109 - 51,697,007 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 51,616,637 - 51,695,535 (-) NCBI MGSCv36 mm8 Celera 15 53,359,320 - 53,438,134 (-) NCBI Celera Cytogenetic Map 15 C NCBI cM Map 15 19.42 NCBI
Eif3h Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955417 22,754,395 - 22,846,618 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955417 22,757,781 - 22,846,349 (-) NCBI ChiLan1.0 ChiLan1.0
EIF3H Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 134,048,331 - 134,158,684 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 109,567,521 - 109,677,808 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 113,320,059 - 113,440,769 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 115,863,493 - 115,984,107 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 115,863,490 - 115,973,872 (-) Ensembl panpan1.1 panPan2
EIF3H Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 16,105,960 - 16,201,902 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 16,105,990 - 16,341,153 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 16,107,272 - 16,203,193 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 16,393,919 - 16,489,878 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 16,393,949 - 16,490,038 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 16,139,289 - 16,233,993 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 16,238,566 - 16,334,288 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 16,479,179 - 16,575,072 (-) NCBI UU_Cfam_GSD_1.0
Eif3h Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 22,083,049 - 22,180,007 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936470 29,509,151 - 29,606,124 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936470 29,509,154 - 29,606,124 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
EIF3H Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 21,954,874 - 22,058,699 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 21,955,026 - 22,053,683 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 23,327,980 - 23,448,893 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
EIF3H
Eif3h
.
Predicted Target Of
Count of predictions: 114 Count of miRNA genes: 95 Interacting mature miRNAs: 98 Transcripts: ENSRNOT00000005786 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 2293667 Bss42 Bone structure and strength QTL 42 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 7 47651439 92651439 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 2317035 Aia16 Adjuvant induced arthritis QTL 16 2.71 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 59238038 104238038 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 2293678 Bss24 Bone structure and strength QTL 24 6.71 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 7 47651439 92651439 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 1357338 Stl17 Serum triglyceride level QTL 17 3.23 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 69736356 112729554 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 2293685 Bmd21 Bone mineral density QTL 21 4.2 0.0003 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 7 47651439 92651439 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 631529 Tls2 T-lymphoma susceptibility QTL 2 0 0.001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 7 80221299 109401111 Rat 2293696 Bmd32 Bone mineral density QTL 32 5.1 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 7 47651439 92651439 Rat 1300151 Bp181 Blood pressure QTL 181 3.36 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 7 53612714 103945643 Rat 1559283 Emca4 Estrogen-induced mammary cancer QTL 4 3.7 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 7 62004452 101773158 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 2293707 Bss32 Bone structure and strength QTL 32 7.64 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 47651439 92651439 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 1641908 Teswt1 Testicular weight QTL 1 3.28 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 7 80221299 94811326 Rat 2293644 Bmd29 Bone mineral density QTL 29 5.4 0.0001 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 7 47651439 92651439 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 2300178 Bmd54 Bone mineral density QTL 54 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 7 47651439 92651439 Rat 724537 Niddm52 Non-insulin dependent diabetes mellitus QTL 52 0.02 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 80221299 93595843 Rat 1298528 Bp169 Blood pressure QTL 169 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 61074194 106074194 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1331746 Kidm9 Kidney mass QTL 9 3.934 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 7 80221299 112308525 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 1576303 Ept7 Estrogen-induced pituitary tumorigenesis QTL 7 3.7 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 7 62004452 101773158 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat
D7Rat86
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 85,043,242 - 85,043,362 (+) Marker Load Pipeline mRatBN7.2 7 83,153,392 - 83,153,512 (-) MAPPER mRatBN7.2 Rnor_6.0 6 10,173,862 - 10,173,981 NCBI Rnor6.0 Rnor_6.0 6 108,696,796 - 108,696,915 NCBI Rnor6.0 Rnor_5.0 6 116,858,276 - 116,858,395 UniSTS Rnor5.0 Rnor_5.0 6 20,168,871 - 20,168,990 UniSTS Rnor5.0 RGSC_v3.4 7 88,132,195 - 88,132,315 RGD RGSC3.4 RGSC_v3.4 7 88,132,196 - 88,132,315 UniSTS RGSC3.4 RGSC_v3.1 7 88,152,926 - 88,153,045 RGD Celera 7 80,031,740 - 80,031,859 UniSTS RH 3.4 Map 7 545.2 RGD RH 3.4 Map 7 545.2 UniSTS RH 2.0 Map 7 472.9 RGD SHRSP x BN Map 7 50.08 RGD FHH x ACI Map 7 40.04 RGD Cytogenetic Map 7 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005786 ⟹ ENSRNOP00000005786
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 83,091,039 - 83,152,147 (-) Ensembl Rnor_6.0 Ensembl 6 10,151,729 - 10,236,695 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000061786 ⟹ ENSRNOP00000058501
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 83,091,039 - 83,105,508 (-) Ensembl Rnor_6.0 Ensembl 6 108,745,895 - 108,756,130 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000094377 ⟹ ENSRNOP00000080205
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 83,092,893 - 83,174,451 (-) Ensembl
RefSeq Acc Id:
NM_198751 ⟹ NP_942046
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 84,980,891 - 85,064,284 (-) NCBI mRatBN7.2 7 83,091,037 - 83,174,451 (-) NCBI Rnor_6.0 6 10,151,732 - 10,236,677 (+) NCBI Rnor_5.0 6 116,806,338 - 116,856,511 (-) NCBI Rnor_5.0 6 116,798,908 - 116,803,475 (-) NCBI RGSC_v3.4 7 88,069,668 - 88,154,285 (-) RGD Celera 7 79,969,394 - 80,052,871 (-) RGD
Sequence:
GGGGTCTTTCTTCCTGTCTGGCTGGAAACATGGCGTCGCGCAAGGAAGGCACCGGTTCCACCGCCACCTCTTCCAGCTCTACTGGCGGCGCGGTGGGGAAGGGAAAAGGGAAAGGCGGCTCTGGAGAT
hide sequence
RefSeq Acc Id:
NP_942046 ⟸ NM_198751
- UniProtKB:
Q6P9U8 (UniProtKB/Swiss-Prot), A0A8I5ZP79 (UniProtKB/TrEMBL)
- Sequence:
MASRKEGTGSTATSSSSTGGAVGKGKGKGGSGDSAVKQVQIDGLVVLKIIKHYQEEGQGTEVVQGVLLGLVVEDRLEITNCFPFPQHTEDDADFDEVQYQMEMMRSLRHVNIDHLHVGWYQSTYYGSF
hide sequence
Ensembl Acc Id:
ENSRNOP00000005786 ⟸ ENSRNOT00000005786
Ensembl Acc Id:
ENSRNOP00000058501 ⟸ ENSRNOT00000061786
Ensembl Acc Id:
ENSRNOP00000080205 ⟸ ENSRNOT00000094377
RGD ID: 13694394 Promoter ID: EPDNEW_R4909 Type: multiple initiation site Name: LOC108348062_1 Description: eukaryotic translation initiation factor 3 subunit H SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 10,151,731 - 10,151,791 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Eif3h
eukaryotic translation initiation factor 3, subunit H
LOC108348062
eukaryotic translation initiation factor 3 subunit H
Data merged from RGD:11498408
737654 PROVISIONAL
2016-08-02
LOC108348062
eukaryotic translation initiation factor 3 subunit H
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-03-04
Eif3h
eukaryotic translation initiation factor 3, subunit H
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-18
Eif3h
eukaryotic translation initiation factor 3, subunit H
Eif3s3
eukaryotic translation initiation factor 3, subunit 3 gamma
Symbol and Name updated to reflect Human and Mouse nomenclature
1299863 APPROVED
2005-07-08
Eif3s3
eukaryotic translation initiation factor 3, subunit 3 (gamma)
eukaryotic translation initiation factor 3, subunit 3 gamma, 40kDa
Name updated
1299863 APPROVED
