Symbol:
Psmc5
Name:
proteasome 26S subunit, ATPase 5
RGD ID:
708376
Description:
Enables ATP hydrolysis activity and TBP-class protein binding activity. Involved in positive regulation of inclusion body assembly. Located in inclusion body. Part of cytosolic proteasome complex and nuclear proteasome complex. Orthologous to human PSMC5 (proteasome 26S subunit, ATPase 5); PARTICIPATES IN retinoic acid signaling pathway; ubiquitin/proteasome degradation pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1,2,4-trimethylbenzene; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
26S protease regulatory subunit 8; 26S proteasome AAA-ATPase subunit RPT6; 26S proteasome regulatory subunit 8; for proteasomal ATPase (SUG1); LOC81827; p45/SUG; peptidase (prosome, macropain) 26S subunit, ATPase 5; protease (prosome, macropain) 26S subunit, ATPase 5; proteasomal ATPase (SUG1); proteasome (prosome, macropain) 26S subunit, ATPase, 5; proteasome 26S subunit ATPase 5; proteasome p45/SUG; proteasome subunit p45; Sug1; thyroid hormone receptor-interacting protein 1; TRIP1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PSMC5 (proteasome 26S subunit, ATPase 5) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Psmc5 (protease (prosome, macropain) 26S subunit, ATPase 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Psmc5 (proteasome 26S subunit, ATPase 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PSMC5 (proteasome 26S subunit, ATPase 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PSMC5 (proteasome 26S subunit, ATPase 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Psmc5 (proteasome 26S subunit, ATPase 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PSMC5 (proteasome 26S subunit, ATPase 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PSMC5 (proteasome 26S subunit, ATPase 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Psmc5 (proteasome 26S subunit, ATPase 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
TOMM70 (translocase of outer mitochondrial membrane 70) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
PSMC5 (proteasome 26S subunit, ATPase 5)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Psmc5 (protease (prosome, macropain) 26S subunit, ATPase 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
psmc5 (proteasome 26S subunit, ATPase 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
F56F11.4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RPT6
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Rpt6
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Rpt6R
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
rpt-6
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
psmc5
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 91,687,553 - 91,693,487 (+) NCBI GRCr8 mRatBN7.2 10 91,187,763 - 91,193,697 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 91,187,743 - 91,213,135 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 96,242,456 - 96,248,389 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 95,705,625 - 95,711,558 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 91,116,202 - 91,122,136 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 94,445,877 - 94,451,811 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 94,445,877 - 94,451,811 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 94,197,179 - 94,203,113 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 95,650,987 - 95,656,921 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 95,665,356 - 95,671,291 (+) NCBI Celera 10 89,863,649 - 89,869,583 (+) NCBI Celera Cytogenetic Map 10 q32.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Psmc5 Rat (S)-nicotine multiple interactions ISO Psmc5 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Psmc5 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO Psmc5 (Mus musculus) 6480464 o and p'-DDT results in increased expression of PSMC5 mRNA CTD PMID:24096037 Psmc5 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression EXP 6480464 o and p'-DDT results in increased expression of PSMC5 mRNA CTD PMID:24096037 Psmc5 Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of PSMC5 protein CTD PMID:17337753 Psmc5 Rat 1,2-dimethylhydrazine increases expression ISO Psmc5 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PSMC5 mRNA CTD PMID:22206623 Psmc5 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO PSMC5 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to PSMC5 protein CTD PMID:32991956 Psmc5 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO Psmc5 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Psmc5 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Psmc5 (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Psmc5 Rat 17alpha-ethynylestradiol increases expression ISO Psmc5 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of PSMC5 mRNA CTD PMID:17942748 and PMID:24096037 Psmc5 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of PSMC5 mRNA CTD PMID:24096037 Psmc5 Rat 17beta-estradiol affects expression ISO Psmc5 (Mus musculus) 6480464 Estradiol affects the expression of PSMC5 mRNA CTD PMID:15598610 Psmc5 Rat 17beta-estradiol increases expression ISO Psmc5 (Mus musculus) 6480464 Estradiol results in increased expression of PSMC5 mRNA CTD PMID:39298647 Psmc5 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO Psmc5 (Mus musculus) 6480464 2 more ... CTD PMID:25639565 Psmc5 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:31826744 Psmc5 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Psmc5 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Psmc5 Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Psmc5 (Mus musculus) 6480464 troxerutin inhibits the reaction [2 more ... CTD PMID:25639565 Psmc5 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Psmc5 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PSMC5 mRNA CTD PMID:21570461 and PMID:24680724 Psmc5 Rat 2,4,6-tribromophenol decreases expression ISO PSMC5 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Psmc5 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PSMC5 mRNA CTD PMID:21346803 Psmc5 Rat 2-hydroxypropanoic acid decreases expression ISO PSMC5 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PSMC5 mRNA CTD PMID:30851411 Psmc5 Rat 2-nitrofluorene increases expression EXP 6480464 2-nitrofluorene results in increased expression of PSMC5 mRNA CTD PMID:15890375 Psmc5 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO PSMC5 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of PSMC5 protein CTD PMID:31675489 Psmc5 Rat 4,4'-sulfonyldiphenol increases expression ISO Psmc5 (Mus musculus) 6480464 bisphenol S results in increased expression of PSMC5 mRNA CTD PMID:39298647 Psmc5 Rat 4,4'-sulfonyldiphenol increases expression ISO PSMC5 (Homo sapiens) 6480464 bisphenol S results in increased expression of PSMC5 protein CTD PMID:34186270 Psmc5 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of PSMC5 mRNA CTD PMID:15890375 Psmc5 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of PSMC5 mRNA CTD PMID:19483382 Psmc5 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of PSMC5 mRNA CTD PMID:19483382 Psmc5 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of PSMC5 mRNA CTD PMID:15890375 Psmc5 Rat aflatoxin B1 increases methylation ISO PSMC5 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of PSMC5 gene CTD PMID:27153756 Psmc5 Rat all-trans-retinoic acid decreases expression ISO PSMC5 (Homo sapiens) 6480464 Tretinoin results in decreased expression of PSMC5 mRNA CTD PMID:33167477 Psmc5 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of PSMC5 mRNA CTD PMID:19483382 Psmc5 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PSMC5 mRNA CTD PMID:16483693 Psmc5 Rat arsane multiple interactions ISO PSMC5 (Homo sapiens) 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PSMC5 mRNA CTD PMID:35809665 Psmc5 Rat arsenic atom multiple interactions ISO PSMC5 (Homo sapiens) 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PSMC5 mRNA CTD PMID:35809665 Psmc5 Rat arsenic trichloride multiple interactions ISO PSMC5 (Homo sapiens) 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PSMC5 mRNA CTD PMID:35809665 Psmc5 Rat atrazine decreases expression ISO PSMC5 (Homo sapiens) 6480464 Atrazine results in decreased expression of PSMC5 mRNA CTD PMID:22378314 Psmc5 Rat azoxystrobin multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PSMC5 mRNA CTD PMID:33854195 Psmc5 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of PSMC5 mRNA CTD PMID:19483382 Psmc5 Rat benzo[a]pyrene increases expression ISO Psmc5 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PSMC5 mRNA CTD PMID:22228805 Psmc5 Rat benzo[a]pyrene multiple interactions ISO PSMC5 (Homo sapiens) 6480464 [Soot co-treated with Benzo(a)pyrene] results in increased expression of PSMC5 protein CTD PMID:24464499 Psmc5 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of PSMC5 mRNA CTD PMID:21318169 Psmc5 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PSMC5 mRNA CTD PMID:25181051 Psmc5 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PSMC5 mRNA CTD PMID:33296240 Psmc5 Rat bisphenol A decreases expression ISO PSMC5 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PSMC5 mRNA CTD PMID:29275510 and PMID:33670352 Psmc5 Rat bisphenol A decreases methylation ISO Psmc5 (Mus musculus) 6480464 bisphenol A results in decreased methylation of PSMC5 promoter CTD PMID:27312807 Psmc5 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PSMC5 gene CTD PMID:28505145 Psmc5 Rat bisphenol AF increases expression ISO PSMC5 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PSMC5 protein CTD PMID:34186270 Psmc5 Rat Bisphenol B increases expression ISO PSMC5 (Homo sapiens) 6480464 bisphenol B results in increased expression of PSMC5 protein CTD PMID:34186270 Psmc5 Rat bisphenol F increases expression ISO PSMC5 (Homo sapiens) 6480464 bisphenol F results in increased expression of PSMC5 protein CTD PMID:34186270 Psmc5 Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of PSMC5 mRNA CTD PMID:12628495 Psmc5 Rat cadmium atom multiple interactions ISO PSMC5 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PSMC5 mRNA CTD PMID:35301059 Psmc5 Rat cadmium dichloride multiple interactions ISO PSMC5 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PSMC5 mRNA CTD PMID:35301059 Psmc5 Rat caffeine multiple interactions ISO Psmc5 (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Psmc5 Rat CGP 52608 multiple interactions ISO PSMC5 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PSMC5 gene] CTD PMID:28238834 Psmc5 Rat chlorpyrifos multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PSMC5 mRNA CTD PMID:33854195 Psmc5 Rat choline multiple interactions EXP 6480464 [Folic Acid deficiency co-treated with Methionine deficiency co-treated with Choline deficiency] results in increased expression of PSMC5 protein CTD PMID:19566968 Psmc5 Rat ciguatoxin CTX1B affects expression ISO Psmc5 (Mus musculus) 6480464 Ciguatoxins affects the expression of PSMC5 mRNA CTD PMID:18353800 Psmc5 Rat clobetasol increases expression ISO Psmc5 (Mus musculus) 6480464 Clobetasol results in increased expression of PSMC5 mRNA CTD PMID:27462272 Psmc5 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of PSMC5 mRNA CTD PMID:19483382 Psmc5 Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of PSMC5 mRNA CTD PMID:21318169 Psmc5 Rat clozapine increases expression ISO PSMC5 (Homo sapiens) 6480464 Clozapine results in increased expression of PSMC5 protein CTD PMID:34122009 Psmc5 Rat cyclosporin A increases methylation ISO PSMC5 (Homo sapiens) 6480464 Cyclosporine results in increased methylation of PSMC5 promoter CTD PMID:27989131 Psmc5 Rat Dibutyl phosphate affects expression ISO PSMC5 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PSMC5 mRNA CTD PMID:37042841 Psmc5 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PSMC5 mRNA CTD PMID:17379624 Psmc5 Rat dibutyl phthalate decreases expression ISO Psmc5 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of PSMC5 mRNA CTD PMID:17361019 Psmc5 Rat dichlorine increases expression EXP 6480464 Chlorine results in increased expression of PSMC5 mRNA CTD PMID:18636392 Psmc5 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of PSMC5 mRNA CTD PMID:18636392 Psmc5 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of PSMC5 mRNA CTD PMID:15890375 Psmc5 Rat doxorubicin increases expression ISO PSMC5 (Homo sapiens) 6480464 Doxorubicin results in increased expression of PSMC5 mRNA CTD PMID:29803840 Psmc5 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of PSMC5 mRNA CTD PMID:15353170 Psmc5 Rat ethanol affects splicing ISO Psmc5 (Mus musculus) 6480464 Ethanol affects the splicing of PSMC5 mRNA CTD PMID:30319688 Psmc5 Rat fenthion increases expression ISO Psmc5 (Mus musculus) 6480464 Fenthion results in increased expression of PSMC5 mRNA CTD PMID:34813904 Psmc5 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of PSMC5 mRNA CTD PMID:24136188 Psmc5 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PSMC5 mRNA CTD PMID:24136188 Psmc5 Rat folic acid multiple interactions EXP 6480464 [Folic Acid deficiency co-treated with Methionine deficiency co-treated with Choline deficiency] results in increased expression of PSMC5 protein CTD PMID:19566968 Psmc5 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PSMC5 mRNA CTD PMID:33387578 Psmc5 Rat glyphosate multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PSMC5 mRNA CTD PMID:33854195 Psmc5 Rat hyaluronic acid decreases expression EXP 6480464 Hyaluronic Acid analog results in decreased expression of PSMC5 protein CTD PMID:23178681 Psmc5 Rat hydrogen peroxide decreases expression EXP 6480464 Hydrogen Peroxide results in decreased expression of PSMC5 protein CTD PMID:23178681 Psmc5 Rat imidacloprid multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PSMC5 mRNA CTD PMID:33854195 Psmc5 Rat isoprenaline multiple interactions EXP 6480464 [Isoproterenol co-treated with POSTN protein] results in decreased expression of PSMC5 mRNA CTD PMID:30303030 Psmc5 Rat ivermectin decreases expression ISO PSMC5 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PSMC5 protein CTD PMID:32959892 Psmc5 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of PSMC5 mRNA CTD PMID:19483382 Psmc5 Rat L-methionine multiple interactions EXP 6480464 [Folic Acid deficiency co-treated with Methionine deficiency co-treated with Choline deficiency] results in increased expression of PSMC5 protein CTD PMID:19566968 Psmc5 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of PSMC5 mRNA CTD PMID:24136188 Psmc5 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of PSMC5 mRNA CTD PMID:15890375 Psmc5 Rat methidathion increases expression ISO Psmc5 (Mus musculus) 6480464 methidathion results in increased expression of PSMC5 mRNA CTD PMID:34813904 Psmc5 Rat methotrexate affects expression ISO Psmc5 (Mus musculus) 6480464 Methotrexate affects the expression of PSMC5 mRNA CTD PMID:18502557 Psmc5 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions EXP 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde promotes the reaction and affects the localization of [PSMC5 protein binds to GABBR2 protein] CTD PMID:24482233 Psmc5 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO PSMC5 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of PSMC5 mRNA CTD PMID:31806706 Psmc5 Rat N-methyl-4-phenylpyridinium increases expression ISO Psmc5 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PSMC5 protein CTD PMID:26558463 Psmc5 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of PSMC5 mRNA CTD PMID:15890375 Psmc5 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of PSMC5 mRNA CTD PMID:24136188 Psmc5 Rat nicotine multiple interactions ISO Psmc5 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Psmc5 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of PSMC5 mRNA CTD PMID:24136188 Psmc5 Rat nitrates multiple interactions ISO Psmc5 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PSMC5 mRNA CTD PMID:35964746 Psmc5 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of PSMC5 mRNA CTD PMID:19483382 Psmc5 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of PSMC5 mRNA CTD PMID:18636392 Psmc5 Rat ozone increases expression EXP 6480464 Ozone results in increased expression of PSMC5 mRNA CTD PMID:35737395 Psmc5 Rat paraquat multiple interactions ISO Psmc5 (Mus musculus) 6480464 PARK7 gene mutant form affects the reaction [Paraquat affects the expression of PSMC5 protein] CTD PMID:17823202 Psmc5 Rat pentachlorophenol increases expression ISO Psmc5 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of PSMC5 mRNA CTD PMID:23892564 Psmc5 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of PSMC5 mRNA CTD PMID:19162173 and PMID:21318169 Psmc5 Rat phenobarbital increases expression ISO Psmc5 (Mus musculus) 6480464 Phenobarbital results in increased expression of PSMC5 mRNA CTD PMID:25270620 Psmc5 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of PSMC5 mRNA CTD PMID:19162173 and PMID:21318169 Psmc5 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of PSMC5 mRNA CTD PMID:15890375 and PMID:22484513 Psmc5 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of PSMC5 mRNA CTD PMID:19483382 Psmc5 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of PSMC5 mRNA CTD PMID:15890375 Psmc5 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of PSMC5 mRNA CTD PMID:19162173 and PMID:21318169 Psmc5 Rat Propiverine affects binding EXP 6480464 propiverine binds to PSMC5 protein CTD PMID:29273565 Psmc5 Rat quinoline increases expression ISO PSMC5 (Homo sapiens) 6480464 quinoline analog results in increased expression of PSMC5 protein CTD PMID:18645022 Psmc5 Rat rac-lactic acid decreases expression ISO PSMC5 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PSMC5 mRNA CTD PMID:30851411 Psmc5 Rat resveratrol multiple interactions ISO PSMC5 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of PSMC5 mRNA CTD PMID:23557933 Psmc5 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of PSMC5 mRNA CTD PMID:19013527 Psmc5 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of PSMC5 mRNA CTD PMID:19281266 Psmc5 Rat sulindac decreases expression EXP 6480464 Sulindac results in decreased expression of PSMC5 mRNA CTD PMID:24136188 Psmc5 Rat sunitinib decreases expression ISO PSMC5 (Homo sapiens) 6480464 Sunitinib results in decreased expression of PSMC5 mRNA CTD PMID:31533062 Psmc5 Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of PSMC5 mRNA CTD PMID:12734012 Psmc5 Rat tetrachloromethane increases expression ISO Psmc5 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PSMC5 mRNA CTD PMID:31919559 Psmc5 Rat thiabendazole multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PSMC5 mRNA CTD PMID:33854195 Psmc5 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of PSMC5 mRNA CTD PMID:19483382 Psmc5 Rat tolcapone affects binding EXP 6480464 tolcapone binds to PSMC5 protein CTD PMID:19783845 Psmc5 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of PSMC5 gene CTD PMID:27618143 Psmc5 Rat trimellitic anhydride increases expression ISO Psmc5 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of PSMC5 mRNA CTD PMID:19042947 Psmc5 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of PSMC5 mRNA CTD PMID:24136188 Psmc5 Rat valproic acid decreases methylation ISO PSMC5 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of PSMC5 gene CTD PMID:29154799 Psmc5 Rat valproic acid increases expression ISO PSMC5 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PSMC5 mRNA CTD PMID:23179753 Psmc5 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of PSMC5 mRNA CTD PMID:21318169 Psmc5 Rat zinc sulfate decreases expression ISO PSMC5 (Homo sapiens) 6480464 Zinc Sulfate results in decreased expression of PSMC5 mRNA CTD PMID:12756304
Imported Annotations - KEGG (archival)
(S)-nicotine (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO) 1,2,4-trimethylbenzene (EXP) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (ISO) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 2-nitrofluorene (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) amiodarone (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenic trichloride (ISO) atrazine (ISO) azoxystrobin (EXP) benzbromarone (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bromobenzene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) CGP 52608 (ISO) chlorpyrifos (EXP) choline (EXP) ciguatoxin CTX1B (ISO) clobetasol (ISO) clofibrate (EXP) clozapine (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dichlorine (EXP) diethylstilbestrol (EXP) doxorubicin (ISO) ethanol (EXP,ISO) fenthion (ISO) finasteride (EXP) flutamide (EXP) folic acid (EXP) gentamycin (EXP) glyphosate (EXP) hyaluronic acid (EXP) hydrogen peroxide (EXP) imidacloprid (EXP) isoprenaline (EXP) ivermectin (ISO) L-ethionine (EXP) L-methionine (EXP) leflunomide (EXP) methapyrilene (EXP) methidathion (ISO) methotrexate (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (EXP,ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodimethylamine (EXP) nefazodone (EXP) nicotine (ISO) nimesulide (EXP) nitrates (ISO) omeprazole (EXP) ozone (EXP) paraquat (ISO) pentachlorophenol (ISO) perfluorooctanoic acid (EXP) phenobarbital (EXP,ISO) piperonyl butoxide (EXP) pirinixic acid (EXP) pregnenolone 16alpha-carbonitrile (EXP) Propiverine (EXP) quinoline (ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (EXP) Soman (EXP) sulindac (EXP) sunitinib (ISO) tetrachloromethane (EXP,ISO) thiabendazole (EXP) thioacetamide (EXP) tolcapone (EXP) trichloroethene (EXP) trimellitic anhydride (ISO) valdecoxib (EXP) valproic acid (EXP,ISO) zinc sulfate (ISO)
Cellular Component
cytoplasm (IEA,ISO,ISS) cytoplasmic vesicle (IEA,ISO) cytosolic proteasome complex (IDA) inclusion body (IDA) nuclear proteasome complex (IDA) nucleus (IEA,ISO,ISS) proteasome accessory complex (IEA,ISO,ISS) proteasome complex (IEA,ISO,ISS) proteasome regulatory particle (IEA,ISO) proteasome regulatory particle, base subcomplex (IBA)
1.
cDNA cloning of a new putative ATPase subunit p45 of the human 26S proteasome, a homolog of yeast transcriptional factor Sug1p.
Akiyama K, etal., FEBS Lett 1995 Apr 17;363(1-2):151-6.
2.
Phosphorylation of Rpt6 regulates synaptic strength in hippocampal neurons.
Djakovic SN, etal., J Neurosci. 2012 Apr 11;32(15):5126-31. doi: 10.1523/JNEUROSCI.4427-11.2012.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Gene coding for the transcription factor, SUG/proteasome, p45 is located nearly 40 kb downstream from the rat growth hormone gene.
Kazahari K, etal., Gene 1997 Oct 1;198(1-2):323-7.
5.
Structures of the rat proteasomal ATPases: determination of highly conserved structural motifs and rules for their spacing.
Makino Y, etal., Biochem Biophys Res Commun 1996 Mar 27;220(3):1049-54.
6.
Multiple mammalian proteasomal ATPases, but not proteasome itself, are associated with TATA-binding protein and a novel transcriptional activator, TIP120.
Makino Y, etal., Genes Cells. 1999 Sep;4(9):529-39.
7.
SUG1, a component of the 26 S proteasome, is an ATPase stimulated by specific RNAs.
Makino Y, etal., J Biol Chem. 1997 Sep 12;272(37):23201-5.
8.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
GOA pipeline
RGD automated data pipeline
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Dynamic and combinatorial control of gene expression by nuclear retinoic acid receptors (RARs).
Rochette-Egly C and Germain P, Nucl Recept Signal. 2009 May 8;7:e005.
13.
Misfolding of proteins with a polyglutamine expansion is facilitated by proteasomal chaperones.
Rousseau E, etal., J Biol Chem. 2009 Jan 16;284(3):1917-29. doi: 10.1074/jbc.M806256200. Epub 2008 Nov 5.
14.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
15.
Differential ligand-dependent interactions between the AF-2 activating domain of nuclear receptors and the putative transcriptional intermediary factors mSUG1 and TIF1.
vom Baur E, etal., EMBO J 1996 Jan 2;15(1):110-24.
16.
Mammalian Sug1 and c-Fos in the nuclear 26S proteasome.
Wang W, etal., Proc Natl Acad Sci U S A. 1996 Aug 6;93(16):8236-40.
Psmc5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 91,687,553 - 91,693,487 (+) NCBI GRCr8 mRatBN7.2 10 91,187,763 - 91,193,697 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 91,187,743 - 91,213,135 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 96,242,456 - 96,248,389 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 95,705,625 - 95,711,558 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 91,116,202 - 91,122,136 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 94,445,877 - 94,451,811 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 94,445,877 - 94,451,811 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 94,197,179 - 94,203,113 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 95,650,987 - 95,656,921 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 95,665,356 - 95,671,291 (+) NCBI Celera 10 89,863,649 - 89,869,583 (+) NCBI Celera Cytogenetic Map 10 q32.1 NCBI
PSMC5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 63,827,431 - 63,832,019 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 63,827,152 - 63,832,026 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 61,904,791 - 61,909,379 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 59,258,542 - 59,263,119 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 59,258,541 - 59,263,118 NCBI Celera 17 56,292,931 - 56,297,508 (+) NCBI Celera Cytogenetic Map 17 q23.3 NCBI HuRef 17 57,272,832 - 57,277,449 (+) NCBI HuRef CHM1_1 17 61,969,121 - 61,973,738 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 64,697,992 - 64,702,868 (+) NCBI T2T-CHM13v2.0
Psmc5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 106,147,011 - 106,153,938 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 106,146,980 - 106,153,946 (+) Ensembl GRCm39 Ensembl GRCm38 11 106,256,185 - 106,263,112 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 106,256,154 - 106,263,120 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 106,117,499 - 106,124,426 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 106,072,275 - 106,079,202 (+) NCBI MGSCv36 mm8 Celera 11 117,986,618 - 117,993,566 (+) NCBI Celera Cytogenetic Map 11 E1 NCBI cM Map 11 68.89 NCBI
Psmc5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955478 7,996,902 - 8,002,183 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955478 7,996,902 - 8,002,183 (-) NCBI ChiLan1.0 ChiLan1.0
PSMC5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 79,998,638 - 80,003,642 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 84,816,490 - 84,821,109 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 57,906,934 - 57,911,551 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 63,051,050 - 63,055,911 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 63,051,050 - 63,055,907 (+) Ensembl panpan1.1 panPan2
PSMC5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 11,783,422 - 11,787,624 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 11,783,466 - 11,787,617 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 12,743,141 - 12,747,321 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 13,444,521 - 13,448,701 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 13,444,569 - 13,448,699 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 12,391,162 - 12,395,338 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 15,136,575 - 15,140,755 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 15,139,318 - 15,143,495 (-) NCBI UU_Cfam_GSD_1.0
Psmc5
PSMC5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 15,101,859 - 15,106,213 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 15,101,946 - 15,106,326 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 15,092,253 - 15,096,632 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PSMC5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 57,457,670 - 57,462,321 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 57,457,720 - 57,462,249 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 28,066,027 - 28,070,940 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Psmc5
.
Predicted Target Of
Count of predictions: 62 Count of miRNA genes: 60 Interacting mature miRNAs: 60 Transcripts: ENSRNOT00000013997 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 631555 Bp134 Blood pressure QTL 134 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 80515287 91230079 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 1579915 Bp280 Blood pressure QTL 280 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90404397 107211142 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 4889948 Bss91 Bone structure and strength QTL 91 4 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 10 82564856 92369470 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1579919 Bp281 Blood pressure QTL 281 0.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 74372084 94965338 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 1300107 Rf18 Renal function QTL 18 3.41 urine output (VT:0003620) timed urine volume (CMO:0000260) 10 78775516 98279596 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 2317754 Glom25 Glomerulus QTL 25 3.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 82685200 107211142 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 10450495 Bp383 Blood pressure QTL 383 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 94965338 Rat 2313856 Bp342 Blood pressure QTL 342 4.4 0.0001 life span trait (VT:0005372) age at time of death (CMO:0001193) 10 87307617 96121100 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2292617 Ept18 Estrogen-induced pituitary tumorigenesis QTL 18 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 61363 Oia3 Oil induced arthritis QTL 3 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87307617 107211142 Rat 1357344 Bp249 Blood pressure QTL 249 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 66743655 98003205 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 724530 Bp149 Blood pressure QTL 149 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90627439 107211142 Rat 1300137 Bp186 Blood pressure QTL 186 3.57 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 10 90627439 107057807 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 6893357 Bw102 Body weight QTL 102 0.5 0.36 body mass (VT:0001259) body weight (CMO:0000012) 10 80515287 101325465 Rat 12880384 Cm107 Cardiac mass QTL 107 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 90404397 107211142 Rat 12880385 Cm108 Cardiac mass QTL 108 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 90404397 107211142 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 2303589 Bw87 Body weight QTL 87 2 body mass (VT:0001259) body weight (CMO:0000012) 10 81285008 107211142 Rat 12880396 Am13 Aortic mass QTL 13 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 90404397 107211142 Rat 2306793 Ean5 Experimental allergic neuritis QTL 5 4.7 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 72552416 93995749 Rat 12880398 Kidm67 Kidney mass QTL 67 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 90404397 107211142 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2306792 Ean4 Experimental allergic neuritis QTL 4 4 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 84022321 93995963 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 12880395 Cm109 Cardiac mass QTL 109 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 10 90404397 107211142 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 634320 Niddm49 Non-insulin dependent diabetes mellitus QTL 49 4.41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 10 88539139 107211142 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 12880055 Am11 Aortic mass QTL 11 0.004 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 84007272 95933025 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 2301398 Kidm38 Kidney mass QTL 38 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 84007272 95933025 Rat 1600367 Mcs15 Mammary carcinoma susceptibility QTL 15 4.5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 85565469 103884409 Rat 1358188 Ept9 Estrogen-induced pituitary tumorigenesis QTL 9 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 631538 Oia5 Oil induced arthritis QTL 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87055121 107211142 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
M60510
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 91,194,082 - 91,194,158 (+) MAPPER mRatBN7.2 Rnor_6.0 10 94,452,197 - 94,452,272 NCBI Rnor6.0 Rnor_5.0 10 94,203,499 - 94,203,574 UniSTS Rnor5.0 RGSC_v3.4 10 95,657,307 - 95,657,382 UniSTS RGSC3.4 Celera 10 89,869,969 - 89,870,044 UniSTS Cytogenetic Map 10 q32.1 UniSTS
RH136975
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 91,693,209 - 91,693,478 (+) Marker Load Pipeline mRatBN7.2 10 91,193,419 - 91,193,688 (+) MAPPER mRatBN7.2 Rnor_6.0 10 94,451,534 - 94,451,802 NCBI Rnor6.0 Rnor_5.0 10 94,202,836 - 94,203,104 UniSTS Rnor5.0 RGSC_v3.4 10 95,656,644 - 95,656,912 UniSTS RGSC3.4 Celera 10 89,869,306 - 89,869,574 UniSTS Cytogenetic Map 10 q32.1 UniSTS
MARC_4113-4114:991938380:3
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 91,687,557 - 91,688,238 (+) Marker Load Pipeline mRatBN7.2 10 91,187,767 - 91,188,448 (+) MAPPER mRatBN7.2 Rnor_6.0 10 94,445,882 - 94,446,562 NCBI Rnor6.0 Rnor_5.0 10 94,197,184 - 94,197,864 UniSTS Rnor5.0 RGSC_v3.4 10 95,650,992 - 95,651,672 UniSTS RGSC3.4 Celera 10 89,863,654 - 89,864,334 UniSTS Cytogenetic Map 10 q32.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013997 ⟹ ENSRNOP00000013997
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 91,187,743 - 91,213,135 (+) Ensembl Rnor_6.0 Ensembl 10 94,445,877 - 94,451,811 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113357 ⟹ ENSRNOP00000090060
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 91,187,746 - 91,193,694 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000118001 ⟹ ENSRNOP00000079284
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 91,187,773 - 91,196,129 (+) Ensembl
RefSeq Acc Id:
NM_031149 ⟹ NP_112411
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 91,687,553 - 91,693,487 (+) NCBI mRatBN7.2 10 91,187,763 - 91,193,697 (+) NCBI Rnor_6.0 10 94,445,877 - 94,451,811 (+) NCBI Rnor_5.0 10 94,197,179 - 94,203,113 (+) NCBI RGSC_v3.4 10 95,650,987 - 95,656,921 (+) RGD Celera 10 89,863,649 - 89,869,583 (+) RGD
Sequence:
GCCGAAAGAGGGAAGATGGCGCTTGATGGGCCAGAGCAGATGGAACTGGAAGAGGGGAAGGCAGGCAGTGGACTCCGTCAATATTATCTGTCCAAGATTGAAGAACTCCAGTTGATTGTGAATGACAA
hide sequence
RefSeq Acc Id:
NP_112411 ⟸ NM_031149
- UniProtKB:
P62198 (UniProtKB/Swiss-Prot), A0A8L2Q7I4 (UniProtKB/TrEMBL), A6HK17 (UniProtKB/TrEMBL)
- Sequence:
MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILP
hide sequence
Ensembl Acc Id:
ENSRNOP00000013997 ⟸ ENSRNOT00000013997
Ensembl Acc Id:
ENSRNOP00000090060 ⟸ ENSRNOT00000113357
Ensembl Acc Id:
ENSRNOP00000079284 ⟸ ENSRNOT00000118001
RGD ID: 13697839 Promoter ID: EPDNEW_R8364 Type: multiple initiation site Name: Psmc5_1 Description: proteasome 26S subunit, ATPase 5 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 94,445,855 - 94,445,915 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-08-19
Psmc5
proteasome 26S subunit, ATPase 5
Psmc5
proteasome (prosome, macropain) 26S subunit, ATPase, 5
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-12-15
Psmc5
proteasome (prosome, macropain) 26S subunit, ATPase, 5
Psmc5
protease (prosome, macropain) 26S subunit, ATPase 5
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-04
Psmc5
protease (prosome, macropain) 26S subunit, ATPase 5
Psmc5
peptidase (prosome, macropain) 26S subunit, ATPase 5
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-07-08
Psmc5
peptidase (prosome, macropain) 26S subunit, ATPase 5
LOC81827
for proteasomal ATPase (SUG1)
Symbol and Name updated
1299863 APPROVED
