Symbol:
Gsto1
Name:
glutathione S-transferase omega 1
RGD ID:
70952
Description:
Enables glutathione dehydrogenase (ascorbate) activity. Involved in L-ascorbic acid biosynthetic process. Located in several cellular components, including basement membrane; cell body; and nuclear membrane. Human ortholog(s) of this gene implicated in Alzheimer's disease and Parkinson's disease. Orthologous to human GSTO1 (glutathione S-transferase omega 1); PARTICIPATES IN glutathione conjugation pathway; glutathione metabolic pathway; phase I biotransformation pathway via cytochrome P450; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,5-hexanedione.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
glutathione S-transferase omega 1-1; glutathione S-transferase omega-1; glutathione-dependent dehydroascorbate reductase; GSTO 1-1; GSTO-1; MGC94845; MMA(V) reductase; monomethylarsonic acid reductase; S-(Phenacyl)glutathione reductase; SPG-R
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GSTO1 (glutathione S-transferase omega 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Gsto1 (glutathione S-transferase omega 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GSTO1 (glutathione S-transferase omega 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GSTO1 (glutathione S-transferase omega 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Gsto1 (glutathione S-transferase omega 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GSTO1 (glutathione S-transferase omega 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GSTO1 (glutathione S-transferase omega 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Gsto1 (glutathione S-transferase omega 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
GSTO2 (glutathione S-transferase omega 2) HGNC
OrthoDB
Homo sapiens (human):
NR1D1 (nuclear receptor subfamily 1 group D member 1) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Gsto1 (glutathione S-transferase omega 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
GSTO1 (glutathione S-transferase omega 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gsto1 (glutathione S-transferase omega 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
gsto2 (glutathione S-transferase omega 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
C02D5.4
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
GstO2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
GstO3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
gst-44
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
gsto-1
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
gsto-2
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
gsto-3
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
GstO1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
se
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
gsto1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
gsto2
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
LOC100498493
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 256,662,377 - 256,672,515 (+) NCBI GRCr8 mRatBN7.2 1 246,721,089 - 246,731,228 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 246,721,221 - 246,731,468 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 254,848,516 - 254,858,523 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 261,541,609 - 261,551,494 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 254,191,672 - 254,201,560 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 267,607,437 - 267,617,387 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 267,607,418 - 267,617,387 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 275,040,049 - 275,050,033 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 253,228,547 - 253,238,531 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 253,493,307 - 253,503,274 (+) NCBI Celera 1 242,486,178 - 242,496,113 (+) NCBI Celera Cytogenetic Map 1 q54 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gsto1 Rat (1->4)-beta-D-glucan multiple interactions ISO Gsto1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of GSTO1 mRNA CTD PMID:36331819 Gsto1 Rat 1,2-dimethylhydrazine decreases expression ISO Gsto1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of GSTO1 mRNA CTD PMID:22206623 Gsto1 Rat 1,2-dimethylhydrazine multiple interactions ISO Gsto1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of GSTO1 mRNA CTD PMID:22206623 Gsto1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of GSTO1 mRNA CTD PMID:12075121 and PMID:15576828 Gsto1 Rat 17beta-estradiol affects expression ISO Gsto1 (Mus musculus) 6480464 Estradiol affects the expression of GSTO1 mRNA CTD PMID:15598610 and PMID:39298647 Gsto1 Rat 17beta-estradiol increases expression ISO Gsto1 (Mus musculus) 6480464 Estradiol results in increased expression of GSTO1 mRNA CTD PMID:15289156 Gsto1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Gsto1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of GSTO1 mRNA CTD PMID:21041162 Gsto1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of GSTO1 mRNA CTD PMID:33387578 and PMID:34747641 Gsto1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Gsto1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GSTO1 mRNA CTD PMID:21570461 Gsto1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GSTO1 mRNA CTD PMID:21215274 Gsto1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO Gsto1 (Mus musculus) 6480464 2 more ... CTD PMID:18550172 Gsto1 Rat 2,5-hexanedione decreases expression EXP 6480464 2 and 5-hexanedione results in decreased expression of GSTO1 protein CTD PMID:15928459 Gsto1 Rat 2,6-dimethoxyphenol multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of and affects the localization of GSTO1 protein CTD PMID:38598786 Gsto1 Rat 2-bromohexadecanoic acid multiple interactions ISO GSTO1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of GSTO1 protein] CTD PMID:38195004 Gsto1 Rat 2-hydroxypropanoic acid increases expression ISO GSTO1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of GSTO1 mRNA CTD PMID:30851411 Gsto1 Rat 2-palmitoylglycerol increases expression ISO GSTO1 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of GSTO1 mRNA CTD PMID:37199045 Gsto1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of GSTO1 mRNA CTD PMID:28628672 Gsto1 Rat 4,4'-sulfonyldiphenol increases expression ISO Gsto1 (Mus musculus) 6480464 bisphenol S results in increased expression of GSTO1 mRNA CTD PMID:39298647 Gsto1 Rat 4,4'-sulfonyldiphenol increases expression ISO GSTO1 (Homo sapiens) 6480464 bisphenol S results in increased expression of GSTO1 protein CTD PMID:34186270 Gsto1 Rat 5-aza-2'-deoxycytidine multiple interactions ISO Gsto1 (Mus musculus) 6480464 [Decitabine co-treated with trichostatin A] results in increased expression of GSTO1 mRNA CTD PMID:19444856 Gsto1 Rat 5-aza-2'-deoxycytidine affects expression ISO GSTO1 (Homo sapiens) 6480464 Decitabine affects the expression of GSTO1 mRNA CTD PMID:23300844 Gsto1 Rat 5-aza-2'-deoxycytidine increases expression ISO GSTO1 (Homo sapiens) 6480464 Decitabine results in increased expression of GSTO1 mRNA and Decitabine results in increased expression of GSTO1 protein CTD PMID:24998975 Gsto1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of GSTO1 mRNA CTD PMID:31881176 Gsto1 Rat acetylsalicylic acid decreases expression ISO GSTO1 (Homo sapiens) 6480464 Aspirin results in decreased expression of GSTO1 mRNA CTD PMID:14976132 Gsto1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of GSTO1 mRNA CTD PMID:28959563 Gsto1 Rat aflatoxin B1 decreases methylation ISO GSTO1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of GSTO1 gene CTD PMID:27153756 Gsto1 Rat all-trans-retinoic acid increases expression ISO GSTO1 (Homo sapiens) 6480464 Tretinoin results in increased expression of GSTO1 mRNA CTD PMID:15498508 and PMID:33167477 Gsto1 Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of GSTO1 mRNA and Tretinoin results in decreased expression of GSTO1 protein CTD PMID:30267739 Gsto1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GSTO1 mRNA CTD PMID:16483693 Gsto1 Rat antimonite multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [Antimony Potassium Tartrate results in increased abundance of antimonite] which results in increased expression of GSTO1 mRNA CTD PMID:32076005 Gsto1 Rat antirheumatic drug decreases expression ISO GSTO1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of GSTO1 mRNA CTD PMID:24449571 Gsto1 Rat aristolochic acid A increases expression ISO GSTO1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of GSTO1 protein CTD PMID:33212167 Gsto1 Rat arotinoid acid multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:34480604 Gsto1 Rat arsane multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [Arsenic Trioxide results in increased abundance of Arsenic] which results in increased expression of GSTO1 mRNA more ... CTD PMID:14680363 more ... Gsto1 Rat arsane affects response to substance ISO GSTO1 (Homo sapiens) 6480464 GSTO1 gene polymorphism affects the susceptibility to Arsenic CTD PMID:28436716 Gsto1 Rat arsane increases response to substance ISO GSTO1 (Homo sapiens) 6480464 GSTO1 gene SNP results in increased susceptibility to Arsenic CTD PMID:29323258 Gsto1 Rat arsane increases metabolic processing ISO GSTO1 (Homo sapiens) 6480464 GSTO1 protein results in increased metabolism of Arsenic CTD PMID:16638819 and PMID:18414634 Gsto1 Rat arsane decreases metabolic processing ISO GSTO1 (Homo sapiens) 6480464 GSTO1 protein polymorphism results in decreased metabolism of Arsenic CTD PMID:15901998 Gsto1 Rat arsane affects metabolic processing ISO GSTO1 (Homo sapiens) 6480464 GSTO1 gene SNP affects the metabolism of Arsenic CTD PMID:21094982 and PMID:27327299 Gsto1 Rat arsane affects abundance ISO GSTO1 (Homo sapiens) 6480464 GSTO1 gene polymorphism affects the abundance of Arsenic metabolite CTD PMID:24239724 Gsto1 Rat arsenic acid increases reduction ISO GSTO1 (Homo sapiens) 6480464 GSTO1 protein results in increased reduction of arsenic acid CTD PMID:16930657 Gsto1 Rat arsenic atom multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [Arsenic Trioxide results in increased abundance of Arsenic] which results in increased expression of GSTO1 mRNA more ... CTD PMID:14680363 more ... Gsto1 Rat arsenic atom affects response to substance ISO GSTO1 (Homo sapiens) 6480464 GSTO1 gene polymorphism affects the susceptibility to Arsenic CTD PMID:28436716 Gsto1 Rat arsenic atom increases response to substance ISO GSTO1 (Homo sapiens) 6480464 GSTO1 gene SNP results in increased susceptibility to Arsenic CTD PMID:29323258 Gsto1 Rat arsenic atom decreases metabolic processing ISO GSTO1 (Homo sapiens) 6480464 GSTO1 protein polymorphism results in decreased metabolism of Arsenic CTD PMID:15901998 Gsto1 Rat arsenic atom increases metabolic processing ISO GSTO1 (Homo sapiens) 6480464 GSTO1 protein results in increased metabolism of Arsenic CTD PMID:16638819 and PMID:18414634 Gsto1 Rat arsenic atom affects metabolic processing ISO GSTO1 (Homo sapiens) 6480464 GSTO1 gene SNP affects the metabolism of Arsenic CTD PMID:21094982 and PMID:27327299 Gsto1 Rat arsenic atom affects abundance ISO GSTO1 (Homo sapiens) 6480464 GSTO1 gene polymorphism affects the abundance of Arsenic metabolite CTD PMID:24239724 Gsto1 Rat arsenite(3-) increases expression ISO Gsto1 (Mus musculus) 6480464 arsenite results in increased expression of GSTO1 mRNA CTD PMID:18929588 Gsto1 Rat arsenite(3-) multiple interactions ISO GSTO1 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to GSTO1 mRNA] CTD PMID:32406909 Gsto1 Rat arsenite(3-) increases chemical synthesis ISO GSTO1 (Homo sapiens) 6480464 GSTO1 protein results in increased chemical synthesis of arsenite CTD PMID:16930657 Gsto1 Rat arsenous acid multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [Arsenic Trioxide results in increased abundance of Arsenic] which results in increased expression of GSTO1 mRNA CTD PMID:33434570 Gsto1 Rat arsenous acid increases expression ISO Gsto1 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of GSTO1 mRNA CTD PMID:35676786 Gsto1 Rat atrazine increases expression EXP 6480464 Atrazine results in increased expression of GSTO1 mRNA CTD PMID:28882082 Gsto1 Rat Azoxymethane multiple interactions ISO Gsto1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of GSTO1 mRNA CTD PMID:29950665 Gsto1 Rat benzo[a]pyrene decreases expression ISO GSTO1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of GSTO1 mRNA and Benzo(a)pyrene results in decreased expression of GSTO1 protein CTD PMID:22138271 and PMID:32234424 Gsto1 Rat benzo[a]pyrene increases expression ISO Gsto1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of GSTO1 mRNA CTD PMID:20127859 and PMID:23735875 Gsto1 Rat benzo[a]pyrene decreases expression ISO Gsto1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of GSTO1 mRNA CTD PMID:22228805 Gsto1 Rat benzo[a]pyrene multiple interactions ISO GSTO1 (Homo sapiens) 6480464 Methionine inhibits the reaction [Benzo(a)pyrene results in decreased expression of GSTO1 protein] CTD PMID:22138271 Gsto1 Rat benzoates decreases expression ISO GSTO1 (Homo sapiens) 6480464 Benzoates analog results in decreased expression of GSTO1 mRNA CTD PMID:29472718 Gsto1 Rat bis(2-ethylhexyl) phthalate increases expression ISO GSTO1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of GSTO1 mRNA CTD PMID:31163220 Gsto1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Gsto1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of GSTO1 mRNA CTD PMID:35550907 Gsto1 Rat bisphenol A increases expression ISO GSTO1 (Homo sapiens) 6480464 bisphenol A results in increased expression of GSTO1 mRNA and bisphenol A results in increased expression of GSTO1 protein CTD PMID:25047013 and PMID:37567409 Gsto1 Rat bisphenol A decreases expression ISO Gsto1 (Mus musculus) 6480464 bisphenol A results in decreased expression of GSTO1 mRNA CTD PMID:37105096 Gsto1 Rat bisphenol A increases expression ISO Gsto1 (Mus musculus) 6480464 bisphenol A results in increased expression of GSTO1 mRNA and bisphenol A results in increased expression of GSTO1 protein CTD PMID:34585602 and PMID:35999755 Gsto1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of GSTO1 mRNA CTD PMID:30903817 Gsto1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of GSTO1 mRNA CTD PMID:31129395 Gsto1 Rat bisphenol A multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of GSTO1 gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of GSTO1 mRNA CTD PMID:28628672 and PMID:31601247 Gsto1 Rat bisphenol A decreases expression ISO GSTO1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of GSTO1 mRNA and bisphenol A results in decreased expression of GSTO1 protein CTD PMID:29275510 and PMID:34186270 Gsto1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GSTO1 mRNA and bisphenol A results in increased expression of GSTO1 protein CTD PMID:12075121 more ... Gsto1 Rat bisphenol AF increases expression ISO GSTO1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of GSTO1 protein CTD PMID:34186270 Gsto1 Rat Bisphenol B increases expression ISO GSTO1 (Homo sapiens) 6480464 bisphenol B results in increased expression of GSTO1 protein CTD PMID:34186270 Gsto1 Rat butylated hydroxyanisole increases expression ISO Gsto1 (Mus musculus) 6480464 Butylated Hydroxyanisole results in increased expression of GSTO1 mRNA CTD PMID:18723825 Gsto1 Rat cadmium atom increases expression ISO GSTO1 (Homo sapiens) 6480464 Cadmium results in increased expression of GSTO1 mRNA CTD PMID:23369406 Gsto1 Rat cadmium atom multiple interactions ISO GSTO1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of GSTO1 protein] more ... CTD PMID:33040242 more ... Gsto1 Rat cadmium dichloride multiple interactions ISO Gsto1 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Cadmium Chloride] results in increased expression of GSTO1 mRNA CTD PMID:19840844 Gsto1 Rat cadmium dichloride increases expression ISO GSTO1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of GSTO1 mRNA CTD PMID:38568856 Gsto1 Rat cadmium dichloride multiple interactions ISO GSTO1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of GSTO1 protein] more ... CTD PMID:33040242 more ... Gsto1 Rat cadmium sulfate multiple interactions ISO Gsto1 (Mus musculus) 6480464 cadmium sulfate affects the reaction [MTF1 affects the expression of GSTO1 mRNA] CTD PMID:16221973 Gsto1 Rat caffeine decreases expression ISO GSTO1 (Homo sapiens) 6480464 Caffeine results in decreased expression of GSTO1 mRNA CTD PMID:11793227 Gsto1 Rat carbon nanotube decreases expression ISO Gsto1 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of GSTO1 mRNA CTD PMID:25620056 Gsto1 Rat carbon nanotube multiple interactions ISO Gsto1 (Mus musculus) 6480464 [Dibutyl Phthalate co-treated with Nanotubes and Carbon] results in decreased expression of GSTO1 protein CTD PMID:34864091 Gsto1 Rat CHIR 99021 multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:34480604 Gsto1 Rat chlordecone decreases expression ISO Gsto1 (Mus musculus) 6480464 Chlordecone results in decreased expression of GSTO1 mRNA CTD PMID:33711761 Gsto1 Rat chloropicrin increases expression ISO GSTO1 (Homo sapiens) 6480464 chloropicrin results in increased expression of GSTO1 mRNA CTD PMID:26352163 Gsto1 Rat chloroprene increases expression ISO Gsto1 (Mus musculus) 6480464 Chloroprene results in increased expression of GSTO1 mRNA CTD PMID:23125180 Gsto1 Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of GSTO1 mRNA CTD PMID:19440498 Gsto1 Rat cisplatin affects response to substance ISO GSTO1 (Homo sapiens) 6480464 GSTO1 protein affects the susceptibility to Cisplatin CTD PMID:16217747 Gsto1 Rat cisplatin multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of GSTO1 mRNA CTD PMID:27392435 Gsto1 Rat cisplatin increases expression ISO GSTO1 (Homo sapiens) 6480464 Cisplatin results in increased expression of GSTO1 mRNA CTD PMID:27392435 Gsto1 Rat cisplatin affects expression ISO GSTO1 (Homo sapiens) 6480464 Cisplatin affects the expression of GSTO1 mRNA CTD PMID:23300844 Gsto1 Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of GSTO1 mRNA CTD PMID:17602206 Gsto1 Rat cocaine affects expression ISO GSTO1 (Homo sapiens) 6480464 Cocaine affects the expression of GSTO1 protein CTD PMID:19393250 Gsto1 Rat copper(II) sulfate decreases expression ISO GSTO1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of GSTO1 mRNA CTD PMID:19549813 Gsto1 Rat cortisol multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:34480604 Gsto1 Rat curcumin multiple interactions ISO Gsto1 (Mus musculus) 6480464 Curcumin promotes the reaction [sodium arsenite results in increased expression of GSTO1 mRNA] CTD PMID:34272803 Gsto1 Rat curcumin increases expression ISO Gsto1 (Mus musculus) 6480464 Curcumin results in increased expression of GSTO1 mRNA CTD PMID:34272803 Gsto1 Rat cyclosporin A decreases expression ISO GSTO1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of GSTO1 mRNA CTD PMID:20106945 Gsto1 Rat DDE increases expression ISO GSTO1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of GSTO1 mRNA CTD PMID:38568856 Gsto1 Rat DDT increases expression ISO GSTO1 (Homo sapiens) 6480464 DDT results in increased expression of GSTO1 mRNA CTD PMID:31521043 Gsto1 Rat dexamethasone multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of GSTO1 mRNA CTD PMID:28628672 Gsto1 Rat dextran sulfate multiple interactions ISO Gsto1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of GSTO1 mRNA CTD PMID:29950665 Gsto1 Rat diarsenic trioxide multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [Arsenic Trioxide results in increased abundance of Arsenic] which results in increased expression of GSTO1 mRNA CTD PMID:33434570 Gsto1 Rat diarsenic trioxide increases expression ISO Gsto1 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of GSTO1 mRNA CTD PMID:35676786 Gsto1 Rat diazinon increases expression EXP 6480464 Diazinon results in increased expression of GSTO1 mRNA CTD PMID:19440498 Gsto1 Rat Dibutyl phosphate affects expression ISO GSTO1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of GSTO1 mRNA CTD PMID:37042841 Gsto1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of GSTO1 mRNA CTD PMID:21266533 Gsto1 Rat dibutyl phthalate decreases expression ISO Gsto1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of GSTO1 protein CTD PMID:34864091 Gsto1 Rat dibutyl phthalate multiple interactions ISO Gsto1 (Mus musculus) 6480464 [Dibutyl Phthalate co-treated with Nanotubes and Carbon] results in decreased expression of GSTO1 protein CTD PMID:34864091 Gsto1 Rat dieldrin increases expression EXP 6480464 Dieldrin results in increased expression of GSTO1 mRNA CTD PMID:19440498 Gsto1 Rat diethyl maleate increases expression ISO Gsto1 (Mus musculus) 6480464 diethyl maleate results in increased expression of GSTO1 mRNA CTD PMID:25270620 Gsto1 Rat diethylstilbestrol decreases expression ISO Gsto1 (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of GSTO1 mRNA CTD PMID:17394237 Gsto1 Rat diethylstilbestrol increases expression ISO Gsto1 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of GSTO1 mRNA CTD PMID:15289156 Gsto1 Rat dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [Antimony Potassium Tartrate results in increased abundance of antimonite] which results in increased expression of GSTO1 mRNA CTD PMID:32076005 Gsto1 Rat disodium selenite decreases expression ISO GSTO1 (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of GSTO1 mRNA CTD PMID:16705456 Gsto1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of GSTO1 mRNA CTD PMID:21551480 Gsto1 Rat dorsomorphin multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GSTO1 mRNA CTD PMID:27188386 Gsto1 Rat doxorubicin affects expression ISO GSTO1 (Homo sapiens) 6480464 Doxorubicin affects the expression of GSTO1 mRNA CTD PMID:25529476 Gsto1 Rat enzyme inhibitor multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of GSTO1 protein CTD PMID:23301498 Gsto1 Rat ethanol increases expression ISO Gsto1 (Mus musculus) 6480464 Ethanol results in increased expression of GSTO1 mRNA CTD PMID:30319688 Gsto1 Rat fenvalerate decreases expression EXP 6480464 fenvalerate results in decreased expression of GSTO1 protein CTD PMID:33656234 Gsto1 Rat flurbiprofen increases expression ISO Gsto1 (Mus musculus) 6480464 Flurbiprofen results in increased expression of GSTO1 mRNA CTD PMID:16949054 Gsto1 Rat folic acid multiple interactions ISO Gsto1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of GSTO1 mRNA CTD PMID:22206623 Gsto1 Rat fulvestrant multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of GSTO1 gene CTD PMID:31601247 Gsto1 Rat gamma-tocopherol decreases activity ISO GSTO1 (Homo sapiens) 6480464 Tocopherols results in decreased activity of GSTO1 protein CTD PMID:16781109 Gsto1 Rat genistein increases expression ISO Gsto1 (Mus musculus) 6480464 Genistein results in increased expression of GSTO1 mRNA CTD PMID:15289156 Gsto1 Rat genistein increases expression EXP 6480464 Genistein results in increased expression of GSTO1 mRNA CTD PMID:12075121 Gsto1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of GSTO1 mRNA CTD PMID:22061828 and PMID:33387578 Gsto1 Rat hemin increases expression ISO GSTO1 (Homo sapiens) 6480464 Hemin results in increased expression of GSTO1 mRNA CTD PMID:33434570 Gsto1 Rat hemin multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [benzyloxycarbonylleucyl-leucyl-leucine aldehyde co-treated with Hemin] results in increased expression of GSTO1 mRNA CTD PMID:33434570 Gsto1 Rat indometacin multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of GSTO1 mRNA CTD PMID:28628672 Gsto1 Rat inulin multiple interactions ISO Gsto1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of GSTO1 mRNA CTD PMID:36331819 Gsto1 Rat isoprenaline decreases expression ISO Gsto1 (Mus musculus) 6480464 Isoproterenol results in decreased expression of GSTO1 mRNA CTD PMID:21335049 Gsto1 Rat ivermectin decreases expression ISO GSTO1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of GSTO1 protein CTD PMID:32959892 Gsto1 Rat L-ascorbic acid multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [[Ascorbic Acid co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein co-treated with FGF1 protein co-treated with WNT3A protein co-treated with HGF protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of GSTO1 mRNA and Ascorbic Acid inhibits the reaction [[lead acetate results in increased abundance of Lead] which results in decreased expression of GSTO1 mRNA] CTD PMID:31610155 and PMID:34480604 Gsto1 Rat L-ascorbic acid increases expression ISO GSTO1 (Homo sapiens) 6480464 Ascorbic Acid results in increased expression of GSTO1 mRNA CTD PMID:31610155 Gsto1 Rat L-ascorbic acid 2-phosphate multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of GSTO1 mRNA CTD PMID:34480604 Gsto1 Rat L-methionine multiple interactions ISO GSTO1 (Homo sapiens) 6480464 Methionine inhibits the reaction [Benzo(a)pyrene results in decreased expression of GSTO1 protein] CTD PMID:22138271 Gsto1 Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of GSTO1 mRNA CTD PMID:11578147 Gsto1 Rat lead diacetate multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [lead acetate results in increased abundance of Lead] which results in decreased expression of GSTO1 mRNA more ... CTD PMID:31610155 Gsto1 Rat lead(0) multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [lead acetate results in increased abundance of Lead] which results in decreased expression of GSTO1 mRNA more ... CTD PMID:31610155 Gsto1 Rat manganese atom multiple interactions EXP 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of GSTO1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of GSTO1 protein CTD PMID:38129942 Gsto1 Rat manganese(0) multiple interactions EXP 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of GSTO1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of GSTO1 protein CTD PMID:38129942 Gsto1 Rat manganese(II) chloride multiple interactions EXP 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of GSTO1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of GSTO1 protein CTD PMID:38129942 Gsto1 Rat menadione affects expression ISO GSTO1 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of GSTO1 mRNA CTD PMID:20044591 Gsto1 Rat Mesaconitine decreases expression EXP 6480464 mesaconitine results in decreased expression of GSTO1 protein CTD PMID:37182599 Gsto1 Rat methylarsonic acid multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [GSTO1 protein results in increased metabolism of monomethylarsonic acid] which results in increased chemical synthesis of monomethylarsonous acid CTD PMID:12928150 Gsto1 Rat methylarsonic acid increases reduction ISO GSTO1 (Homo sapiens) 6480464 GSTO1 protein results in increased reduction of monomethylarsonic acid CTD PMID:15929903 Gsto1 Rat methylmercury chloride increases expression ISO Gsto1 (Mus musculus) 6480464 methylmercuric chloride results in increased expression of GSTO1 mRNA CTD PMID:20061341 Gsto1 Rat microcystin decreases expression EXP 6480464 Microcystins results in decreased expression of GSTO1 mRNA CTD PMID:19790251 Gsto1 Rat microcystin affects expression EXP 6480464 Microcystins affects the expression of GSTO1 mRNA CTD PMID:19790251 Gsto1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [benzyloxycarbonylleucyl-leucyl-leucine aldehyde co-treated with Hemin] results in increased expression of GSTO1 mRNA CTD PMID:33434570 Gsto1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO GSTO1 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of GSTO1 mRNA CTD PMID:33434570 Gsto1 Rat N-butyl-N-(4-hydroxybutyl)nitrosamine increases expression ISO Gsto1 (Mus musculus) 6480464 Butylhydroxybutylnitrosamine results in increased expression of GSTO1 protein CTD PMID:24998975 Gsto1 Rat N-methyl-N'-nitro-N-nitrosoguanidine multiple interactions ISO Gsto1 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Cadmium Chloride] results in increased expression of GSTO1 mRNA more ... CTD PMID:19840844 Gsto1 Rat nickel atom decreases expression EXP 6480464 Nickel results in decreased expression of GSTO1 mRNA CTD PMID:19440498 Gsto1 Rat ochratoxin A decreases expression ISO GSTO1 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of GSTO1 mRNA and ochratoxin A results in decreased expression of GSTO1 protein CTD PMID:19287073 Gsto1 Rat okadaic acid multiple interactions ISO Gsto1 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Okadaic Acid] results in increased expression of GSTO1 mRNA CTD PMID:19840844 Gsto1 Rat ozone multiple interactions ISO Gsto1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of GSTO1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of GSTO1 mRNA CTD PMID:34911549 Gsto1 Rat p-menthan-3-ol increases expression ISO GSTO1 (Homo sapiens) 6480464 Menthol results in increased expression of GSTO1 mRNA CTD PMID:26760959 Gsto1 Rat paracetamol decreases expression ISO GSTO1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of GSTO1 mRNA CTD PMID:11793227 more ... Gsto1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of GSTO1 mRNA CTD PMID:33387578 Gsto1 Rat paraquat increases expression ISO Gsto1 (Mus musculus) 6480464 Paraquat results in increased expression of GSTO1 mRNA CTD PMID:16128001 Gsto1 Rat paraquat increases expression ISO GSTO1 (Homo sapiens) 6480464 Paraquat results in increased expression of GSTO1 protein CTD PMID:34064677 Gsto1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Gsto1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of GSTO1 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of GSTO1 mRNA CTD PMID:36331819 Gsto1 Rat phenytoin decreases expression ISO GSTO1 (Homo sapiens) 6480464 Phenytoin results in decreased expression of GSTO1 mRNA CTD PMID:14741686 Gsto1 Rat PhIP decreases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in decreased expression of GSTO1 mRNA CTD PMID:33945839 Gsto1 Rat phorbol 13-acetate 12-myristate multiple interactions ISO Gsto1 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Tetradecanoylphorbol Acetate] results in increased expression of GSTO1 mRNA CTD PMID:19840844 Gsto1 Rat progesterone increases expression ISO Gsto1 (Mus musculus) 6480464 Progesterone results in increased expression of GSTO1 mRNA CTD PMID:22238285 Gsto1 Rat rac-lactic acid increases expression ISO GSTO1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of GSTO1 mRNA CTD PMID:30851411 Gsto1 Rat resveratrol increases expression ISO Gsto1 (Mus musculus) 6480464 resveratrol results in increased expression of GSTO1 mRNA and resveratrol results in increased expression of GSTO1 protein CTD PMID:22610192 and PMID:25505154 Gsto1 Rat rosmarinic acid multiple interactions ISO GSTO1 (Homo sapiens) 6480464 Rosmarinic Acid inhibits the reaction [[lead acetate results in increased abundance of Lead] which results in decreased expression of GSTO1 mRNA] CTD PMID:31610155 Gsto1 Rat rosmarinic acid increases expression ISO GSTO1 (Homo sapiens) 6480464 Rosmarinic Acid results in increased expression of GSTO1 mRNA CTD PMID:31610155 Gsto1 Rat rotenone increases expression ISO Gsto1 (Mus musculus) 6480464 Rotenone results in increased expression of GSTO1 mRNA CTD PMID:17657281 Gsto1 Rat SB 431542 multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 more ... Gsto1 Rat sodium arsenate multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of GSTO1 mRNA CTD PMID:33434570 Gsto1 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of GSTO1 mRNA and sodium arsenite results in decreased expression of GSTO1 protein CTD PMID:32736004 Gsto1 Rat sodium arsenite affects expression ISO GSTO1 (Homo sapiens) 6480464 sodium arsenite affects the expression of GSTO1 mRNA CTD PMID:34032870 Gsto1 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of GSTO1 protein CTD PMID:29459688 Gsto1 Rat sodium arsenite multiple interactions ISO Gsto1 (Mus musculus) 6480464 Curcumin promotes the reaction [sodium arsenite results in increased expression of GSTO1 mRNA] and NFE2L1 protein alternative form inhibits the reaction [sodium arsenite results in increased expression of GSTO1 mRNA] CTD PMID:28549828 and PMID:34272803 Gsto1 Rat sodium arsenite increases expression ISO Gsto1 (Mus musculus) 6480464 sodium arsenite results in increased expression of GSTO1 mRNA CTD PMID:26473898 more ... Gsto1 Rat sodium arsenite increases expression ISO GSTO1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of GSTO1 mRNA and sodium arsenite results in increased expression of GSTO1 protein CTD PMID:15725613 more ... Gsto1 Rat sodium arsenite decreases expression ISO GSTO1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of GSTO1 mRNA CTD PMID:12634122 and PMID:37956786 Gsto1 Rat sodium arsenite decreases expression ISO Gsto1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of GSTO1 mRNA CTD PMID:17450228 Gsto1 Rat sodium arsenite multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GSTO1 mRNA CTD PMID:33434570 Gsto1 Rat sodium chloride multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of and affects the localization of GSTO1 protein CTD PMID:38598786 Gsto1 Rat sulforaphane increases expression ISO Gsto1 (Mus musculus) 6480464 sulforaphane results in increased expression of GSTO1 mRNA CTD PMID:30529165 Gsto1 Rat sunitinib decreases expression ISO GSTO1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of GSTO1 mRNA CTD PMID:31533062 Gsto1 Rat tamibarotene increases expression ISO GSTO1 (Homo sapiens) 6480464 tamibarotene results in increased expression of GSTO1 mRNA CTD PMID:15498508 Gsto1 Rat temozolomide decreases expression ISO GSTO1 (Homo sapiens) 6480464 Temozolomide results in decreased expression of GSTO1 mRNA CTD PMID:31758290 Gsto1 Rat tetrachloroethene increases expression ISO Gsto1 (Mus musculus) 6480464 Tetrachloroethylene results in increased expression of GSTO1 mRNA CTD PMID:28973375 Gsto1 Rat thioacetamide decreases expression ISO GSTO1 (Homo sapiens) 6480464 Thioacetamide results in decreased expression of GSTO1 mRNA CTD PMID:11793227 Gsto1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of GSTO1 mRNA CTD PMID:34492290 Gsto1 Rat titanium dioxide decreases expression ISO Gsto1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of GSTO1 mRNA CTD PMID:23557971 Gsto1 Rat titanium dioxide decreases methylation ISO Gsto1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of GSTO1 promoter CTD PMID:35295148 Gsto1 Rat titanium dioxide multiple interactions ISO Gsto1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of GSTO1 mRNA CTD PMID:29950665 Gsto1 Rat tocopherol decreases activity ISO GSTO1 (Homo sapiens) 6480464 Tocopherols results in decreased activity of GSTO1 protein CTD PMID:16781109 Gsto1 Rat tributylstannane multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of GSTO1 mRNA CTD PMID:31129395 Gsto1 Rat trichloroethene multiple interactions ISO Gsto1 (Mus musculus) 6480464 PPARA protein inhibits the reaction [Trichloroethylene results in decreased expression of GSTO1 mRNA] CTD PMID:15363585 Gsto1 Rat trichloroethene increases expression ISO GSTO1 (Homo sapiens) 6480464 Trichloroethylene results in increased expression of GSTO1 mRNA and Trichloroethylene results in increased expression of GSTO1 protein CTD PMID:19109764 and PMID:21351650 Gsto1 Rat trichostatin A multiple interactions ISO Gsto1 (Mus musculus) 6480464 [decitabine co-treated with trichostatin A] results in increased expression of GSTO1 mRNA CTD PMID:19444856 Gsto1 Rat trichostatin A multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GSTO1 mRNA CTD PMID:27188386 Gsto1 Rat trichostatin A increases expression ISO GSTO1 (Homo sapiens) 6480464 trichostatin A results in increased expression of GSTO1 mRNA CTD PMID:24935251 and PMID:26272509 Gsto1 Rat triclosan decreases expression ISO GSTO1 (Homo sapiens) 6480464 Triclosan results in decreased expression of GSTO1 mRNA CTD PMID:30510588 Gsto1 Rat tris(2-butoxyethyl) phosphate affects expression ISO GSTO1 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of GSTO1 mRNA CTD PMID:29024780 Gsto1 Rat urethane decreases expression ISO GSTO1 (Homo sapiens) 6480464 Urethane results in decreased expression of GSTO1 mRNA CTD PMID:28818685 Gsto1 Rat valproic acid increases expression ISO GSTO1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of GSTO1 mRNA CTD PMID:23527032 Gsto1 Rat valproic acid affects expression ISO GSTO1 (Homo sapiens) 6480464 Valproic Acid affects the expression of GSTO1 mRNA CTD PMID:25979313 Gsto1 Rat valproic acid decreases expression ISO GSTO1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of GSTO1 mRNA CTD PMID:23179753 and PMID:27188386 Gsto1 Rat XAV939 multiple interactions ISO GSTO1 (Homo sapiens) 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of GSTO1 mRNA and [[Ascorbic Acid co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein co-treated with FGF1 protein co-treated with WNT3A protein co-treated with HGF protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of GSTO1 mRNA CTD PMID:34480604
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,5-hexanedione (EXP) 2,6-dimethoxyphenol (ISO) 2-bromohexadecanoic acid (ISO) 2-hydroxypropanoic acid (ISO) 2-palmitoylglycerol (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) acetamide (EXP) acetylsalicylic acid (ISO) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP,ISO) ammonium chloride (EXP) antimonite (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arotinoid acid (ISO) arsane (ISO) arsenic acid (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (EXP) Azoxymethane (ISO) benzo[a]pyrene (ISO) benzoates (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) butylated hydroxyanisole (ISO) cadmium atom (ISO) cadmium dichloride (ISO) cadmium sulfate (ISO) caffeine (ISO) carbon nanotube (ISO) CHIR 99021 (ISO) chlordecone (ISO) chloropicrin (ISO) chloroprene (ISO) chlorpyrifos (EXP) cisplatin (ISO) clofibric acid (EXP) cocaine (ISO) copper(II) sulfate (ISO) cortisol (ISO) curcumin (ISO) cyclosporin A (ISO) DDE (ISO) DDT (ISO) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) diazinon (EXP) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dieldrin (EXP) diethyl maleate (ISO) diethylstilbestrol (ISO) dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO) disodium selenite (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) ethanol (ISO) fenvalerate (EXP) flurbiprofen (ISO) folic acid (ISO) fulvestrant (ISO) gamma-tocopherol (ISO) genistein (EXP,ISO) gentamycin (EXP) hemin (ISO) indometacin (ISO) inulin (ISO) isoprenaline (ISO) ivermectin (ISO) L-ascorbic acid (ISO) L-ascorbic acid 2-phosphate (ISO) L-methionine (ISO) lead diacetate (EXP,ISO) lead(0) (ISO) manganese atom (EXP) manganese(0) (EXP) manganese(II) chloride (EXP) menadione (ISO) Mesaconitine (EXP) methylarsonic acid (ISO) methylmercury chloride (ISO) microcystin (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-butyl-N-(4-hydroxybutyl)nitrosamine (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) nickel atom (EXP) ochratoxin A (ISO) okadaic acid (ISO) ozone (ISO) p-menthan-3-ol (ISO) paracetamol (EXP,ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (ISO) phenytoin (ISO) PhIP (EXP) phorbol 13-acetate 12-myristate (ISO) progesterone (ISO) rac-lactic acid (ISO) resveratrol (ISO) rosmarinic acid (ISO) rotenone (ISO) SB 431542 (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) sulforaphane (ISO) sunitinib (ISO) tamibarotene (ISO) temozolomide (ISO) tetrachloroethene (ISO) thioacetamide (EXP,ISO) titanium dioxide (ISO) tocopherol (ISO) tributylstannane (EXP) trichloroethene (ISO) trichostatin A (ISO) triclosan (ISO) tris(2-butoxyethyl) phosphate (ISO) urethane (ISO) valproic acid (ISO) XAV939 (ISO)
Biological Process
cellular oxidant detoxification (IEA) cellular response to arsenic-containing substance (IEA,ISO,ISS) glutathione metabolic process (IBA,IEA) L-ascorbic acid biosynthetic process (IMP) L-ascorbic acid metabolic process (IBA,IEA,ISO,ISS) negative regulation of release of sequestered calcium ion into cytosol (IEA,ISO) positive regulation of release of sequestered calcium ion into cytosol (IEA,ISO) positive regulation of skeletal muscle contraction by regulation of release of sequestered calcium ion (IEA,ISO) regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion (IEA,ISO) regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum (IEA,ISO) xenobiotic catabolic process (IEA,ISO,ISS)
1.
Toward protein biomarkers for allergy: CD4+ T cell proteomics in allergic and nonallergic subjects sampled in and out of pollen season.
Bluggel M, etal., J Proteome Res. 2011 Apr 1;10(4):1558-70. Epub 2011 Mar 16.
2.
Polymorphisms in glutathione S-transferase omega-1 gene and increased risk of sporadic Alzheimer disease.
Capurso C, etal., Rejuvenation Res. 2010 Dec;13(6):645-52. Epub 2010 Sep 6.
3.
Subcellular localization of a glutathione-dependent dehydroascorbate reductase within specific rat brain regions.
Fornai F, etal., Neuroscience. 2001;104(1):15-31.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Combined genealogical, mapping, and expression approaches to identify spontaneously hypertensive rat hypertension candidate genes.
Hinojos CA, etal., Hypertension 2005 Apr;45(4):698-704. Epub 2005 Feb 14.
7.
Molecular cloning and functional expression of rat liver glutathione-dependent dehydroascorbate reductase.
Ishikawa T, etal., J Biol Chem 1998 Oct 30;273(44):28708-12.
8.
Glutathione S-transferase omega-1 modifies age-at-onset of Alzheimer disease and Parkinson disease.
Li YJ, etal., Hum Mol Genet 2003 Dec 15;12(24):3259-67. Epub 2003 Oct 21.
9.
Purification and characterization of glutathione-dependent dehydroascorbate reductase from rat liver.
Maellaro E, etal., Biochem J 1994 Jul 15;301 ( Pt 2):471-6.
10.
Gene Data Set
MGD Curation, June 12, 2002
11.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
12.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.
Three SNPs in the GSTO1, GSTO2 and PRSS11 genes on chromosome 10 are not associated with age-at-onset of Alzheimer's disease.
Ozturk A, etal., Neurobiol Aging. 2005 Aug-Sep;26(8):1161-5. Epub 2004 Dec 18.
14.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
15.
GOA pipeline
RGD automated data pipeline
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Glutathione S-transferase: genetics and role in toxicology.
Strange RC, etal., Toxicol Lett 2000 Mar 15;112-113:357-63.
18.
Glutathione S-transferase mu, omega, pi, and theta class variants and smoking in Parkinson's disease.
Wahner AD, etal., Neurosci Lett. 2007 Feb 21;413(3):274-8. Epub 2006 Dec 27.
Gsto1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 256,662,377 - 256,672,515 (+) NCBI GRCr8 mRatBN7.2 1 246,721,089 - 246,731,228 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 246,721,221 - 246,731,468 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 254,848,516 - 254,858,523 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 261,541,609 - 261,551,494 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 254,191,672 - 254,201,560 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 267,607,437 - 267,617,387 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 267,607,418 - 267,617,387 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 275,040,049 - 275,050,033 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 253,228,547 - 253,238,531 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 253,493,307 - 253,503,274 (+) NCBI Celera 1 242,486,178 - 242,496,113 (+) NCBI Celera Cytogenetic Map 1 q54 NCBI
GSTO1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 104,254,173 - 104,267,455 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 104,235,356 - 104,267,459 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 106,013,931 - 106,027,213 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 106,004,668 - 106,017,203 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 106,004,667 - 106,017,199 NCBI Celera 10 99,754,787 - 99,768,056 (+) NCBI Celera Cytogenetic Map 10 q25.1 NCBI HuRef 10 99,645,735 - 99,659,002 (+) NCBI HuRef CHM1_1 10 106,297,838 - 106,311,108 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 105,142,310 - 105,155,591 (+) NCBI T2T-CHM13v2.0
Gsto1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 47,843,412 - 47,853,229 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 47,843,409 - 47,853,229 (+) Ensembl GRCm39 Ensembl GRCm38 19 47,854,973 - 47,864,790 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 47,854,970 - 47,864,790 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 47,929,479 - 47,939,280 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 47,908,300 - 47,918,101 (+) NCBI MGSCv36 mm8 Celera 19 48,615,471 - 48,625,281 (+) NCBI Celera Cytogenetic Map 19 D1 NCBI cM Map 19 40.41 NCBI
GSTO1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 116,140,609 - 116,153,570 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 116,145,764 - 116,158,902 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 100,853,682 - 100,866,892 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 104,312,403 - 104,325,733 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 104,313,024 - 104,325,733 (+) Ensembl panpan1.1 panPan2
GSTO1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 16,569,421 - 16,579,239 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 16,569,066 - 16,619,880 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 16,741,837 - 16,751,645 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 17,047,667 - 17,057,466 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 17,047,318 - 17,057,465 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 16,595,211 - 16,605,015 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 16,623,890 - 16,633,711 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 16,762,582 - 16,772,417 (+) NCBI UU_Cfam_GSD_1.0
Gsto1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 30,328,927 - 30,339,488 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936600 1,930,695 - 1,943,422 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936600 1,932,152 - 1,943,342 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GSTO1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 115,206,188 - 115,216,613 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 115,206,434 - 115,216,624 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 125,175,630 - 125,185,821 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GSTO1
Gsto1
.
Predicted Target Of
Count of predictions: 35 Count of miRNA genes: 33 Interacting mature miRNAs: 35 Transcripts: ENSRNOT00000016851 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 1549910 Bw54 Body weight QTL 54 0.05 body mass (VT:0001259) body weight (CMO:0000012) 1 214647894 259647894 Rat 1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 70211 Niddm24 Non-insulin dependent diabetes mellitus QTL 24 3.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 214647894 259647894 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 724552 Glom2 Glomerulus QTL 2 3.3 0.0001 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 1 222363780 260522016 Rat 631690 Scl5 Serum cholesterol level QTL 5 2.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 236125214 260522016 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 10053715 Scort24 Serum corticosterone level QTL 24 2.13 0.0088 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 221414816 260522016 Rat 61327 Eae7 Experimental allergic encephalomyelitis QTL 7 5.6 body mass (VT:0001259) change in body weight (CMO:0002045) 1 216255568 260522016 Rat 1600392 Bw123 Body weight QTL 123 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 223201027 260522016 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 631837 Niddm35 Non-insulin dependent diabetes mellitus QTL 35 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 238699859 259647894 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 631836 Stl31 Serum triglyceride level QTL 31 4.64 5e-06 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 237147813 260522016 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 1300108 Rf8 Renal function QTL 8 3.75 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 1 228581588 259647894 Rat 734767 Niddm57 Non-insulin dependent diabetes mellitus QTL 57 body mass (VT:0001259) body weight (CMO:0000012) 1 224054293 260122809 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 631215 Stl8 Serum triglyceride level QTL 8 9.27 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 1 225126575 260522016 Rat 7387289 Uae45 Urinary albumin excretion QTL 45 2.86 0.0021 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 223262787 260522016 Rat 631843 Bw116 Body weight QTL 116 4.1 0.016 abdominal adipose amount (VT:1000220) abdominal fat pad weight (CMO:0000088) 1 224054293 260122809 Rat 731175 Uae20 Urinary albumin excretion QTL 20 3.5 0.0018 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 221264111 259647894 Rat 1598839 Rf56 Renal function QTL 56 renal blood flow trait (VT:2000006) ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239) 1 245907761 257976495 Rat 1581544 Rf52 Renal function QTL 52 0.05 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 1 232156370 259647894 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 724538 Kidm1 Kidney mass QTL 1 3.2 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 213707201 252085212 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 631536 Lnnr2 Liver neoplastic nodule remodeling QTL 2 2.9 0.0005 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 1 233948574 260522016 Rat 734769 Niddm58 Non-insulin dependent diabetes mellitus QTL 58 body mass (VT:0001259) body weight (CMO:0000012) 1 224569538 260122809 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 734768 Niddm59 Non-insulin dependent diabetes mellitus QTL 59 body mass (VT:0001259) body weight (CMO:0000012) 1 213843987 258843987 Rat 2302040 Pia35 Pristane induced arthritis QTL 35 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 216255568 260522016 Rat 631669 Iddm9 Insulin dependent diabetes mellitus QTL 9 2.8 0.039 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 233190394 258625266 Rat 1598821 Rf55 Renal function QTL 55 6.3 renal blood flow trait (VT:2000006) ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239) 1 218748008 257976495 Rat 1358890 Bp259 Blood pressure QTL 259 3.06 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 210702053 260522016 Rat 724533 Rf51 Renal function QTL 51 5.3 0.0002 kidney plasma flow trait (VT:0005524) renal plasma flow (CMO:0001914) 1 218753816 256448513 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016851 ⟹ ENSRNOP00000016851
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 246,721,298 - 246,731,468 (+) Ensembl Rnor_6.0 Ensembl 1 267,607,437 - 267,617,387 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000076367 ⟹ ENSRNOP00000067943
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 1 267,607,418 - 267,617,367 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000077011
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 246,721,221 - 246,722,689 (+) Ensembl Rnor_6.0 Ensembl 1 267,607,483 - 267,608,950 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000097867 ⟹ ENSRNOP00000095479
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 246,721,255 - 246,731,468 (+) Ensembl
RefSeq Acc Id:
NM_001007602 ⟹ NP_001007603
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 256,662,531 - 256,672,515 (+) NCBI mRatBN7.2 1 246,721,243 - 246,731,228 (+) NCBI Rnor_6.0 1 267,607,437 - 267,617,387 (+) NCBI Rnor_5.0 1 275,040,049 - 275,050,033 (+) NCBI RGSC_v3.4 1 253,228,547 - 253,238,531 (+) RGD Celera 1 242,486,178 - 242,496,113 (+) RGD
Sequence:
GGCGAGACTTGGCCACGTGCTTCCTGAGTCACCCGCAAACGAGAGCAGGACCCTCTTGGCTCTCCGTCTGCTCGGCGCAGCGATGTCCGGGGCGTCCGCCAGGAGCCTGGGGAAGGGAAGCGCGCCCC
hide sequence
RefSeq Acc Id:
XM_039108850 ⟹ XP_038964778
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 256,662,377 - 256,672,515 (+) NCBI mRatBN7.2 1 246,721,089 - 246,731,221 (+) NCBI
RefSeq Acc Id:
NP_001007603 ⟸ NM_001007602
- UniProtKB:
Q9Z339 (UniProtKB/Swiss-Prot), Q6AXR6 (UniProtKB/TrEMBL), A6JHR8 (UniProtKB/TrEMBL), B6DYQ5 (UniProtKB/TrEMBL), F7F9Z0 (UniProtKB/TrEMBL)
- Sequence:
MSGASARSLGKGSAPPGPVPEGQIRVYSMRFCPFAQRTLMVLKAKGIRHEIININLKNKPEWFFEKNPFGLVPVLENTQGHLITESVITCEYLDEAYPEKKLFPDDPYEKACQKMTFELFSKVPSLVT
hide sequence
Ensembl Acc Id:
ENSRNOP00000016851 ⟸ ENSRNOT00000016851
Ensembl Acc Id:
ENSRNOP00000067943 ⟸ ENSRNOT00000076367
RefSeq Acc Id:
XP_038964778 ⟸ XM_039108850
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000095479 ⟸ ENSRNOT00000097867
RGD ID: 13690981 Promoter ID: EPDNEW_R1506 Type: initiation region Name: Gsto1_1 Description: glutathione S-transferase omega 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 267,607,462 - 267,607,522 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-07-09
Gsto1
glutathione S-transferase omega 1
Symbol and Name updated to reflect Human and Mouse nomenclature
70877 APPROVED
Note Type
Note
Reference
gene_expression
expression is decreased 1.5 fold in SHR compared with WKY rats
1357414
gene_protein
213 amino acids with a molecular weight of 24,929
70644
