Symbol:
Ace2
Name:
angiotensin converting enzyme 2
RGD ID:
728890
Description:
Enables carboxypeptidase activity. Involved in maternal process involved in female pregnancy; negative regulation of ERK1 and ERK2 cascade; and negative regulation of smooth muscle cell proliferation. Located in extracellular space. Used to study glaucoma; myocardial infarction; and thrombosis. Biomarker of hypertension; lung disease; middle cerebral artery infarction; myocardial infarction; and primary biliary cholangitis. Human ortholog(s) of this gene implicated in several diseases, including avian influenza; cerebral malaria; hypertension (multiple); respiratory syncytial virus infectious disease; and severe acute respiratory syndrome. Orthologous to human ACE2 (angiotensin converting enzyme 2); PARTICIPATES IN angiotensin (1-7) signaling pathway; renin-angiotensin cascade pathway; INTERACTS WITH (S)-colchicine; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ACE-related carboxypeptidase; angiotensin I converting enzyme (peptidyl-dipeptidase A) 2; angiotensin I converting enzyme 2; angiotensin-converting enzyme 2; anigotensin-converting enzyme-related carboxypeptidase; renal angiotensin-converting enzyme 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 33,925,458 - 33,972,851 (-) NCBI GRCr8 mRatBN7.2 X 30,293,597 - 30,340,961 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 30,293,589 - 30,340,977 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 31,326,034 - 31,372,619 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 34,763,480 - 34,809,624 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 30,950,895 - 30,996,838 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 32,050,734 - 32,095,860 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 32,049,931 - 32,096,016 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 32,422,286 - 32,469,137 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 51,051,758 - 51,096,036 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 51,105,228 - 51,149,505 (-) NCBI Celera X 30,638,123 - 30,683,403 (-) NCBI Celera Cytogenetic Map X q14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ace2 Rat (S)-colchicine decreases expression EXP 6480464 Colchicine results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat (S)-colchicine decreases expression ISO ACE2 (Homo sapiens) 6480464 Colchicine results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat (S,S,S)-nicotianamine decreases activity ISO ACE2 (Homo sapiens) 6480464 nicotianamine results in decreased activity of ACE2 protein CTD PMID:26106051 Ace2 Rat 1,2-dimethylhydrazine decreases expression ISO Ace2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of ACE2 mRNA CTD PMID:22206623 Ace2 Rat 14,15-EET multiple interactions ISO Ace2 (Mus musculus) 6480464 14 more ... CTD PMID:27428043 Ace2 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat 17alpha-ethynylestradiol decreases expression ISO ACE2 (Homo sapiens) 6480464 Ethinyl Estradiol results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in decreased expression of ACE2 mRNA CTD PMID:32741896 Ace2 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in decreased expression of ACE2 mRNA CTD PMID:32741896 Ace2 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:31826744 Ace2 Rat 2,5-dihydroxybenzoic acid multiple interactions ISO Ace2 (Mus musculus) 6480464 2 and 5-dihydroxybenzoic acid inhibits the reaction [[Streptozocin co-treated with Niacinamide] results in decreased expression of ACE2 mRNA] CTD PMID:37120126 Ace2 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of ACE2 mRNA CTD PMID:28522335 Ace2 Rat 4-(5,6,7,8-tetrahydroimidazo[1,5-a]pyridin-5-yl)benzonitrile increases expression EXP 6480464 Fadrozole results in increased expression of ACE2 protein CTD PMID:18586661 Ace2 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole decreases expression ISO ACE2 (Homo sapiens) 6480464 Omeprazole results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole decreases expression EXP 6480464 Omeprazole results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat 6-propyl-2-thiouracil decreases expression ISO ACE2 (Homo sapiens) 6480464 Propylthiouracil results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat 8-Br-cAMP increases expression ISO ACE2 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of ACE2 mRNA CTD PMID:22079614 Ace2 Rat Ac-Ser-Asp-Lys-Pro-OH multiple interactions ISO Ace2 (Mus musculus) 6480464 ACE2 protein affects the reaction [goralatide inhibits the reaction [AGT protein results in decreased expression of ACE2 mRNA]] more ... CTD PMID:33007385 Ace2 Rat acarbose decreases expression ISO ACE2 (Homo sapiens) 6480464 Acarbose results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat acetic acid [4-[2-(dimethylamino)ethoxy]-2-methyl-5-propan-2-ylphenyl] ester decreases expression ISO ACE2 (Homo sapiens) 6480464 Moxisylyte results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of ACE2 mRNA CTD PMID:23630614 Ace2 Rat aflatoxin B1 decreases methylation ISO ACE2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ACE2 gene CTD PMID:27153756 Ace2 Rat aldehydo-D-glucose multiple interactions EXP 6480464 NFE2L2 protein affects the reaction [Glucose results in decreased expression of ACE2 mRNA] more ... CTD PMID:29211853 Ace2 Rat aldehydo-D-glucose decreases expression ISO Ace2 (Mus musculus) 6480464 Glucose results in decreased expression of ACE2 protein CTD PMID:29266779 Ace2 Rat aldehydo-D-glucose decreases expression EXP 6480464 Glucose results in decreased expression of ACE2 mRNA CTD PMID:29211853 Ace2 Rat aldehydo-D-glucose multiple interactions ISO Ace2 (Mus musculus) 6480464 CEBPB protein inhibits the reaction [Glucose results in decreased expression of ACE2 protein] more ... CTD PMID:29266779 Ace2 Rat all-trans-retinoic acid multiple interactions ISO Ace2 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of ACE2 mRNA CTD PMID:36189433 Ace2 Rat all-trans-retinol increases expression ISO ACE2 (Homo sapiens) 6480464 Vitamin A results in increased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat amitriptyline increases expression ISO ACE2 (Homo sapiens) 6480464 Amitriptyline results in increased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of ACE2 mRNA CTD PMID:30779732 Ace2 Rat ampicillin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of ACE2 protein CTD PMID:30545405 Ace2 Rat angiotensin I affects abundance ISO Ace2 (Mus musculus) 6480464 [ACE2 protein affects the abundance of Angiotensin I] which affects the abundance of angiotensin I (1-7) more ... CTD PMID:27649628 Ace2 Rat angiotensin II affects abundance ISO Ace2 (Mus musculus) 6480464 [ACE2 protein affects the abundance of Angiotensin I] which affects the abundance of Angiotensin II and ACE2 protein affects the abundance of Angiotensin II CTD PMID:27649628 Ace2 Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions EXP 6480464 pyrazolanthrone inhibits the reaction [2-(1-carboxy-2-(3-(3 more ... CTD PMID:27302421 Ace2 Rat aprindine increases activity ISO ACE2 (Homo sapiens) 6480464 Aprindine results in increased activity of ACE2 protein CTD PMID:21859683 Ace2 Rat arsane multiple interactions ISO ACE2 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ACE2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ACE2 protein CTD PMID:36669534 Ace2 Rat arsane decreases expression ISO Ace2 (Mus musculus) 6480464 Arsenic results in decreased expression of ACE2 mRNA CTD PMID:36669534 Ace2 Rat arsenic atom multiple interactions ISO ACE2 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ACE2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ACE2 protein CTD PMID:36669534 Ace2 Rat arsenic atom decreases expression ISO Ace2 (Mus musculus) 6480464 Arsenic results in decreased expression of ACE2 mRNA CTD PMID:36669534 Ace2 Rat arsenite(3-) multiple interactions ISO ACE2 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to ACE2 mRNA] CTD PMID:32406909 Ace2 Rat atorvastatin calcium increases expression EXP 6480464 Atorvastatin results in increased expression of ACE2 mRNA CTD PMID:23390189 Ace2 Rat azathioprine increases expression ISO ACE2 (Homo sapiens) 6480464 Azathioprine results in increased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat benazepril affects response to substance ISO ACE2 (Homo sapiens) 6480464 ACE2 gene SNP affects the susceptibility to benazepril CTD PMID:20559404 Ace2 Rat benazepril increases response to substance ISO ACE2 (Homo sapiens) 6480464 ACE2 gene SNP results in increased susceptibility to benazepril CTD PMID:27121444 Ace2 Rat benazepril multiple interactions ISO ACE2 (Homo sapiens) 6480464 [AGT gene polymorphism co-treated with ACE2 gene polymorphism] affects the susceptibility to benazepril CTD PMID:21449848 Ace2 Rat benzbromarone decreases expression ISO ACE2 (Homo sapiens) 6480464 Benzbromarone results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat benzo[a]pyrene affects methylation ISO ACE2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ACE2 promoter CTD PMID:27901495 Ace2 Rat Benzo[k]fluoranthene decreases expression ISO Ace2 (Mus musculus) 6480464 benzo(k)fluoranthene results in decreased expression of ACE2 mRNA CTD PMID:26377693 Ace2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ACE2 mRNA CTD PMID:25181051 Ace2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ACE2 mRNA and bisphenol A results in increased expression of ACE2 protein CTD PMID:36779543 and PMID:38027817 Ace2 Rat bisphenol F increases expression ISO Ace2 (Mus musculus) 6480464 bisphenol F results in increased expression of ACE2 mRNA CTD PMID:38685157 Ace2 Rat bleomycin A2 multiple interactions EXP 6480464 angiotensin I (1-7) inhibits the reaction [Bleomycin results in decreased expression of ACE2 mRNA] CTD PMID:20581171 Ace2 Rat bleomycin A2 decreases expression EXP 6480464 Bleomycin results in decreased expression of ACE2 mRNA CTD PMID:20581171 Ace2 Rat Butralin multiple interactions EXP 6480464 Gum Arabic inhibits the reaction [butralin results in increased expression of ACE2 mRNA] CTD PMID:34240313 Ace2 Rat Butralin increases expression EXP 6480464 butralin results in increased expression of ACE2 mRNA CTD PMID:34240313 Ace2 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of ACE2 promoter CTD PMID:22457795 Ace2 Rat cadmium dichloride multiple interactions ISO Ace2 (Mus musculus) 6480464 Melatonin inhibits the reaction [Cadmium Chloride results in decreased expression of ACE2 protein] CTD PMID:35844137 Ace2 Rat cadmium dichloride decreases expression ISO Ace2 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of ACE2 protein CTD PMID:35844137 Ace2 Rat caffeine decreases phosphorylation ISO ACE2 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of ACE2 protein CTD PMID:35688186 Ace2 Rat candesartan decreases expression EXP 6480464 candesartan results in decreased expression of ACE2 mRNA CTD PMID:18796534 Ace2 Rat Candesartan cilexetil increases expression EXP 6480464 candesartan cilexetil results in increased expression of ACE2 protein CTD PMID:22120037 Ace2 Rat captopril multiple interactions ISO Ace2 (Mus musculus) 6480464 Captopril inhibits the reaction [AGT protein results in decreased expression of ACE2 mRNA] more ... CTD PMID:33007385 Ace2 Rat captopril decreases response to substance ISO ACE2 (Homo sapiens) 6480464 ACE2 gene SNP results in decreased susceptibility to Captopril CTD PMID:17473847 Ace2 Rat captopril multiple interactions EXP 6480464 Captopril inhibits the reaction [Pregabalin results in decreased expression of ACE2 protein] CTD PMID:31629013 Ace2 Rat carbon nanotube decreases expression ISO Ace2 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of ACE2 mRNA CTD PMID:25554681 Ace2 Rat ceftriaxone decreases expression EXP 6480464 Ceftriaxone results in decreased expression of ACE2 mRNA CTD PMID:29745864 Ace2 Rat CGP 52608 multiple interactions ISO ACE2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ACE2 gene] CTD PMID:28238834 Ace2 Rat chloramphenicol decreases expression ISO ACE2 (Homo sapiens) 6480464 Chloramphenicol results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat Chlormadinone acetate decreases expression ISO ACE2 (Homo sapiens) 6480464 Chlormadinone Acetate results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat chlorpromazine decreases expression ISO ACE2 (Homo sapiens) 6480464 Chlorpromazine results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat chlorpropamide decreases expression ISO ACE2 (Homo sapiens) 6480464 Chlorpropamide results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat chromium(6+) affects expression ISO Ace2 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of ACE2 mRNA CTD PMID:28472532 Ace2 Rat cisplatin multiple interactions ISO ACE2 (Homo sapiens) 6480464 [ACE2 protein inhibits the reaction [Cisplatin results in increased activity of CASP3 protein]] which results in decreased cleavage of PARP1 protein more ... CTD PMID:35622184 Ace2 Rat cobalt dichloride decreases expression ISO Ace2 (Mus musculus) 6480464 cobaltous chloride results in decreased expression of ACE2 mRNA and cobaltous chloride results in decreased expression of ACE2 protein CTD PMID:25511041 Ace2 Rat cobalt dichloride increases expression ISO ACE2 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of ACE2 protein CTD PMID:29673971 Ace2 Rat copper(II) sulfate decreases expression ISO ACE2 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ACE2 mRNA CTD PMID:19549813 Ace2 Rat copper(II) sulfate decreases expression ISO Ace2 (Mus musculus) 6480464 Copper Sulfate results in decreased expression of ACE2 mRNA CTD PMID:18579281 Ace2 Rat curcumin multiple interactions EXP 6480464 Curcumin inhibits the reaction [AGT protein results in increased expression of ACE2 protein] CTD PMID:26648693 Ace2 Rat curcumin affects binding ISO ACE2 (Homo sapiens) 6480464 Curcumin binds to ACE2 protein CTD PMID:34138966 Ace2 Rat cyclophosphamide decreases expression ISO ACE2 (Homo sapiens) 6480464 Cyclophosphamide results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of ACE2 mRNA CTD PMID:21865292 Ace2 Rat D-glucose decreases expression ISO Ace2 (Mus musculus) 6480464 Glucose results in decreased expression of ACE2 protein CTD PMID:29266779 Ace2 Rat D-glucose multiple interactions ISO Ace2 (Mus musculus) 6480464 CEBPB protein inhibits the reaction [Glucose results in decreased expression of ACE2 protein] more ... CTD PMID:29266779 Ace2 Rat D-glucose multiple interactions EXP 6480464 NFE2L2 protein affects the reaction [Glucose results in decreased expression of ACE2 mRNA] more ... CTD PMID:29211853 Ace2 Rat D-glucose decreases expression EXP 6480464 Glucose results in decreased expression of ACE2 mRNA CTD PMID:29211853 Ace2 Rat D-penicillamine increases expression ISO ACE2 (Homo sapiens) 6480464 Penicillamine results in increased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat danazol decreases expression EXP 6480464 Danazol results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat danazol decreases expression ISO ACE2 (Homo sapiens) 6480464 Danazol results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat dantrolene increases expression ISO ACE2 (Homo sapiens) 6480464 Dantrolene results in increased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat DDE multiple interactions EXP 6480464 [Dietary Fats co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of ACE2 mRNA CTD PMID:30415545 Ace2 Rat desloratadine affects binding ISO ACE2 (Homo sapiens) 6480464 desloratadine binds to ACE2 protein CTD PMID:33609497 Ace2 Rat dexamethasone decreases expression ISO ACE2 (Homo sapiens) 6480464 Dexamethasone results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat diazepam decreases expression ISO ACE2 (Homo sapiens) 6480464 Diazepam results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat diclofenac decreases expression ISO ACE2 (Homo sapiens) 6480464 Diclofenac results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat diminazene increases activity ISO ACE2 (Homo sapiens) 6480464 Diminazene results in increased activity of ACE2 protein CTD PMID:21859683 Ace2 Rat diminazene diaceturate increases expression ISO Ace2 (Mus musculus) 6480464 diminazene aceturate results in increased expression of ACE2 mRNA and diminazene aceturate results in increased expression of ACE2 protein CTD PMID:25301841 Ace2 Rat diminazene diaceturate increases expression ISO ACE2 (Homo sapiens) 6480464 diminazene aceturate results in increased expression of ACE2 mRNA and diminazene aceturate results in increased expression of ACE2 protein CTD PMID:26862037 Ace2 Rat diminazene diaceturate multiple interactions ISO ACE2 (Homo sapiens) 6480464 [Lipopolysaccharides co-treated with diminazene aceturate] results in increased expression of ACE2 mRNA more ... CTD PMID:26862037 Ace2 Rat diminazene diaceturate increases expression EXP 6480464 diminazene aceturate results in increased expression of ACE2 protein CTD PMID:28688122 Ace2 Rat diminazene diaceturate multiple interactions EXP 6480464 PD 123319 inhibits the reaction [diminazene aceturate results in increased expression of ACE2 protein] CTD PMID:28688122 Ace2 Rat diminazene diaceturate increases activity ISO Ace2 (Mus musculus) 6480464 diminazene aceturate results in increased activity of ACE2 protein CTD PMID:27550926 and PMID:31982938 Ace2 Rat dioxygen decreases expression ISO Ace2 (Mus musculus) 6480464 Oxygen deficiency results in decreased expression of ACE2 mRNA and Oxygen deficiency results in decreased expression of ACE2 protein CTD PMID:25511041 Ace2 Rat dioxygen multiple interactions ISO Ace2 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of ACE2 mRNA and Losartan inhibits the reaction [Oxygen deficiency results in decreased expression of ACE2 protein] CTD PMID:25511041 and PMID:30529165 Ace2 Rat disopyramide increases expression ISO ACE2 (Homo sapiens) 6480464 Disopyramide results in increased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat disulfiram decreases expression ISO ACE2 (Homo sapiens) 6480464 Disulfiram results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat dorsomorphin multiple interactions ISO ACE2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ACE2 mRNA CTD PMID:27188386 Ace2 Rat doxepin decreases expression ISO ACE2 (Homo sapiens) 6480464 Doxepin results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat doxorubicin increases expression ISO ACE2 (Homo sapiens) 6480464 Doxorubicin results in increased expression of ACE2 mRNA CTD PMID:28940058 and PMID:30031762 Ace2 Rat doxorubicin decreases response to substance EXP 6480464 ACE2 protein results in decreased susceptibility to Doxorubicin CTD PMID:28445944 Ace2 Rat doxorubicin decreases expression ISO ACE2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ACE2 mRNA CTD PMID:29803840 Ace2 Rat EC 3.4.15.1 (peptidyl-dipeptidase A) inhibitor increases expression ISO ACE2 (Homo sapiens) 6480464 Angiotensin-Converting Enzyme Inhibitors results in increased expression of ACE2 mRNA CTD PMID:25534429 Ace2 Rat endosulfan decreases expression ISO ACE2 (Homo sapiens) 6480464 Endosulfan results in decreased expression of ACE2 protein CTD PMID:36513242 Ace2 Rat ethambutol increases expression ISO ACE2 (Homo sapiens) 6480464 Ethambutol results in increased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of ACE2 mRNA CTD PMID:29548890 Ace2 Rat ethionamide decreases expression ISO ACE2 (Homo sapiens) 6480464 Ethionamide results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat etoposide increases expression ISO ACE2 (Homo sapiens) 6480464 Etoposide results in increased expression of ACE2 mRNA CTD PMID:29397400 Ace2 Rat etoposide decreases expression EXP 6480464 Etoposide results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat etoposide decreases expression ISO ACE2 (Homo sapiens) 6480464 Etoposide results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat flutamide decreases expression ISO ACE2 (Homo sapiens) 6480464 Flutamide results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat gemfibrozil increases expression ISO ACE2 (Homo sapiens) 6480464 Gemfibrozil results in increased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat gentamycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of ACE2 protein CTD PMID:30545405 Ace2 Rat glucose decreases expression ISO Ace2 (Mus musculus) 6480464 Glucose results in decreased expression of ACE2 protein CTD PMID:29266779 Ace2 Rat glucose multiple interactions EXP 6480464 NFE2L2 protein affects the reaction [Glucose results in decreased expression of ACE2 mRNA] more ... CTD PMID:29211853 Ace2 Rat glucose decreases expression EXP 6480464 Glucose results in decreased expression of ACE2 mRNA CTD PMID:29211853 Ace2 Rat glucose multiple interactions ISO Ace2 (Mus musculus) 6480464 CEBPB protein inhibits the reaction [Glucose results in decreased expression of ACE2 protein] more ... CTD PMID:29266779 Ace2 Rat glyburide decreases expression ISO ACE2 (Homo sapiens) 6480464 Glyburide results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat glyphosate affects methylation EXP 6480464 Glyphosate affects the methylation of ACE2 gene CTD PMID:35440735 Ace2 Rat goralatide multiple interactions ISO Ace2 (Mus musculus) 6480464 ACE2 protein affects the reaction [goralatide inhibits the reaction [AGT protein results in decreased expression of ACE2 mRNA]] more ... CTD PMID:33007385 Ace2 Rat griseofulvin decreases expression EXP 6480464 Griseofulvin results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat griseofulvin decreases expression ISO ACE2 (Homo sapiens) 6480464 Griseofulvin results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat GW 4064 increases expression ISO Ace2 (Mus musculus) 6480464 GW 4064 results in increased expression of ACE2 mRNA CTD PMID:26655953 Ace2 Rat hydroquinone decreases expression ISO ACE2 (Homo sapiens) 6480464 hydroquinone results in decreased expression of ACE2 mRNA CTD PMID:31256213 Ace2 Rat hydroxyzine increases activity ISO ACE2 (Homo sapiens) 6480464 Hydroxyzine results in increased activity of ACE2 protein CTD PMID:21859683 Ace2 Rat hydroxyzine decreases expression ISO ACE2 (Homo sapiens) 6480464 Hydroxyzine results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat Ile(5)-angiotensin II affects abundance ISO Ace2 (Mus musculus) 6480464 [ACE2 protein affects the abundance of Angiotensin I] which affects the abundance of Angiotensin II and ACE2 protein affects the abundance of Angiotensin II CTD PMID:27649628 Ace2 Rat imidapril increases response to substance ISO ACE2 (Homo sapiens) 6480464 ACE2 gene SNP results in increased susceptibility to imidapril CTD PMID:27121444 Ace2 Rat imipramine decreases expression ISO ACE2 (Homo sapiens) 6480464 Imipramine results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat inulin multiple interactions ISO Ace2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ACE2 mRNA CTD PMID:36331819 Ace2 Rat Iodine aqueous multiple interactions ISO ACE2 (Homo sapiens) 6480464 Lugol's solution inhibits the reaction [potassium perchlorate results in increased expression of ACE2 protein] CTD PMID:29673971 Ace2 Rat irbesartan affects response to substance ISO ACE2 (Homo sapiens) 6480464 ACE2 gene polymorphism affects the susceptibility to irbesartan CTD PMID:11593098 Ace2 Rat isoniazide decreases expression ISO ACE2 (Homo sapiens) 6480464 Isoniazid results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat isoprenaline increases expression ISO Ace2 (Mus musculus) 6480464 Isoproterenol results in increased expression of ACE2 mRNA CTD PMID:20003209 Ace2 Rat isoprenaline decreases activity EXP 6480464 Isoproterenol results in decreased activity of ACE2 protein CTD PMID:36414029 Ace2 Rat isoprenaline multiple interactions EXP 6480464 [Isoproterenol results in decreased activity of ACE2 protein] which results in decreased abundance of angiotensin I (1-7) more ... CTD PMID:36414029 Ace2 Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of ACE2 protein CTD PMID:20409916 Ace2 Rat ketoconazole increases expression ISO ACE2 (Homo sapiens) 6480464 Ketoconazole results in increased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat L-ascorbic acid multiple interactions ISO ACE2 (Homo sapiens) 6480464 [Quercetin co-treated with Ascorbic Acid] results in decreased expression of ACE2 mRNA CTD PMID:17639512 Ace2 Rat labetalol increases activity ISO ACE2 (Homo sapiens) 6480464 Labetalol results in increased activity of ACE2 protein CTD PMID:21859683 Ace2 Rat lead diacetate decreases expression ISO Ace2 (Mus musculus) 6480464 lead acetate results in decreased expression of ACE2 mRNA CTD PMID:22613225 Ace2 Rat levonorgestrel multiple interactions ISO ACE2 (Homo sapiens) 6480464 [testosterone undecanoate co-treated with Levonorgestrel] results in decreased expression of ACE2 mRNA CTD PMID:19074003 Ace2 Rat lipopolysaccharide decreases expression EXP 6480464 Lipopolysaccharides results in decreased expression of ACE2 protein CTD PMID:27302421 Ace2 Rat lipopolysaccharide decreases response to substance EXP 6480464 ACE2 protein results in decreased susceptibility to Lipopolysaccharides CTD PMID:27302421 Ace2 Rat lipopolysaccharide multiple interactions ISO ACE2 (Homo sapiens) 6480464 [Lipopolysaccharides co-treated with diminazene aceturate] results in increased expression of ACE2 mRNA more ... CTD PMID:26862037 Ace2 Rat lipopolysaccharide multiple interactions EXP 6480464 2-(1-carboxy-2-(3-(3 more ... CTD PMID:27302421 Ace2 Rat lisinopril dihydrate increases expression EXP 6480464 Lisinopril results in increased expression of ACE2 mRNA CTD PMID:15897343 Ace2 Rat lisinopril dihydrate multiple interactions ISO Ace2 (Mus musculus) 6480464 ACE2 protein affects the reaction [[[Lisinopril co-treated with Thiorphan co-treated with N-benzyloxycarbonylprolylprolinal] affects the metabolism of AGT protein] which results in decreased abundance of angiotensin I (1-7)] CTD PMID:27649628 Ace2 Rat lisinopril dihydrate increases activity EXP 6480464 Lisinopril results in increased activity of ACE2 protein CTD PMID:16221218 Ace2 Rat lomustine decreases expression ISO ACE2 (Homo sapiens) 6480464 Lomustine results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat loratadine affects binding ISO ACE2 (Homo sapiens) 6480464 Loratadine binds to ACE2 protein CTD PMID:33609497 Ace2 Rat losartan multiple interactions EXP 6480464 Losartan inhibits the reaction [AGT protein results in decreased expression of ACE2 mRNA] more ... CTD PMID:16176966 and PMID:20178811 Ace2 Rat losartan increases activity EXP 6480464 Losartan results in increased activity of ACE2 protein CTD PMID:15897343 more ... Ace2 Rat losartan increases expression ISO Ace2 (Mus musculus) 6480464 Losartan results in increased expression of ACE2 protein CTD PMID:25655897 Ace2 Rat losartan increases expression EXP 6480464 Losartan results in increased expression of ACE2 mRNA and Losartan results in increased expression of ACE2 protein CTD PMID:15897343 and PMID:28091615 Ace2 Rat losartan multiple interactions ISO Ace2 (Mus musculus) 6480464 Losartan inhibits the reaction [AGT protein results in decreased expression of ACE2 mRNA] more ... CTD PMID:25511041 and PMID:33007385 Ace2 Rat Magnolol multiple interactions EXP 6480464 magnolol inhibits the reaction [Monocrotaline results in decreased expression of ACE2 protein] CTD PMID:30466619 Ace2 Rat melatonin multiple interactions ISO Ace2 (Mus musculus) 6480464 Melatonin inhibits the reaction [Cadmium Chloride results in decreased expression of ACE2 protein] CTD PMID:35844137 Ace2 Rat metformin increases expression ISO ACE2 (Homo sapiens) 6480464 Metformin results in increased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat metformin multiple interactions ISO Ace2 (Mus musculus) 6480464 Metformin inhibits the reaction [[Streptozocin co-treated with Niacinamide] results in decreased expression of ACE2 mRNA] CTD PMID:37120126 Ace2 Rat methimazole decreases expression ISO ACE2 (Homo sapiens) 6480464 Methimazole results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat metronidazole multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of ACE2 protein CTD PMID:30545405 Ace2 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Ace2 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of ACE2 mRNA CTD PMID:36189433 Ace2 Rat monocrotaline decreases expression EXP 6480464 Monocrotaline results in decreased expression of ACE2 protein CTD PMID:30466619 Ace2 Rat monocrotaline multiple interactions EXP 6480464 [Monocrotaline co-treated with angiotensin I (1-7)] results in increased expression of ACE2 mRNA and magnolol inhibits the reaction [Monocrotaline results in decreased expression of ACE2 protein] CTD PMID:20581171 and PMID:30466619 Ace2 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO ACE2 (Homo sapiens) 6480464 ATF6 protein affects the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of ACE2 protein] and ERN1 protein affects the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of ACE2 protein] CTD PMID:27638906 Ace2 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases expression ISO ACE2 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of ACE2 protein CTD PMID:27638906 Ace2 Rat N-methylnicotinate multiple interactions EXP 6480464 oltipraz inhibits the reaction [trigonelline inhibits the reaction [Glucose results in decreased expression of ACE2 mRNA]] and trigonelline inhibits the reaction [Glucose results in decreased expression of ACE2 mRNA] CTD PMID:29211853 Ace2 Rat N-methylnicotinate multiple interactions ISO Ace2 (Mus musculus) 6480464 oltipraz affects the reaction [trigonelline affects the reaction [INS2 protein affects the expression of ACE2 mRNA]] more ... CTD PMID:29211853 Ace2 Rat naproxen decreases expression ISO ACE2 (Homo sapiens) 6480464 Naproxen results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat neomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of ACE2 protein CTD PMID:30545405 Ace2 Rat nickel atom increases expression ISO ACE2 (Homo sapiens) 6480464 Nickel results in increased expression of ACE2 mRNA CTD PMID:24768652 Ace2 Rat nicotianamine decreases activity ISO ACE2 (Homo sapiens) 6480464 nicotianamine results in decreased activity of ACE2 protein CTD PMID:26106051 Ace2 Rat nicotinamide multiple interactions ISO Ace2 (Mus musculus) 6480464 2 more ... CTD PMID:37120126 Ace2 Rat nimesulide decreases expression ISO ACE2 (Homo sapiens) 6480464 nimesulide results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat olmesartan increases expression EXP 6480464 olmesartan results in increased expression of ACE2 mRNA and olmesartan results in increased expression of ACE2 protein CTD PMID:19171689 and PMID:28656296 Ace2 Rat oltipraz multiple interactions EXP 6480464 oltipraz inhibits the reaction [trigonelline inhibits the reaction [Glucose results in decreased expression of ACE2 mRNA]] CTD PMID:29211853 Ace2 Rat oltipraz multiple interactions ISO Ace2 (Mus musculus) 6480464 oltipraz affects the reaction [trigonelline affects the reaction [INS2 protein affects the expression of ACE2 mRNA]] and oltipraz affects the reaction [trigonelline affects the reaction [INS2 protein affects the expression of ACE2 protein]] CTD PMID:29211853 Ace2 Rat omeprazole decreases expression EXP 6480464 Omeprazole results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat omeprazole decreases expression ISO ACE2 (Homo sapiens) 6480464 Omeprazole results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of ACE2 mRNA CTD PMID:23665939 Ace2 Rat papaverine decreases expression ISO ACE2 (Homo sapiens) 6480464 Papaverine results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat paracetamol decreases expression ISO ACE2 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat paraquat multiple interactions EXP 6480464 Unithiol inhibits the reaction [Paraquat results in decreased expression of ACE2 mRNA] CTD PMID:20465954 Ace2 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of ACE2 mRNA CTD PMID:20465954 and PMID:32680482 Ace2 Rat PD123319 multiple interactions EXP 6480464 PD 123319 inhibits the reaction [diminazene aceturate results in increased expression of ACE2 protein] CTD PMID:28688122 Ace2 Rat pentanal increases expression ISO ACE2 (Homo sapiens) 6480464 pentanal results in increased expression of ACE2 mRNA CTD PMID:26079696 Ace2 Rat perfluorohexanesulfonic acid increases expression ISO Ace2 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of ACE2 mRNA CTD PMID:37995155 Ace2 Rat perfluorohexanesulfonic acid multiple interactions ISO Ace2 (Mus musculus) 6480464 [perfluorooctanoic acid co-treated with perfluorooctane sulfonic acid co-treated with perfluoro-n-nonanoic acid co-treated with perfluorohexanesulfonic acid co-treated with ammonium 2 more ... CTD PMID:36270329 Ace2 Rat perfluorononanoic acid multiple interactions ISO Ace2 (Mus musculus) 6480464 [perfluorooctanoic acid co-treated with perfluorooctane sulfonic acid co-treated with perfluoro-n-nonanoic acid co-treated with perfluorohexanesulfonic acid co-treated with ammonium 2 more ... CTD PMID:36270329 Ace2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ace2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ACE2 mRNA more ... CTD PMID:36270329 and PMID:36331819 Ace2 Rat perfluorooctanoic acid multiple interactions ISO Ace2 (Mus musculus) 6480464 [perfluorooctanoic acid co-treated with perfluorooctane sulfonic acid co-treated with perfluoro-n-nonanoic acid co-treated with perfluorohexanesulfonic acid co-treated with ammonium 2 more ... CTD PMID:36270329 Ace2 Rat perindopril multiple interactions EXP 6480464 Perindopril promotes the reaction [Carbon Tetrachloride results in increased expression of ACE2 mRNA] and Perindopril promotes the reaction [Carbon Tetrachloride results in increased expression of ACE2 protein] CTD PMID:19793108 Ace2 Rat phenobarbital decreases expression ISO ACE2 (Homo sapiens) 6480464 Phenobarbital results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat phenylmercury acetate increases expression ISO ACE2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of ACE2 mRNA CTD PMID:26272509 Ace2 Rat phenylmercury acetate multiple interactions ISO ACE2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ACE2 mRNA CTD PMID:27188386 Ace2 Rat phenytoin decreases expression ISO ACE2 (Homo sapiens) 6480464 Phenytoin results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat pioglitazone increases expression EXP 6480464 Pioglitazone results in increased expression of ACE2 protein CTD PMID:24114819 and PMID:24558317 Ace2 Rat pioglitazone increases secretion EXP 6480464 Pioglitazone results in increased secretion of ACE2 protein CTD PMID:24114819 Ace2 Rat pirfenidone increases expression EXP 6480464 pirfenidone results in increased expression of ACE2 protein CTD PMID:28091615 Ace2 Rat pirinixic acid multiple interactions ISO ACE2 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of ACE2 mRNA CTD PMID:19710929 Ace2 Rat pravastatin multiple interactions EXP 6480464 [INS1 protein co-treated with Pravastatin] inhibits the reaction [Streptozocin results in decreased expression of ACE2 protein] CTD PMID:29682576 Ace2 Rat pregabalin multiple interactions EXP 6480464 Captopril inhibits the reaction [Pregabalin results in decreased expression of ACE2 protein] and Telmisartan inhibits the reaction [Pregabalin results in decreased expression of ACE2 protein] CTD PMID:31629013 Ace2 Rat pregabalin decreases expression EXP 6480464 Pregabalin results in decreased expression of ACE2 protein CTD PMID:31629013 Ace2 Rat quercetin multiple interactions ISO ACE2 (Homo sapiens) 6480464 [Quercetin co-treated with Ascorbic Acid] results in decreased expression of ACE2 mRNA CTD PMID:17639512 Ace2 Rat quinidine decreases expression ISO ACE2 (Homo sapiens) 6480464 Quinidine results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat rifampicin decreases expression ISO ACE2 (Homo sapiens) 6480464 Rifampin results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat SB 203580 multiple interactions EXP 6480464 SB 203580 inhibits the reaction [2-(1-carboxy-2-(3-(3 more ... CTD PMID:27302421 Ace2 Rat SB 431542 multiple interactions ISO ACE2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ACE2 mRNA CTD PMID:27188386 Ace2 Rat silicon dioxide decreases expression ISO Ace2 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of ACE2 mRNA and Silicon Dioxide results in decreased expression of ACE2 protein CTD PMID:33007385 Ace2 Rat silicon dioxide multiple interactions ISO Ace2 (Mus musculus) 6480464 2-(1-carboxy-2-(3-(3 more ... CTD PMID:33007385 Ace2 Rat silver atom increases expression EXP 6480464 Silver results in increased expression of ACE2 mRNA CTD PMID:26277626 Ace2 Rat silver(0) increases expression EXP 6480464 Silver results in increased expression of ACE2 mRNA CTD PMID:26277626 Ace2 Rat simvastatin decreases expression ISO ACE2 (Homo sapiens) 6480464 Simvastatin results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat sirolimus decreases expression EXP 6480464 Sirolimus results in decreased expression of ACE2 mRNA CTD PMID:21865292 Ace2 Rat sodium arsenite multiple interactions ISO ACE2 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ACE2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ACE2 protein CTD PMID:36669534 Ace2 Rat sodium fluoride decreases expression EXP 6480464 Sodium Fluoride results in decreased expression of ACE2 mRNA and Sodium Fluoride results in decreased expression of ACE2 protein CTD PMID:37105417 Ace2 Rat spironolactone increases expression EXP 6480464 Spironolactone results in increased expression of ACE2 protein CTD PMID:18586661 Ace2 Rat spironolactone affects expression EXP 6480464 Spironolactone affects the expression of ACE2 protein CTD PMID:30734886 Ace2 Rat streptozocin decreases expression ISO Ace2 (Mus musculus) 6480464 Streptozocin results in decreased expression of ACE2 protein CTD PMID:21381899 and PMID:29266779 Ace2 Rat streptozocin increases activity ISO Ace2 (Mus musculus) 6480464 Streptozocin results in increased activity of ACE2 protein CTD PMID:28468961 Ace2 Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of ACE2 protein CTD PMID:29682576 Ace2 Rat streptozocin multiple interactions EXP 6480464 [INS1 protein co-treated with Pravastatin] inhibits the reaction [Streptozocin results in decreased expression of ACE2 protein] more ... CTD PMID:20844835 and PMID:29682576 Ace2 Rat streptozocin multiple interactions ISO Ace2 (Mus musculus) 6480464 2 more ... CTD PMID:21381899 more ... Ace2 Rat sulfasalazine decreases expression ISO ACE2 (Homo sapiens) 6480464 Sulfasalazine results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat sulindac decreases expression EXP 6480464 Sulindac results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat sulindac decreases expression ISO ACE2 (Homo sapiens) 6480464 Sulindac results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat sunitinib decreases expression ISO ACE2 (Homo sapiens) 6480464 Sunitinib results in decreased expression of ACE2 mRNA CTD PMID:31533062 Ace2 Rat tacrolimus hydrate decreases expression EXP 6480464 Tacrolimus results in decreased expression of ACE2 mRNA CTD PMID:21865292 Ace2 Rat telmisartan multiple interactions ISO Ace2 (Mus musculus) 6480464 telmisartan inhibits the reaction [Streptozocin results in decreased expression of ACE2 protein] CTD PMID:21381899 Ace2 Rat telmisartan decreases expression EXP 329956421 telmisartan decreases expression of mRNA in mandible of rats with periodontal disease RGD Ace2 Rat telmisartan multiple interactions EXP 6480464 Telmisartan inhibits the reaction [Pregabalin results in decreased expression of ACE2 protein] CTD PMID:31629013 Ace2 Rat telmisartan decreases expression EXP 6480464 Telmisartan results in decreased expression of ACE2 mRNA and Telmisartan results in decreased expression of ACE2 protein CTD PMID:25973029 Ace2 Rat telmisartan increases expression EXP 6480464 Telmisartan results in increased expression of ACE2 mRNA and Telmisartan results in increased expression of ACE2 protein CTD PMID:28656296 and PMID:29909460 Ace2 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in decreased expression of ACE2 mRNA CTD PMID:32741896 Ace2 Rat testosterone undecanoate multiple interactions ISO ACE2 (Homo sapiens) 6480464 [testosterone undecanoate co-treated with Levonorgestrel] results in decreased expression of ACE2 mRNA CTD PMID:19074003 Ace2 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ACE2 mRNA and Carbon Tetrachloride results in increased expression of ACE2 protein CTD PMID:19793108 Ace2 Rat tetrachloromethane multiple interactions EXP 6480464 Perindopril promotes the reaction [Carbon Tetrachloride results in increased expression of ACE2 mRNA] and Perindopril promotes the reaction [Carbon Tetrachloride results in increased expression of ACE2 protein] CTD PMID:19793108 Ace2 Rat tetracycline increases expression ISO ACE2 (Homo sapiens) 6480464 Tetracycline results in increased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat Theaflavin 3,3'-digallate affects binding ISO ACE2 (Homo sapiens) 6480464 theaflavin-3 and 3'-digallate binds to ACE2 protein CTD PMID:34138966 Ace2 Rat theophylline decreases expression ISO ACE2 (Homo sapiens) 6480464 Theophylline results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat thioacetamide increases response to substance ISO Ace2 (Mus musculus) 6480464 ACE2 gene mutant form results in increased susceptibility to Thioacetamide CTD PMID:28845018 Ace2 Rat thioacetamide multiple interactions ISO Ace2 (Mus musculus) 6480464 ACE2 gene mutant form promotes the reaction [Thioacetamide results in increased activity of MMP9 protein] more ... CTD PMID:28845018 Ace2 Rat Thiorphan multiple interactions ISO Ace2 (Mus musculus) 6480464 ACE2 protein affects the reaction [[[Lisinopril co-treated with Thiorphan co-treated with N-benzyloxycarbonylprolylprolinal] affects the metabolism of AGT protein] which results in decreased abundance of angiotensin I (1-7)] CTD PMID:27649628 Ace2 Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of ACE2 mRNA and titanium dioxide results in increased expression of ACE2 protein CTD PMID:26277626 Ace2 Rat trandolapril multiple interactions ISO Ace2 (Mus musculus) 6480464 trandolapril promotes the reaction [REN2 protein results in increased expression of ACE2 protein] CTD PMID:27428043 Ace2 Rat tributylstannane increases expression ISO Ace2 (Mus musculus) 6480464 tributyltin results in increased expression of ACE2 mRNA CTD PMID:31939706 Ace2 Rat triclosan decreases expression ISO ACE2 (Homo sapiens) 6480464 Triclosan results in decreased expression of ACE2 mRNA CTD PMID:28940058 Ace2 Rat triptonide increases expression ISO Ace2 (Mus musculus) 6480464 triptonide results in increased expression of ACE2 mRNA CTD PMID:33045310 Ace2 Rat tryptophan increases expression EXP 401793718 tryptophan in pregnant dams increases expression of mRNA in kidney of male offspring RGD Ace2 Rat valproic acid affects expression ISO ACE2 (Homo sapiens) 6480464 Valproic Acid affects the expression of ACE2 mRNA CTD PMID:25979313 and PMID:32808185 Ace2 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of ACE2 mRNA CTD PMID:32808185 Ace2 Rat valsartan multiple interactions EXP 6480464 Valsartan inhibits the reaction [AGT protein results in decreased expression of ACE2 mRNA] CTD PMID:16176966 Ace2 Rat valsartan multiple interactions ISO Ace2 (Mus musculus) 6480464 Valsartan inhibits the reaction [Glucose results in decreased expression of ACE2 protein] CTD PMID:29266779 Ace2 Rat vancomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of ACE2 protein CTD PMID:30545405 Ace2 Rat xanthone multiple interactions EXP 6480464 xanthone inhibits the reaction [[Isoproterenol results in decreased activity of ACE2 protein] which results in decreased abundance of angiotensin I (1-7)] more ... CTD PMID:25205467 and PMID:36414029
Imported Annotations - KEGG (archival)
(S)-colchicine (EXP,ISO) (S,S,S)-nicotianamine (ISO) 1,2-dimethylhydrazine (ISO) 14,15-EET (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,5-dihydroxybenzoic acid (ISO) 3-chloropropane-1,2-diol (EXP) 4-(5,6,7,8-tetrahydroimidazo[1,5-a]pyridin-5-yl)benzonitrile (EXP) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP,ISO) 6-propyl-2-thiouracil (ISO) 8-Br-cAMP (ISO) Ac-Ser-Asp-Lys-Pro-OH (ISO) acarbose (ISO) acetic acid [4-[2-(dimethylamino)ethoxy]-2-methyl-5-propan-2-ylphenyl] ester (ISO) aflatoxin B1 (EXP,ISO) aldehydo-D-glucose (EXP,ISO) all-trans-retinoic acid (ISO) all-trans-retinol (ISO) amitriptyline (ISO) amphetamine (EXP) ampicillin (EXP) angiotensin I (ISO) angiotensin II (ISO) anthra[1,9-cd]pyrazol-6(2H)-one (EXP) aprindine (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atorvastatin calcium (EXP) azathioprine (ISO) benazepril (ISO) benzbromarone (ISO) benzo[a]pyrene (ISO) Benzo[k]fluoranthene (ISO) bisphenol A (EXP) bisphenol F (ISO) bleomycin A2 (EXP) Butralin (EXP) cadmium dichloride (EXP,ISO) caffeine (ISO) candesartan (EXP) Candesartan cilexetil (EXP) captopril (EXP,ISO) carbon nanotube (ISO) ceftriaxone (EXP) CGP 52608 (ISO) chloramphenicol (ISO) Chlormadinone acetate (ISO) chlorpromazine (ISO) chlorpropamide (ISO) chromium(6+) (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) curcumin (EXP,ISO) cyclophosphamide (ISO) cyclosporin A (EXP) D-glucose (EXP,ISO) D-penicillamine (ISO) danazol (EXP,ISO) dantrolene (ISO) DDE (EXP) desloratadine (ISO) dexamethasone (ISO) diazepam (ISO) diclofenac (ISO) diminazene (ISO) diminazene diaceturate (EXP,ISO) dioxygen (ISO) disopyramide (ISO) disulfiram (ISO) dorsomorphin (ISO) doxepin (ISO) doxorubicin (EXP,ISO) EC 3.4.15.1 (peptidyl-dipeptidase A) inhibitor (ISO) endosulfan (ISO) ethambutol (ISO) ethanol (EXP) ethionamide (ISO) etoposide (EXP,ISO) flutamide (ISO) gemfibrozil (ISO) gentamycin (EXP) glucose (EXP,ISO) glyburide (ISO) glyphosate (EXP) goralatide (ISO) griseofulvin (EXP,ISO) GW 4064 (ISO) hydroquinone (ISO) hydroxyzine (ISO) Ile(5)-angiotensin II (ISO) imidapril (ISO) imipramine (ISO) inulin (ISO) Iodine aqueous (ISO) irbesartan (ISO) isoniazide (ISO) isoprenaline (EXP,ISO) ketoconazole (ISO) L-ascorbic acid (ISO) labetalol (ISO) lead diacetate (ISO) levonorgestrel (ISO) lipopolysaccharide (EXP,ISO) lisinopril dihydrate (EXP,ISO) lomustine (ISO) loratadine (ISO) losartan (EXP,ISO) Magnolol (EXP) melatonin (ISO) metformin (ISO) methimazole (ISO) metronidazole (EXP) mono(2-ethylhexyl) phthalate (ISO) monocrotaline (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-methylnicotinate (EXP,ISO) naproxen (ISO) neomycin (EXP) nickel atom (ISO) nicotianamine (ISO) nicotinamide (ISO) nimesulide (EXP,ISO) olmesartan (EXP) oltipraz (EXP,ISO) omeprazole (EXP,ISO) orphenadrine (EXP) papaverine (ISO) paracetamol (EXP,ISO) paraquat (EXP) PD123319 (EXP) pentanal (ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) perindopril (EXP) phenobarbital (ISO) phenylmercury acetate (ISO) phenytoin (ISO) pioglitazone (EXP) pirfenidone (EXP) pirinixic acid (ISO) pravastatin (EXP) pregabalin (EXP) quercetin (ISO) quinidine (ISO) rifampicin (ISO) SB 203580 (EXP) SB 431542 (ISO) silicon dioxide (ISO) silver atom (EXP) silver(0) (EXP) simvastatin (ISO) sirolimus (EXP) sodium arsenite (ISO) sodium fluoride (EXP) spironolactone (EXP) streptozocin (EXP,ISO) sulfasalazine (ISO) sulindac (EXP,ISO) sunitinib (ISO) tacrolimus hydrate (EXP) telmisartan (EXP,ISO) testosterone (EXP) testosterone undecanoate (ISO) tetrachloromethane (EXP) tetracycline (ISO) Theaflavin 3,3'-digallate (ISO) theophylline (ISO) thioacetamide (ISO) Thiorphan (ISO) titanium dioxide (EXP) trandolapril (ISO) tributylstannane (ISO) triclosan (ISO) triptonide (ISO) tryptophan (EXP) valproic acid (EXP,ISO) valsartan (EXP,ISO) vancomycin (EXP) xanthone (EXP)
Biological Process
angiotensin maturation (IEA,ISO) angiotensin-mediated drinking behavior (IEA,ISO) entry receptor-mediated virion attachment to host cell (IEA,ISO) maternal process involved in female pregnancy (IEP) negative regulation of ERK1 and ERK2 cascade (IMP) negative regulation of smooth muscle cell proliferation (IMP) negative regulation of transcription by RNA polymerase II (ISO) positive regulation of amino acid transport (IEA,ISO) positive regulation of cardiac muscle contraction (IEA,ISO) positive regulation of gap junction assembly (IEA,ISO) positive regulation of L-proline import across plasma membrane (IEA,ISO) proteolysis (IEA) receptor-mediated virion attachment to host cell (IEA,ISO) regulation of cardiac conduction (IEA,ISO) regulation of inflammatory response (ISO) regulation of systemic arterial blood pressure by renin-angiotensin (IEA,ISO) symbiont entry into host cell (IEA,ISO) tryptophan transport (IEA,ISO)
Cellular Component
apical plasma membrane (IEA,ISO) brush border membrane (IEA,ISO) cell projection (IEA) cell surface (IEA,ISO,ISS) cilium (IEA) cytoplasm (IEA,ISO) extracellular region (IEA,ISO) extracellular space (IBA,IDA,IEA,ISO) membrane (IEA) plasma membrane (IBA,IEA,ISO,ISS)
Molecular Function
carboxypeptidase activity (IDA,IEA,ISO) endopeptidase activity (IEA,ISO) hydrolase activity (IEA) identical protein binding (IEA,ISO) metal ion binding (IEA) metallocarboxypeptidase activity (IEA,ISO) metallopeptidase activity (IBA,IEA,ISO) peptidase activity (IEA) peptidyl-dipeptidase activity (IEA,ISO) protein binding (IPI,ISO) transporter activator activity (IEA,ISO) virus receptor activity (IEA,ISO,ISS)
1.
Olmesartan is an angiotensin II receptor blocker with an inhibitory effect on angiotensin-converting enzyme.
Agata J, etal., Hypertens Res. 2006 Nov;29(11):865-74.
2.
The pathogenicity of SARS-CoV-2 in hACE2 transgenic mice.
Bao L, etal., Nature. 2020 May 7. pii: 10.1038/s41586-020-2312-y. doi: 10.1038/s41586-020-2312-y.
3.
Marked Up-Regulation of ACE2 in Hearts of Patients With Obstructive Hypertrophic Cardiomyopathy: Implications for SARS-CoV-2-Mediated COVID-19.
Bos JM, etal., Mayo Clin Proc. 2020 Jul;95(7):1354-1368. doi: 10.1016/j.mayocp.2020.04.028. Epub 2020 Apr 28.
4.
Telmisartan Prevents Alveolar Bone Loss by Decreasing the Expression of Osteoclasts Markers in Hypertensive Rats With Periodontal Disease.
Brito VGB, etal., Front Pharmacol. 2020 Nov 11;11:579926. doi: 10.3389/fphar.2020.579926. eCollection 2020.
5.
Acute kidney injury in the rat causes cardiac remodelling and increases angiotensin-converting enzyme 2 expression.
Burchill L, etal., Exp Physiol. 2008 May;93(5):622-30. doi: 10.1113/expphysiol.2007.040386. Epub 2008 Jan 25.
6.
Myocardial infarction increases ACE2 expression in rat and humans.
Burrell LM, etal., Eur Heart J 2005 Feb;26(4):369-75; discussion 322-4. Epub 2005 Jan 25.
7.
Effects of the ACE2 inhibitor GL1001 on acute dextran sodium sulfate-induced colitis in mice.
Byrnes JJ, etal., Inflamm Res. 2009 Nov;58(11):819-27. doi: 10.1007/s00011-009-0053-3. Epub 2009 Jun 11.
8.
The ACE2 expression in human heart indicates new potential mechanism of heart injury among patients infected with SARS-CoV-2.
Chen L, etal., Cardiovasc Res. 2020 May 1;116(6):1097-1100. doi: 10.1093/cvr/cvaa078.
9.
Angiotensin-converting enzyme 2 is an essential regulator of heart function.
Crackower MA, etal., Nature 2002 Jun 20;417(6891):822-8.
10.
ACE2-angiotensin-(1-7)-Mas axis in renal ischaemia/reperfusion injury in rats.
da Silveira KD, etal., Clin Sci (Lond). 2010 Jul 23;119(9):385-94. doi: 10.1042/CS20090554.
11.
The host's angiotensin-converting enzyme polymorphism may explain epidemiological findings in COVID-19 infections.
Delanghe JR, etal., Clin Chim Acta. 2020 Jun;505:192-193. doi: 10.1016/j.cca.2020.03.031. Epub 2020 Mar 24.
12.
Gene polymorphisms in angiotensin I converting enzyme (ACE I/D) and angiotensin II converting enzyme (ACE2 C-->T) protect against cerebral malaria in Indian adults.
Dhangadamajhi G, etal., Infect Genet Evol. 2010 Mar;10(2):337-41. doi: 10.1016/j.meegid.2010.01.009. Epub 2010 Feb 1.
13.
ACE2 gene transfer attenuates hypertension-linked pathophysiological changes in the SHR.
Diez-Freire C, etal., Physiol Genomics. 2006 Oct 3;27(1):12-9. Epub 2006 Jun 20.
14.
Angiotensin-converting enzyme-2 overexpression improves left ventricular remodeling and function in a rat model of diabetic cardiomyopathy.
Dong B, etal., J Am Coll Cardiol. 2012 Feb 21;59(8):739-47. doi: 10.1016/j.jacc.2011.09.071.
15.
The K18-Human ACE2 Transgenic Mouse Model Recapitulates Non-severe and Severe COVID-19 in Response to an Infectious Dose of the SARS-CoV-2 Virus.
Dong W, etal., J Virol. 2022 Jan 12;96(1):e0096421. doi: 10.1128/JVI.00964-21. Epub 2021 Oct 20.
16.
The novel angiotensin-converting enzyme (ACE) homolog, ACE2, is selectively expressed by adult Leydig cells of the testis.
Douglas GC, etal., Endocrinology. 2004 Oct;145(10):4703-11. Epub 2004 Jul 1.
17.
Angiotensin-converting enzyme 2 activation protects against hypertension-induced cardiac fibrosis involving extracellular signal-regulated kinases.
Ferreira AJ, etal., Exp Physiol. 2011 Mar;96(3):287-94. doi: 10.1113/expphysiol.2010.055277. Epub 2010 Dec 10.
18.
Antiglaucomatous effects of the activation of intrinsic Angiotensin-converting enzyme 2.
Foureaux G, etal., Invest Ophthalmol Vis Sci. 2013 Jun 21;54(6):4296-306. doi: 10.1167/iovs.12-11427.
19.
ACE2 activation promotes antithrombotic activity.
Fraga-Silva RA, etal., Mol Med. 2010 May-Jun;16(5-6):210-5. doi: 10.2119/molmed.2009.00160. Epub 2010 Jan 22.
20.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
21.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
22.
Angiotensin-converting enzyme 2 inhibits lung injury induced by respiratory syncytial virus.
Gu H, etal., Sci Rep. 2016 Jan 27;6:19840. doi: 10.1038/srep19840.
23.
ACE2 links amino acid malnutrition to microbial ecology and intestinal inflammation.
Hashimoto T, etal., Nature. 2012 Jul 25;487(7408):477-81. doi: 10.1038/nature11228.
24.
A SARS-CoV-2 Infection Model in Mice Demonstrates Protection by Neutralizing Antibodies.
Hassan AO, etal., Cell. 2020 Jun 10. pii: S0092-8674(20)30742-X. doi: 10.1016/j.cell.2020.06.011.
25.
The counterregulating role of ACE2 and ACE2-mediated angiotensin 1-7 signaling against angiotensin II stimulation in vascular cells.
Hayashi N, etal., Hypertens Res. 2010 Nov;33(11):1182-5. doi: 10.1038/hr.2010.147. Epub 2010 Aug 12.
26.
Upregulation of hepatic angiotensin-converting enzyme 2 (ACE2) and angiotensin-(1-7) levels in experimental biliary fibrosis.
Herath CB, etal., J Hepatol. 2007 Sep;47(3):387-95. Epub 2007 Apr 2.
27.
ACE/ACE2 ratio and MMP-9 activity as potential biomarkers in tuberculous pleural effusions.
Hsieh WY, etal., Int J Biol Sci. 2012;8(8):1197-205. doi: 10.7150/ijbs.5087. Epub 2012 Oct 17.
28.
Maternal Tryptophan Supplementation Protects Adult Rat Offspring against Hypertension Programmed by Maternal Chronic Kidney Disease: Implication of Tryptophan-Metabolizing Microbiome and Aryl Hydrocarbon Receptor.
Hsu CN, etal., Int J Mol Sci. 2020 Jun 26;21(12):4552. doi: 10.3390/ijms21124552.
29.
Upregulation Of Angiotensin Converting Enzyme 2 In Hepatic Fibrosis By Angiotensin Converting Enzyme Inhibitors: An In Vivo And In Vitro Study.
Huang ML, etal., Clin Exp Pharmacol Physiol. 2009 Sep 28.
30.
Angiotensin-converting enzyme 2 protects from severe acute lung failure.
Imai Y, etal., Nature. 2005 Jul 7;436(7047):112-6. doi: 10.1038/nature03712.
31.
A crucial role of angiotensin converting enzyme 2 (ACE2) in SARS coronavirus-induced lung injury.
Kuba K, etal., Nat Med. 2005 Aug;11(8):875-9. doi: 10.1038/nm1267. Epub 2005 Jul 10.
32.
Targeting the renin-angiotensin system: what's new?
Leckie BJ Curr Med Chem Cardiovasc Hematol Agents. 2005 Jan;3(1):23-32.
33.
Modification of the terminal residue of apelin-13 antagonizes its hypotensive action.
Lee DK, etal., Endocrinology. 2005 Jan;146(1):231-6. Epub 2004 Oct 14.
34.
Receptor and viral determinants of SARS-coronavirus adaptation to human ACE2.
Li W, etal., EMBO J. 2005 Apr 20;24(8):1634-43. doi: 10.1038/sj.emboj.7600640. Epub 2005 Mar 24.
35.
Sini decoction alleviates E. coli induced acute lung injury in mice via equilibrating ACE-AngII-AT1R and ACE2-Ang-(1-7)-Mas axis.
Liu J, etal., Life Sci. 2018 Sep 1;208:139-148. doi: 10.1016/j.lfs.2018.07.013. Epub 2018 Jul 7.
36.
The expression of angiotensin-converting enzyme 2-angiotensin-(1-7)-Mas receptor axis are upregulated after acute cerebral ischemic stroke in rats.
Lu J, etal., Neuropeptides. 2013 Oct;47(5):289-95. doi: 10.1016/j.npep.2013.09.002. Epub 2013 Sep 18.
37.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
38.
Renal ACE and ACE2 expression in early diabetic rats.
Moon JY, etal., Nephron Exp Nephrol. 2008;110(1):e8-e16. Epub 2008 Aug 4.
39.
Oral administration of an angiotensin-converting enzyme 2 activator ameliorates diabetes-induced cardiac dysfunction.
Murca TM, etal., Regul Pept. 2012 Aug 20;177(1-3):107-15. doi: 10.1016/j.regpep.2012.05.093. Epub 2012 May 14.
40.
ACE2 and ANG-(1-7) in the rat uterus during early and late gestation.
Neves LA, etal., Am J Physiol Regul Integr Comp Physiol. 2008 Jan;294(1):R151-61. Epub 2007 Oct 31.
41.
Molecular basis of cross-species ACE2 interactions with SARS-CoV-2-like viruses of pangolin origin.
Niu S, etal., EMBO J. 2021 Aug 16;40(16):e107786. doi: 10.15252/embj.2021107786. Epub 2021 Jun 8.
42.
Enalapril attenuates downregulation of Angiotensin-converting enzyme 2 in the late phase of ventricular dysfunction in myocardial infarcted rat.
Ocaranza MP, etal., Hypertension. 2006 Oct;48(4):572-8. Epub 2006 Aug 14.
43.
SARS-coronavirus modulation of myocardial ACE2 expression and inflammation in patients with SARS.
Oudit GY, etal., Eur J Clin Invest. 2009 Jul;39(7):618-25. doi: 10.1111/j.1365-2362.2009.02153.x. Epub 2009 May 6.
44.
Chronic liver injury in rats and humans upregulates the novel enzyme angiotensin converting enzyme 2.
Paizis G, etal., Gut. 2005 Dec;54(12):1790-6. doi: 10.1136/gut.2004.062398. Epub 2005 Sep 15.
45.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
46.
Diminazene aceturate enhances angiotensin-converting enzyme 2 activity and attenuates ischemia-induced cardiac pathophysiology.
Qi Y, etal., Hypertension. 2013 Oct;62(4):746-52. doi: 10.1161/HYPERTENSIONAHA.113.01337. Epub 2013 Aug 19.
47.
[Effect of atorvastatin on ACE2 expression in pressure overload induced cardiac hypertrophy in rats].
Qin XT, etal., Zhong Nan Da Xue Xue Bao Yi Xue Ban. 2008 May;33(5):438-42.
48.
Zhonghua lao dong wei sheng zhi ye bing za zhi = Zhonghua laodong weisheng zhiyebing zazhi = Chinese journal of industrial hygiene and occupational diseases
Qiu QM, etal., Zhonghua Lao Dong Wei Sheng Zhi Ye Bing Za Zhi. 2010 Apr;28(4):275-9.
49.
Decreased glomerular and tubular expression of ACE2 in patients with type 2 diabetes and kidney disease.
Reich HN, etal., Kidney Int. 2008 Dec;74(12):1610-6. Epub 2008 Oct 1.
50.
A place in our hearts for the lowly angiotensin 1-7 peptide?
Reudelhuber TL Hypertension. 2006 May;47(5):811-5. Epub 2006 Mar 6.
51.
GOA pipeline
RGD automated data pipeline
52.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
53.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
54.
Angiotensin-converting enzyme 2 (ACE2) and ACE activities display tissue-specific sensitivity to undernutrition-programmed hypertension in the adult rat.
Riviere G, etal., Hypertension. 2005 Nov;46(5):1169-74. Epub 2005 Oct 3.
55.
The ACE2/Ang-(1-7)/Mas Axis Confers Cardiopulmonary Protection against Lung Fibrosis and Pulmonary Hypertension.
Shenoy V, etal., Am J Respir Crit Care Med. 2010 Jun 25.
56.
Oral delivery of Angiotensin-converting enzyme 2 and Angiotensin-(1-7) bioencapsulated in plant cells attenuates pulmonary hypertension.
Shenoy V, etal., Hypertension. 2014 Dec;64(6):1248-59. doi: 10.1161/HYPERTENSIONAHA.114.03871. Epub 2014 Sep 15.
57.
Oral delivery of ACE2/Ang-(1-7) bioencapsulated in plant cells protects against experimental uveitis and autoimmune uveoretinitis.
Shil PK, etal., Mol Ther. 2014 Dec;22(12):2069-2082. doi: 10.1038/mt.2014.179. Epub 2014 Sep 17.
58.
A Dynamic Variation of Pulmonary ACE2 Is Required to Modulate Neutrophilic Inflammation in Response to Pseudomonas aeruginosa Lung Infection in Mice.
Sodhi CP, etal., J Immunol. 2019 Dec 1;203(11):3000-3012. doi: 10.4049/jimmunol.1900579. Epub 2019 Oct 23.
59.
ACE2 deficiency modifies renoprotection afforded by ACE inhibition in experimental diabetes.
Tikellis C, etal., Diabetes. 2008 Apr;57(4):1018-25. Epub 2008 Jan 30.
60.
ACE2 X-ray structures reveal a large hinge-bending motion important for inhibitor binding and catalysis.
Towler P, etal., J Biol Chem. 2004 Apr 23;279(17):17996-8007. Epub 2004 Jan 30.
61.
Expression of Human ACE2 in Lactobacillus and Beneficial Effects in Diabetic Retinopathy in Mice.
Verma A, etal., Mol Ther Methods Clin Dev. 2019 Jul 10;14:161-170. doi: 10.1016/j.omtm.2019.06.007. eCollection 2019 Sep 13.
62.
ACE2 and Ang-(1-7) confer protection against development of diabetic retinopathy.
Verma A, etal., Mol Ther. 2012 Jan;20(1):28-36. doi: 10.1038/mt.2011.155. Epub 2011 Jul 26.
63.
Discrepancy between intrarenal messenger RNA and protein expression of ACE and ACE2 in human diabetic nephropathy.
Wang G, etal., Am J Nephrol. 2009;29(6):524-31. Epub 2008 Dec 12.
64.
Expression of ACE and ACE2 in patients with hypertensive nephrosclerosis.
Wang G, etal., Kidney Blood Press Res. 2011;34(3):141-9. doi: 10.1159/000324521. Epub 2011 Feb 24.
65.
SARS-CoV-2 Causes Lung Infection without Severe Disease in Human ACE2 Knock-In Mice.
Winkler ES, etal., J Virol. 2022 Jan 12;96(1):e0151121. doi: 10.1128/JVI.01511-21. Epub 2021 Oct 20.
66.
[Relationship of angiotensin-converting enzyme 2 gene polymorphisms and vulnerability to coronary heart disease in patients with type 2 diabetes mellitus]
Yan QN, etal., Nan Fang Yi Ke Da Xue Xue Bao. 2008 Aug;28(8):1365-8.
67.
Angiotensin-converting enzyme 2 (ACE2) mediates influenza H7N9 virus-induced acute lung injury.
Yang P, etal., Sci Rep. 2014 Nov 13;4:7027. doi: 10.1038/srep07027.
68.
Mice transgenic for human angiotensin-converting enzyme 2 provide a model for SARS coronavirus infection.
Yang XH, etal., Comp Med. 2007 Oct;57(5):450-9.
69.
ACE2 overexpression ameliorates left ventricular remodeling and dysfunction in a rat model of myocardial infarction.
Zhao YX, etal., Hum Gene Ther. 2010 Nov;21(11):1545-54. doi: 10.1089/hum.2009.160.
70.
Association of angiotensin-converting enzyme 2 gene A/G polymorphism and elevated blood pressure in Chinese patients with metabolic syndrome.
Zhong J, etal., J Lab Clin Med. 2006 Feb;147(2):91-5.
71.
Telmisartan attenuates aortic hypertrophy in hypertensive rats by the modulation of ACE2 and profilin-1 expression.
Zhong JC, etal., Regul Pept. 2011 Jan 17;166(1-3):90-7. doi: 10.1016/j.regpep.2010.09.005. Epub 2010 Sep 18.
72.
Decreased expression of angiotensin-converting enzyme 2 in pancreatic ductal adenocarcinoma is associated with tumor progression.
Zhou L, etal., Tohoku J Exp Med. 2009 Feb;217(2):123-31.
73.
Angiotensin-converting enzyme 2 protects from lethal avian influenza A H5N1 infections.
Zou Z, etal., Nat Commun. 2014 May 6;5:3594. doi: 10.1038/ncomms4594.
Ace2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 33,925,458 - 33,972,851 (-) NCBI GRCr8 mRatBN7.2 X 30,293,597 - 30,340,961 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 30,293,589 - 30,340,977 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 31,326,034 - 31,372,619 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 34,763,480 - 34,809,624 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 30,950,895 - 30,996,838 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 32,050,734 - 32,095,860 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 32,049,931 - 32,096,016 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 32,422,286 - 32,469,137 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 51,051,758 - 51,096,036 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 51,105,228 - 51,149,505 (-) NCBI Celera X 30,638,123 - 30,683,403 (-) NCBI Celera Cytogenetic Map X q14 NCBI
ACE2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 15,518,197 - 15,607,211 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 15,494,566 - 15,607,236 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 15,536,320 - 15,625,334 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 15,489,077 - 15,529,058 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 15,338,812 - 15,378,794 NCBI Celera X 19,694,648 - 19,735,682 (-) NCBI Celera Cytogenetic Map X p22.2 NCBI HuRef X 13,333,989 - 13,374,656 (-) NCBI HuRef CHM1_1 X 15,610,102 - 15,651,154 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 15,101,170 - 15,190,203 (-) NCBI T2T-CHM13v2.0
Ace2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 162,922,338 - 162,971,414 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 162,922,328 - 162,971,416 (+) Ensembl GRCm39 Ensembl GRCm38 X 164,139,342 - 164,188,418 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 164,139,332 - 164,188,420 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 160,577,274 - 160,626,350 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 159,484,737 - 159,532,523 (+) NCBI MGSCv36 mm8 Celera X 147,353,722 - 147,402,904 (+) NCBI Celera Cytogenetic Map X F5 NCBI cM Map X 76.12 NCBI
Ace2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955519 2,591,248 - 2,633,495 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955519 2,591,229 - 2,643,705 (+) NCBI ChiLan1.0 ChiLan1.0
ACE2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 17,358,905 - 17,402,027 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 17,362,290 - 17,405,412 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 8,189,267 - 8,229,415 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 15,470,896 - 15,510,891 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 15,470,896 - 15,510,891 (-) Ensembl panpan1.1 panPan2
ACE2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 11,798,839 - 11,839,591 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 11,798,839 - 11,900,594 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 11,706,330 - 11,745,360 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 11,760,479 - 11,822,897 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 11,759,554 - 11,789,618 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 11,824,224 - 11,862,960 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 11,818,311 - 11,856,868 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 11,843,799 - 11,882,613 (-) NCBI UU_Cfam_GSD_1.0
Ace2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 4,964,502 - 5,012,706 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936470 4,965,332 - 5,011,702 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936470 4,964,526 - 5,011,808 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ACE2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 12,093,242 - 12,151,286 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 12,099,849 - 12,152,204 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 13,061,317 - 13,089,851 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ACE2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 14,032,231 - 14,094,163 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 14,030,233 - 14,077,785 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666056 15,866,608 - 15,915,985 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ace2
.
Predicted Target Of
Count of predictions: 76 Count of miRNA genes: 69 Interacting mature miRNAs: 73 Transcripts: ENSRNOT00000049947 Prediction methods: Microtar, Miranda, Pita, Rnahybrid, Targetscan Result types: miRGate_prediction
1598873 Memor2 Memory QTL 2 2.5 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) X 20990947 41052531 Rat 70165 Bp64 Blood pressure QTL 64 5.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) X 1448129 31706553 Rat 1298071 Edpm12 Estrogen-dependent pituitary mass QTL 12 3.2 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) X 2927898 47927898 Rat 2290375 Gluco34 Glucose level QTL 34 2.75 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) X 20990947 41203591 Rat 731181 Uae27 Urinary albumin excretion QTL 27 2.7 0.0059 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) X 1 43491017 Rat 61430 Cia18 Collagen induced arthritis QTL 18 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 14843113 120568734 Rat 10755455 Coatc13 Coat color QTL 13 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 4406000 49406000 Rat 631666 Iddm5 Insulin dependent diabetes mellitus QTL 5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) X 4494549 49494549 Rat 71116 Niddm16 Non-insulin dependent diabetes mellitus QTL 16 7.81 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) X 15297802 60297802 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
43
113
89
88
57
25
57
6
209
90
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000049947 ⟹ ENSRNOP00000047913
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl X 32,050,736 - 32,095,867 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000080730 ⟹ ENSRNOP00000070410
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 30,293,589 - 30,340,977 (-) Ensembl Rnor_6.0 Ensembl X 32,049,931 - 32,096,016 (-) Ensembl
RefSeq Acc Id:
NM_001012006 ⟹ NP_001012006
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 33,925,458 - 33,971,596 (-) NCBI mRatBN7.2 X 30,293,597 - 30,339,735 (-) NCBI Rnor_6.0 X 32,050,734 - 32,095,860 (-) NCBI Rnor_5.0 X 32,422,286 - 32,469,137 (-) NCBI RGSC_v3.4 X 51,051,758 - 51,096,036 (-) RGD Celera X 30,638,123 - 30,683,403 (-) NCBI
Sequence:
ATGTCAAGCTCCTGCTGGCTCCTTCTCAGCCTTGTTGCTGTTGCTACTGCTCAGTCCCTCATCGAGGAAAAGGCCGAGAGCTTTTTAAACAAGTTTAACCAGGAAGCTGAAGACCTGTCTTATCAAAG
hide sequence
RefSeq Acc Id:
XM_039099654 ⟹ XP_038955582
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 33,925,458 - 33,972,851 (-) NCBI mRatBN7.2 X 30,293,597 - 30,340,961 (-) NCBI
RefSeq Acc Id:
XM_039099655 ⟹ XP_038955583
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 33,925,458 - 33,972,851 (-) NCBI mRatBN7.2 X 30,293,597 - 30,340,961 (-) NCBI
RefSeq Acc Id:
NP_001012006 ⟸ NM_001012006
- Peptide Label:
precursor
- UniProtKB:
Q5EGZ1 (UniProtKB/Swiss-Prot), C7ECU5 (UniProtKB/TrEMBL), A0A0G2JXU8 (UniProtKB/TrEMBL)
- Sequence:
MSSSCWLLLSLVAVATAQSLIEEKAESFLNKFNQEAEDLSYQSSLASWNYNTNITEENAQKMNEAAAKWSAFYEEQSKIAQNFSLQEIQNATIKRQLKALQQSGSSALSPDKNKQLNTILNTMSTIYS
hide sequence
Ensembl Acc Id:
ENSRNOP00000070410 ⟸ ENSRNOT00000080730
Ensembl Acc Id:
ENSRNOP00000047913 ⟸ ENSRNOT00000049947
RefSeq Acc Id:
XP_038955583 ⟸ XM_039099655
- Peptide Label:
isoform X1
- UniProtKB:
Q5EGZ1 (UniProtKB/Swiss-Prot), C7ECU5 (UniProtKB/TrEMBL), A0A0G2JXU8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038955582 ⟸ XM_039099654
- Peptide Label:
isoform X1
- UniProtKB:
Q5EGZ1 (UniProtKB/Swiss-Prot), C7ECU5 (UniProtKB/TrEMBL), A0A0G2JXU8 (UniProtKB/TrEMBL)
RGD ID: 13701802 Promoter ID: EPDNEW_R12321 Type: single initiation site Name: Ace2_1 Description: angiotensin I converting enzyme 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 X 32,095,833 - 32,095,893 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-02-09
Ace2
angiotensin converting enzyme 2
Ace2
angiotensin I converting enzyme 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-06-19
Ace2
angiotensin I converting enzyme 2
Ace2
angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-07-08
Ace2
angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
Symbol and Name status set to approved
1299863 APPROVED
2005-02-22
Ace2
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_process
mouse homolog has a role in regulation of cardiac contractility, regulation of the expression of hypoxia-regulated genes and modulating the levels of Angiotesin 1 and 2
629626
gene_regulation
expression is downregulated in hypertensive rats
629626
