Symbol:
Slc35b1
Name:
solute carrier family 35, member B1
RGD ID:
727783
Description:
Predicted to enable ATP:ADP antiporter activity; UDP-galactose transmembrane transporter activity; and UDP-glucose transmembrane transporter activity. Predicted to be involved in UDP-galactose transmembrane transport. Predicted to be located in endoplasmic reticulum and nucleoplasm. Predicted to be active in Golgi membrane and endoplasmic reticulum membrane. Orthologous to human SLC35B1 (solute carrier family 35 member B1); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
ATP/ADP exchanger ER; AXER; endoplasmic reticulum ATP/ADP translocase; galactose transporter; LOC287642; MGC105266; solute carrier family 35 member B1; UDP-galactose transporter-related protein 1; UGTrel1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 80,824,972 - 80,832,048 (+) NCBI GRCr8 mRatBN7.2 10 80,327,921 - 80,335,279 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 80,327,945 - 80,335,274 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 85,276,663 - 85,283,743 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 84,774,708 - 84,781,789 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 80,166,875 - 80,173,936 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 83,201,532 - 83,208,605 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 83,201,311 - 83,208,605 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 83,010,919 - 83,017,992 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 84,069,903 - 84,076,976 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 84,084,272 - 84,091,346 (+) NCBI Celera 10 79,100,288 - 79,107,361 (+) NCBI Celera Cytogenetic Map 10 q26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Slc35b1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of SLC35B1 mRNA] CTD PMID:31150632 Slc35b1 Rat (-)-alpha-phellandrene decreases expression ISO SLC35B1 (Homo sapiens) 6480464 alpha phellandrene results in decreased expression of SLC35B1 mRNA CTD PMID:25075043 Slc35b1 Rat 1,2-dimethylhydrazine multiple interactions ISO Slc35b1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SLC35B1 mRNA CTD PMID:22206623 Slc35b1 Rat 17alpha-ethynylestradiol multiple interactions ISO Slc35b1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SLC35B1 mRNA CTD PMID:17942748 Slc35b1 Rat 17alpha-ethynylestradiol increases expression ISO Slc35b1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of SLC35B1 mRNA CTD PMID:17942748 Slc35b1 Rat 17alpha-ethynylestradiol affects expression ISO Slc35b1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of SLC35B1 mRNA CTD PMID:17555576 Slc35b1 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of SLC35B1 mRNA CTD PMID:26496021 Slc35b1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Slc35b1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SLC35B1 mRNA CTD PMID:21570461 Slc35b1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SLC35B1 mRNA CTD PMID:33387578 and PMID:34747641 Slc35b1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Slc35b1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SLC35B1 mRNA CTD PMID:17942748 Slc35b1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Slc35b1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SLC35B1 mRNA CTD PMID:17942748 Slc35b1 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of SLC35B1 mRNA CTD PMID:21346803 Slc35b1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of SLC35B1 mRNA CTD PMID:21346803 Slc35b1 Rat 4,4'-sulfonyldiphenol increases expression ISO Slc35b1 (Mus musculus) 6480464 bisphenol S results in increased expression of SLC35B1 mRNA CTD PMID:39298647 Slc35b1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SLC35B1 mRNA CTD PMID:36041667 Slc35b1 Rat alpha-phellandrene decreases expression ISO SLC35B1 (Homo sapiens) 6480464 alpha phellandrene results in decreased expression of SLC35B1 mRNA CTD PMID:25075043 Slc35b1 Rat atrazine decreases expression ISO SLC35B1 (Homo sapiens) 6480464 Atrazine results in decreased expression of SLC35B1 mRNA CTD PMID:22378314 Slc35b1 Rat benzo[a]pyrene increases expression ISO Slc35b1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SLC35B1 mRNA CTD PMID:22228805 Slc35b1 Rat benzo[a]pyrene increases methylation ISO SLC35B1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SLC35B1 promoter CTD PMID:27901495 Slc35b1 Rat beta-lapachone decreases expression ISO SLC35B1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of SLC35B1 mRNA CTD PMID:38218311 Slc35b1 Rat bexarotene increases expression EXP 6480464 bexarotene results in increased expression of SLC35B1 mRNA CTD PMID:16648578 Slc35b1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Slc35b1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of SLC35B1 mRNA CTD PMID:33754040 Slc35b1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SLC35B1 mRNA and [bisphenol A co-treated with Estradiol] results in decreased expression of SLC35B1 mRNA CTD PMID:26496021 and PMID:36041667 Slc35b1 Rat bisphenol A affects expression ISO SLC35B1 (Homo sapiens) 6480464 bisphenol A affects the expression of SLC35B1 mRNA CTD PMID:30903817 Slc35b1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SLC35B1 mRNA CTD PMID:30816183 and PMID:32528016 Slc35b1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SLC35B1 mRNA CTD PMID:25181051 and PMID:32145629 Slc35b1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SLC35B1 mRNA CTD PMID:36041667 Slc35b1 Rat carbamazepine affects expression ISO SLC35B1 (Homo sapiens) 6480464 Carbamazepine affects the expression of SLC35B1 mRNA CTD PMID:25979313 Slc35b1 Rat carbon nanotube increases expression ISO Slc35b1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Slc35b1 Rat CGP 52608 multiple interactions ISO SLC35B1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SLC35B1 gene] CTD PMID:28238834 Slc35b1 Rat chenodeoxycholic acid multiple interactions ISO SLC35B1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Cyclosporine] results in increased expression of SLC35B1 mRNA and [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with nefazodone] results in increased expression of SLC35B1 mRNA CTD PMID:33819548 Slc35b1 Rat copper(II) sulfate decreases expression ISO SLC35B1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SLC35B1 mRNA CTD PMID:19549813 Slc35b1 Rat cyclosporin A increases expression ISO Slc35b1 (Mus musculus) 6480464 Cyclosporine results in increased expression of SLC35B1 mRNA CTD PMID:19770486 and PMID:25270620 Slc35b1 Rat cyclosporin A multiple interactions ISO SLC35B1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Cyclosporine] results in increased expression of SLC35B1 mRNA CTD PMID:33819548 Slc35b1 Rat cyclosporin A increases expression ISO SLC35B1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of SLC35B1 mRNA CTD PMID:20106945 more ... Slc35b1 Rat deoxycholic acid multiple interactions ISO SLC35B1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Cyclosporine] results in increased expression of SLC35B1 mRNA and [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with nefazodone] results in increased expression of SLC35B1 mRNA CTD PMID:33819548 Slc35b1 Rat Dibutyl phosphate affects expression ISO SLC35B1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SLC35B1 mRNA CTD PMID:37042841 Slc35b1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of SLC35B1 mRNA CTD PMID:21266533 Slc35b1 Rat disodium selenite increases expression ISO SLC35B1 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of SLC35B1 mRNA CTD PMID:18175754 Slc35b1 Rat diuron decreases expression ISO SLC35B1 (Homo sapiens) 6480464 Diuron results in decreased expression of SLC35B1 mRNA CTD PMID:35967413 Slc35b1 Rat doxorubicin decreases expression ISO SLC35B1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SLC35B1 mRNA CTD PMID:29803840 Slc35b1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of SLC35B1 mRNA CTD PMID:29391264 Slc35b1 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of SLC35B1 mRNA CTD PMID:15353170 Slc35b1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of SLC35B1 mRNA CTD PMID:24136188 Slc35b1 Rat folic acid multiple interactions ISO Slc35b1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SLC35B1 mRNA CTD PMID:22206623 Slc35b1 Rat FR900359 affects phosphorylation ISO SLC35B1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of SLC35B1 protein CTD PMID:37730182 Slc35b1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of SLC35B1 mRNA CTD PMID:22061828 and PMID:33387578 Slc35b1 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of SLC35B1 mRNA CTD PMID:24136188 Slc35b1 Rat glycochenodeoxycholic acid multiple interactions ISO SLC35B1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Cyclosporine] results in increased expression of SLC35B1 mRNA and [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with nefazodone] results in increased expression of SLC35B1 mRNA CTD PMID:33819548 Slc35b1 Rat glycocholic acid multiple interactions ISO SLC35B1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Cyclosporine] results in increased expression of SLC35B1 mRNA and [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with nefazodone] results in increased expression of SLC35B1 mRNA CTD PMID:33819548 Slc35b1 Rat glycodeoxycholic acid multiple interactions ISO SLC35B1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Cyclosporine] results in increased expression of SLC35B1 mRNA and [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with nefazodone] results in increased expression of SLC35B1 mRNA CTD PMID:33819548 Slc35b1 Rat isotretinoin decreases expression ISO SLC35B1 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of SLC35B1 mRNA CTD PMID:20436886 Slc35b1 Rat monosodium L-glutamate multiple interactions ISO Slc35b1 (Mus musculus) 6480464 [Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of SLC35B1 mRNA CTD PMID:22078008 Slc35b1 Rat nefazodone multiple interactions ISO SLC35B1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with nefazodone] results in increased expression of SLC35B1 mRNA CTD PMID:33819548 Slc35b1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of SLC35B1 mRNA CTD PMID:24136188 Slc35b1 Rat paracetamol affects expression ISO Slc35b1 (Mus musculus) 6480464 Acetaminophen affects the expression of SLC35B1 mRNA CTD PMID:17562736 Slc35b1 Rat paracetamol multiple interactions ISO Slc35b1 (Mus musculus) 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in increased expression of SLC35B1 mRNA] CTD PMID:29246445 Slc35b1 Rat paracetamol increases expression ISO Slc35b1 (Mus musculus) 6480464 Acetaminophen results in increased expression of SLC35B1 mRNA CTD PMID:29246445 Slc35b1 Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of SLC35B1 mRNA CTD PMID:19162173 Slc35b1 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of SLC35B1 mRNA CTD PMID:19162173 Slc35b1 Rat pirinixic acid decreases expression ISO Slc35b1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of SLC35B1 mRNA CTD PMID:23811191 Slc35b1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of SLC35B1 mRNA CTD PMID:19162173 Slc35b1 Rat propiconazole increases expression ISO Slc35b1 (Mus musculus) 6480464 propiconazole results in increased expression of SLC35B1 mRNA CTD PMID:21278054 Slc35b1 Rat rotenone increases expression ISO SLC35B1 (Homo sapiens) 6480464 Rotenone results in increased expression of SLC35B1 mRNA CTD PMID:33512557 Slc35b1 Rat sodium arsenite decreases expression ISO SLC35B1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SLC35B1 mRNA CTD PMID:34032870 Slc35b1 Rat tamoxifen affects expression ISO Slc35b1 (Mus musculus) 6480464 Tamoxifen affects the expression of SLC35B1 mRNA CTD PMID:17555576 Slc35b1 Rat testosterone decreases expression ISO Slc35b1 (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of SLC35B1 mRNA CTD PMID:33848595 Slc35b1 Rat tetrachloroethene decreases expression ISO Slc35b1 (Mus musculus) 6480464 Tetrachloroethylene results in decreased expression of SLC35B1 mRNA CTD PMID:28973375 Slc35b1 Rat tetrachloromethane increases expression ISO Slc35b1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of SLC35B1 mRNA CTD PMID:25270620 more ... Slc35b1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of SLC35B1 mRNA] CTD PMID:31150632 Slc35b1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of SLC35B1 mRNA CTD PMID:31150632 Slc35b1 Rat thapsigargin increases expression ISO SLC35B1 (Homo sapiens) 6480464 Thapsigargin results in increased expression of SLC35B1 mRNA CTD PMID:22378314 and PMID:29453283 Slc35b1 Rat titanium dioxide increases expression ISO Slc35b1 (Mus musculus) 6480464 titanium dioxide results in increased expression of SLC35B1 mRNA CTD PMID:23557971 Slc35b1 Rat titanium dioxide decreases methylation ISO Slc35b1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SLC35B1 promoter CTD PMID:35295148 Slc35b1 Rat triphenyl phosphate affects expression ISO SLC35B1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SLC35B1 mRNA CTD PMID:37042841 Slc35b1 Rat tunicamycin increases expression ISO Slc35b1 (Mus musculus) 6480464 Tunicamycin results in increased expression of SLC35B1 mRNA CTD PMID:17127020 Slc35b1 Rat tunicamycin increases expression ISO SLC35B1 (Homo sapiens) 6480464 Tunicamycin results in increased expression of SLC35B1 mRNA CTD PMID:22378314 and PMID:29453283 Slc35b1 Rat valproic acid increases expression ISO SLC35B1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SLC35B1 mRNA CTD PMID:23179753 Slc35b1 Rat valproic acid decreases methylation ISO SLC35B1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of SLC35B1 gene CTD PMID:29154799 Slc35b1 Rat valproic acid affects expression ISO Slc35b1 (Mus musculus) 6480464 Valproic Acid affects the expression of SLC35B1 mRNA CTD PMID:17292431 Slc35b1 Rat zinc atom increases expression ISO SLC35B1 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of SLC35B1 mRNA CTD PMID:22171008 Slc35b1 Rat zinc(0) increases expression ISO SLC35B1 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of SLC35B1 mRNA CTD PMID:22171008
(+)-schisandrin B (EXP) (-)-alpha-phellandrene (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrotoluene (EXP) 2,4-dinitrotoluene (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) alpha-phellandrene (ISO) atrazine (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bexarotene (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) carbamazepine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chenodeoxycholic acid (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) deoxycholic acid (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) disodium selenite (ISO) diuron (ISO) doxorubicin (ISO) endosulfan (EXP) ethanol (EXP) flutamide (EXP) folic acid (ISO) FR900359 (ISO) gentamycin (EXP) glafenine (EXP) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) isotretinoin (ISO) monosodium L-glutamate (ISO) nefazodone (ISO) nimesulide (EXP) paracetamol (ISO) perfluorooctane-1-sulfonic acid (EXP) phenobarbital (EXP) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (EXP) propiconazole (ISO) rotenone (ISO) sodium arsenite (ISO) tamoxifen (ISO) testosterone (ISO) tetrachloroethene (ISO) tetrachloromethane (EXP,ISO) thapsigargin (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) tunicamycin (ISO) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
Slc35b1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 80,824,972 - 80,832,048 (+) NCBI GRCr8 mRatBN7.2 10 80,327,921 - 80,335,279 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 80,327,945 - 80,335,274 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 85,276,663 - 85,283,743 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 84,774,708 - 84,781,789 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 80,166,875 - 80,173,936 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 83,201,532 - 83,208,605 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 83,201,311 - 83,208,605 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 83,010,919 - 83,017,992 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 84,069,903 - 84,076,976 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 84,084,272 - 84,091,346 (+) NCBI Celera 10 79,100,288 - 79,107,361 (+) NCBI Celera Cytogenetic Map 10 q26 NCBI
SLC35B1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 49,700,943 - 49,708,197 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 49,700,934 - 49,709,014 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 47,778,305 - 47,785,326 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 45,133,689 - 45,140,281 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 45,133,688 - 45,140,281 NCBI Celera 17 44,233,680 - 44,240,270 (-) NCBI Celera Cytogenetic Map 17 q21.33 NCBI HuRef 17 43,143,297 - 43,150,313 (-) NCBI HuRef CHM1_1 17 47,843,310 - 47,850,327 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 50,564,044 - 50,571,286 (-) NCBI T2T-CHM13v2.0
Slc35b1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 95,275,696 - 95,282,602 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 95,275,518 - 95,282,602 (+) Ensembl GRCm39 Ensembl GRCm38 11 95,384,856 - 95,391,776 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 95,384,692 - 95,391,776 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 95,246,236 - 95,252,966 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 95,201,012 - 95,207,742 (+) NCBI MGSCv36 mm8 Celera 11 105,008,860 - 105,015,576 (+) NCBI Celera Cytogenetic Map 11 D NCBI cM Map 11 59.01 NCBI
Slc35b1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955451 11,870,771 - 11,878,361 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955451 11,870,771 - 11,877,149 (+) NCBI ChiLan1.0 ChiLan1.0
SLC35B1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 65,886,119 - 65,893,139 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 70,692,673 - 70,699,464 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 43,788,382 - 43,795,123 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 48,517,876 - 48,525,070 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 48,517,867 - 48,524,937 (-) Ensembl panpan1.1 panPan2
SLC35B1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 25,767,285 - 25,776,191 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 25,769,594 - 25,776,614 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 25,225,132 - 25,234,029 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 26,561,952 - 26,570,848 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 26,561,965 - 26,570,882 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 25,329,862 - 25,338,754 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 25,591,136 - 25,597,722 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 25,718,148 - 25,727,044 (-) NCBI UU_Cfam_GSD_1.0
Slc35b1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 25,192,962 - 25,203,421 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936490 11,871,483 - 11,878,237 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936490 11,871,723 - 11,880,595 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SLC35B1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 25,881,256 - 25,888,293 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 25,881,832 - 25,888,546 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 25,888,584 - 25,895,143 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SLC35B1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 70,096,008 - 70,102,714 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 70,096,183 - 70,102,527 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 41,204,760 - 41,211,493 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Slc35b1
.
Predicted Target Of
Count of predictions: 22 Count of miRNA genes: 22 Interacting mature miRNAs: 22 Transcripts: ENSRNOT00000006179 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1579919 Bp281 Blood pressure QTL 281 0.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 74372084 94965338 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 1300107 Rf18 Renal function QTL 18 3.41 urine output (VT:0003620) timed urine volume (CMO:0000260) 10 78775516 98279596 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 10450495 Bp383 Blood pressure QTL 383 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 94965338 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2292617 Ept18 Estrogen-induced pituitary tumorigenesis QTL 18 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 724516 Uae17 Urinary albumin excretion QTL 17 3.6 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 10 78210622 85220348 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 1357344 Bp249 Blood pressure QTL 249 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 66743655 98003205 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 2306793 Ean5 Experimental allergic neuritis QTL 5 4.7 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 72552416 93995749 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 2298481 Eau9 Experimental allergic uveoretinitis QTL 9 0.0169 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 65927233 82565079 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 1358915 Stresp7 Stress response QTL 7 3.52 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 78899655 87307728 Rat 70363 Bp71 Blood pressure QTL 71 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 61345276 81714865 Rat 61402 Niddm3 Non-insulin dependent diabetes mellitus QTL 3 4.58 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 61345413 82564856 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 2325836 Bp346 Blood pressure QTL 346 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 84007272 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 12880053 Cm104 Cardiac mass QTL 104 0.009 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 10 73452992 83463334 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 12880050 Am10 Aortic mass QTL 10 0.016 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 74372084 84007272 Rat 1358188 Ept9 Estrogen-induced pituitary tumorigenesis QTL 9 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 631537 Oia4 Oil induced arthritis QTL 4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 75631887 87055282 Rat 634354 Rends3 Renal damage susceptibility QTL 3 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 10 79813789 85160854 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000006179 ⟹ ENSRNOP00000006179
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 80,327,945 - 80,335,274 (+) Ensembl Rnor_6.0 Ensembl 10 83,201,311 - 83,208,605 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000102666 ⟹ ENSRNOP00000090121
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 80,328,175 - 80,335,273 (+) Ensembl
RefSeq Acc Id:
NM_199081 ⟹ NP_954512
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 80,824,972 - 80,832,045 (+) NCBI mRatBN7.2 10 80,328,198 - 80,335,270 (+) NCBI Rnor_6.0 10 83,201,532 - 83,208,605 (+) NCBI Rnor_5.0 10 83,010,919 - 83,017,992 (+) NCBI RGSC_v3.4 10 84,069,903 - 84,076,976 (+) RGD Celera 10 79,100,288 - 79,107,361 (+) RGD
Sequence:
ATGTCCGCCTGGAGCTTTCGCCTTCGCCGCCGGTACCGCTACCTGTTCTGAACGGATCTCCGGCCGACTCGTCCCTGCGTCTCATGGCCGCTAGCAGATCCCTGGTGCCCGACAGGCTGCGCCTACCA
hide sequence
RefSeq Acc Id:
XM_039085590 ⟹ XP_038941518
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 80,825,113 - 80,832,048 (+) NCBI mRatBN7.2 10 80,327,921 - 80,335,279 (+) NCBI
RefSeq Acc Id:
XM_039085591 ⟹ XP_038941519
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 80,826,549 - 80,832,048 (+) NCBI mRatBN7.2 10 80,328,182 - 80,335,279 (+) NCBI
RefSeq Acc Id:
NP_954512 ⟸ NM_199081
- UniProtKB:
P70639 (UniProtKB/Swiss-Prot), Q6V7K3 (UniProtKB/Swiss-Prot), A0A8I6ADT8 (UniProtKB/TrEMBL)
- Sequence:
MAASRSLVPDRLRLPLCFLGVFVCYFYYGILQEKITRGKYGEGPKQETFTFALTLVFIQCVINAMFAKILIQFFDTARVDRTRTWLYAACSVSYVGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLG
hide sequence
Ensembl Acc Id:
ENSRNOP00000006179 ⟸ ENSRNOT00000006179
RefSeq Acc Id:
XP_038941518 ⟸ XM_039085590
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038941519 ⟸ XM_039085591
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000090121 ⟸ ENSRNOT00000102666
RGD ID: 13697618 Promoter ID: EPDNEW_R8143 Type: single initiation site Name: Slc35b1_1 Description: solute carrier family 35, member B1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 83,201,254 - 83,201,314 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Slc35b1
solute carrier family 35, member B1
LOC287642
galactose transporter
Symbol and Name updated
1299863 APPROVED
2005-09-30
LOC287642
Symbol and Name status set to provisional
70820 PROVISIONAL
