Advanced Search (OLGA)

Gene: Map2k1 (mitogen activated protein kinase kinase 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Map2k1

Name:

mitogen activated protein kinase kinase 1

RGD ID:

70495

Description:

Enables ATP binding activity; MAP kinase kinase activity; and enzyme binding activity. Involved in several processes, including positive regulation of metabolic process; regulation of intracellular signal transduction; and regulation of muscle contraction. Acts upstream of or within positive regulation of Ras protein signal transduction. Located in several cellular components, including dendrite cytoplasm; perikaryon; and perinuclear region of cytoplasm. Is active in glutamatergic synapse and postsynaptic density. Used to study cataract and prostate adenocarcinoma. Human ortholog(s) of this gene implicated in carcinoma (multiple); cardiofaciocutaneous syndrome 3; high grade glioma; and melorheostosis. Orthologous to human MAP2K1 (mitogen-activated protein kinase kinase 1); PARTICIPATES IN the extracellular signal-regulated Raf/Mek/Erk signaling pathway; altered extracellular signal-regulated Raf/Mek/Erk signaling pathway; ceramide signaling pathway; INTERACTS WITH (+)-schisandrin B; 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

dual specificity mitogen-activated protein kinase kinase 1; ERK activator kinase 1; MAP kinase kinase 1; MAP kinase/Erk kinase 1; MAPK/ERK kinase 1; MAPKK 1; Mek1; mitogen-activated protein kinase kinase 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MAP2K1 (mitogen-activated protein kinase kinase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Map2k1 (mitogen-activated protein kinase kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Map2k1 (mitogen-activated protein kinase kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MAP2K1 (mitogen-activated protein kinase kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MAP2K1 (mitogen-activated protein kinase kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Map2k1 (mitogen-activated protein kinase kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MAP2K1 (mitogen-activated protein kinase kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MAP2K1 (mitogen-activated protein kinase kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Map2k1 (mitogen-activated protein kinase kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MAP2K2 (mitogen-activated protein kinase kinase 2)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	MAP2K1 (mitogen-activated protein kinase kinase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Map2k1 (mitogen-activated protein kinase kinase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	map2k1 (mitogen-activated protein kinase kinase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	map2k1 (mitogen-activated protein kinase kinase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Dsor1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PBS2	Alliance	DIOPT (OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mek-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	STE7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	map2k1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	73,578,747 - 73,650,184 (-)	NCBI		GRCr8
GRCr8 Ensembl	8	73,578,752 - 73,650,184 (-)	Ensembl		GRCr8 Ensembl
mRatBN7.2	8	64,683,449 - 64,754,900 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	64,683,449 - 64,755,147 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	70,198,296 - 70,269,639 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	68,470,887 - 68,542,228 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	66,340,874 - 66,412,220 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	69,134,218 - 69,722,573 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	69,134,223 - 69,164,758 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	68,840,454 - 68,877,679 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	68,379,074 - 68,451,554 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	64,090,188 - 64,161,314 (-)	NCBI		Celera
RGSC_v3.1	8	68,398,125 - 68,470,608 (-)	NCBI
Cytogenetic Map	8	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Map2k1	Rat	brain ischemia		ISO	Map2k1 (Mus musculus)	1582169		RGD
Map2k1	Rat	breast cancer		ISO	MAP2K1 (Homo sapiens)	2292627		RGD
Map2k1	Rat	Cardiovascular Abnormalities	susceptibility	ISO	MAP2K1 (Homo sapiens)	1580093		RGD
Map2k1	Rat	cataract		IMP		12801446		RGD
Map2k1	Rat	Experimental Liver Neoplasms		IEP		2306052	associated with Diabetes Mellitus, Experimental;protein:increased expression:liver	RGD
Map2k1	Rat	high grade glioma		ISO	MAP2K1 (Homo sapiens)	13702863		RGD
Map2k1	Rat	lung adenocarcinoma		ISO	MAP2K1 (Homo sapiens)	151665107	mRNA:increased expression:lung (human)	RGD
Map2k1	Rat	lung non-small cell carcinoma		ISO	MAP2K1 (Homo sapiens)	5133243		RGD
Map2k1	Rat	lung non-small cell carcinoma	ameliorates	ISO	Map2k1 (Mus musculus)	150530476		RGD
Map2k1	Rat	lung non-small cell carcinoma		ISO	MAP2K1 (Homo sapiens)	5133242		RGD
Map2k1	Rat	ovarian carcinoma		ISO	MAP2K1 (Homo sapiens)	2306053		RGD
Map2k1	Rat	Ovarian Neoplasms		ISO	MAP2K1 (Homo sapiens)	9068941		RGD	PMID:18060073\|REF_RGD_ID:2298686
Map2k1	Rat	pancreatic adenocarcinoma	severity	ISO	MAP2K1 (Homo sapiens)	13838840	protein:increased expression:pancreas (human)	RGD
Map2k1	Rat	pancreatic adenocarcinoma	treatment	ISO	MAP2K1 (Homo sapiens)	13838804	human tissue in a mouse model	RGD
Map2k1	Rat	pancreatitis	severity	ISO	Map2k1 (Mus musculus)	13838805		RGD
Map2k1	Rat	prostate adenocarcinoma	disease_progression	IDA		2292631	metastasis; inhibition reduced invasiveness of prostate tumor cells	RGD
Map2k1	Rat	renal cell carcinoma		ISO	MAP2K1 (Homo sapiens)	2292629		RGD
Map2k1	Rat	renal cell carcinoma		ISO	MAP2K1 (Homo sapiens)	2292630		RGD
Map2k1	Rat	small intestine adenocarcinoma		ISO	MAP2K1 (Homo sapiens)	13464351		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Map2k1	Rat	arteriovenous malformation		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Arteriovenous malformation	ClinVar	PMID:39434542
Map2k1	Rat	autism spectrum disorder		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism spectrum disorders	ClinVar	PMID:17704260\|PMID:18060073\|PMID:19344873\|PMID:19411838\|PMID:20301365\|PMID:22327936\|PMID:24033266\|PMID:25049390\|PMID:25741868\|PMID:28492532\|PMID:29402968\|PMID:30763456\|PMID:31487502
Map2k1	Rat	Bloom syndrome		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Bloom syndrome	ClinVar	PMID:28492532
Map2k1	Rat	cardiofaciocutaneous syndrome		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: CFC syndrome \| ClinVar Annotator: match by term: Cardio-facio-cutaneous syndrome	ClinVar	PMID:10502786\|PMID:12612583\|PMID:1430233\|PMID:15917206\|PMID:16439621\|PMID:16450583\|PMID:16538226\|PMID:17366577\|PMID:17551924\|PMID:17567882\|PMID:17704260\|PMID:17981815\|PMID:18039235\|PMID:1804226\|PMID:18042262\|PMID:18060073\|PMID:18413255\|PMID:18632602\|PMID:18854871\|PMID:19156172\|PMID:19344873\|PMID:19376813\|PMID:19411838\|PMID:19915144\|PMID:20301365\|PMID:20354455\|PMID:21062266\|PMID:22177953\|PMID:22327936\|PMID:22848035\|PMID:23093928\|PMID:23569304\|PMID:24033266\|PMID:24101678\|PMID:24236184\|PMID:24458522\|PMID:24637312\|PMID:24803665\|PMID:25049390\|PMID:25241384\|PMID:25326635\|PMID:25423878\|PMID:25741868\|PMID:26350204\|PMID:26795593\|PMID:27862862\|PMID:28049852\|PMID:28492532\|PMID:28624954\|PMID:29402968\|PMID:29493581\|PMID:29643386\|PMID:29753091\|PMID:29907801\|PMID:30087384\|PMID:30141192\|PMID:30763456\|PMID:31487502\|PMID:31942422\|PMID:31972311\|PMID:32005694\|PMID:32978145\|PMID:32985417\|PMID:33482860\|PMID:39086472\|PMID:39434542
Map2k1	Rat	cardiofaciocutaneous syndrome 1		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Cardiofaciocutaneous syndrome 1	ClinVar	PMID:17704260\|PMID:18060073\|PMID:19344873\|PMID:19411838\|PMID:20301365\|PMID:22327936\|PMID:24033266\|PMID:25049390\|PMID:25741868\|PMID:28492532\|PMID:29402968\|PMID:30763456\|PMID:31487502
Map2k1	Rat	cardiofaciocutaneous syndrome 3		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Cardiofaciocutaneous syndrome 3 \| ClinVar Annotator: match by term: MAP2K1-related more ...	ClinVar	PMID:10502786\|PMID:12370306\|PMID:12612583\|PMID:1430233\|PMID:15917206\|PMID:16199547\|PMID:16439621\|PMID:16450583\|PMID:16538226\|PMID:17366577\|PMID:17551924\|PMID:17567882\|PMID:17704260\|PMID:17981815\|PMID:18039235\|PMID:1804226\|PMID:18042262\|PMID:18060073\|PMID:18413255\|PMID:18456719\|PMID:18632602\|PMID:18854871\|PMID:19156172\|PMID:19344873\|PMID:19376813\|PMID:19411838\|PMID:19915144\|PMID:20301365\|PMID:21062266\|PMID:22177953\|PMID:22197931\|PMID:22327936\|PMID:22848035\|PMID:23093928\|PMID:23569304\|PMID:24033266\|PMID:24101678\|PMID:24236184\|PMID:24458522\|PMID:24637312\|PMID:24803665\|PMID:25049390\|PMID:25241384\|PMID:25326635\|PMID:25423878\|PMID:25741868\|PMID:25741869\|PMID:26343583\|PMID:26350204\|PMID:26795593\|PMID:27862862\|PMID:28049852\|PMID:28492532\|PMID:28495673\|PMID:28624954\|PMID:28955999\|PMID:29402968\|PMID:29493581\|PMID:29753091\|PMID:29907801\|PMID:30087384\|PMID:30141192\|PMID:30763456\|PMID:31487502\|PMID:31942422\|PMID:31972311\|PMID:32005694\|PMID:32978145\|PMID:32985417\|PMID:33057194\|PMID:33128510\|PMID:33482860\|PMID:34006472\|PMID:34308104\|PMID:34589056\|PMID:35524774\|PMID:35982159\|PMID:39086472
Map2k1	Rat	colorectal cancer		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial colorectal cancer	ClinVar	PMID:28492532
Map2k1	Rat	genetic disease		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:16439621\|PMID:17366577\|PMID:17551924\|PMID:18042262\|PMID:18456719\|PMID:19156172\|PMID:22197931\|PMID:24033266\|PMID:25741868\|PMID:28049852\|PMID:28495673\|PMID:29493581
Map2k1	Rat	lung non-small cell carcinoma		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Non-small cell lung carcinoma	ClinVar	PMID:18632602\|PMID:25741868\|PMID:29643386\|PMID:39434542
Map2k1	Rat	lung non-small cell carcinoma		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Non-small cell lung cancer \| ClinVar Annotator: match by term: more ...	ClinVar	PMID:17704260\|PMID:18060073\|PMID:18632602\|PMID:19411838\|PMID:19915144\|PMID:20301365\|PMID:22327936\|PMID:23444215\|PMID:23569304\|PMID:24033266\|PMID:25049390\|PMID:25157968\|PMID:25741868\|PMID:28492532\|PMID:29643386\|PMID:30763456\|PMID:7651428
Map2k1	Rat	lung squamous cell carcinoma		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Squamous cell lung carcinoma	ClinVar	PMID:25741868
Map2k1	Rat	melorheostosis		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: MELORHEOSTOSIS, ISOLATED \| ClinVar Annotator: match by term: Melorheostosis	ClinVar	PMID:10502786\|PMID:12612583\|PMID:1430233\|PMID:15917206\|PMID:16439621\|PMID:16450583\|PMID:16538226\|PMID:17366577\|PMID:17551924\|PMID:17567882\|PMID:17576681\|PMID:17704260\|PMID:17981815\|PMID:18042262\|PMID:18060073\|PMID:18413255\|PMID:18632602\|PMID:18854871\|PMID:19156172\|PMID:19344873\|PMID:19376813\|PMID:19411838\|PMID:20301365\|PMID:22177953\|PMID:22327936\|PMID:22848035\|PMID:23093928\|PMID:24033266\|PMID:24101678\|PMID:24236184\|PMID:24637312\|PMID:25049390\|PMID:25241384\|PMID:25326635\|PMID:25741868\|PMID:26350204\|PMID:26795593\|PMID:26918529\|PMID:27862862\|PMID:28492532\|PMID:28624954\|PMID:29402968\|PMID:29643386\|PMID:30087384\|PMID:30763456\|PMID:31487502\|PMID:31942422\|PMID:32985417\|PMID:34006472\|PMID:34589056\|PMID:39086472\|PMID:39434542\|PMID:9536098
Map2k1	Rat	neuronal ceroid lipofuscinosis		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neuronal ceroid lipofuscinosis	ClinVar	PMID:28492532
Map2k1	Rat	Noonan syndrome		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Female pseudo-Turner syndrome \| ClinVar Annotator: match by term: Noonan more ...	ClinVar	PMID:10502786\|PMID:12612583\|PMID:1430233\|PMID:15917206\|PMID:16439621\|PMID:16450583\|PMID:16538226\|PMID:17366577\|PMID:17551924\|PMID:17567882\|PMID:17704260\|PMID:17981815\|PMID:18042262\|PMID:18060073\|PMID:18413255\|PMID:18456719\|PMID:18632602\|PMID:18854871\|PMID:19156172\|PMID:19344873\|PMID:19376813\|PMID:19411838\|PMID:20301365\|PMID:22177953\|PMID:22197931\|PMID:22327936\|PMID:22848035\|PMID:23093928\|PMID:24033266\|PMID:24101678\|PMID:24236184\|PMID:24637312\|PMID:25049390\|PMID:25241384\|PMID:25326635\|PMID:25741868\|PMID:26343583\|PMID:26350204\|PMID:26795593\|PMID:27862862\|PMID:28049852\|PMID:28492532\|PMID:28624954\|PMID:29402968\|PMID:30087384\|PMID:30763456\|PMID:31487502\|PMID:31942422\|PMID:32978145\|PMID:32985417\|PMID:34308104\|PMID:35322241\|PMID:39086472
Map2k1	Rat	Noonan syndrome 1		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Noonan syndrome 1	ClinVar	PMID:10502786\|PMID:12612583\|PMID:1430233\|PMID:15917206\|PMID:16439621\|PMID:16450583\|PMID:16538226\|PMID:17366577\|PMID:17551924\|PMID:17567882\|PMID:17981815\|PMID:18042262\|PMID:18413255\|PMID:18632602\|PMID:18854871\|PMID:19156172\|PMID:19376813\|PMID:22177953\|PMID:22848035\|PMID:23093928\|PMID:24033266\|PMID:24101678\|PMID:24236184\|PMID:24637312\|PMID:25241384\|PMID:25326635\|PMID:25741868\|PMID:25741869\|PMID:26350204\|PMID:26795593\|PMID:27862862\|PMID:28492532\|PMID:28624954\|PMID:30087384\|PMID:31942422\|PMID:32985417\|PMID:33057194\|PMID:34308104\|PMID:35524774\|PMID:35982159\|PMID:39086472
Map2k1	Rat	RASopathy		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: RASopathy \| ClinVar Annotator: match by term: rasopathies	ClinVar	PMID:12370306\|PMID:12612583\|PMID:15917206\|PMID:16439621\|PMID:16538226\|PMID:17366577\|PMID:17551924\|PMID:17567882\|PMID:17576681\|PMID:17704260\|PMID:17981815\|PMID:18039235\|PMID:1804226\|PMID:18042262\|PMID:18060073\|PMID:18413255\|PMID:18632602\|PMID:18854871\|PMID:19156172\|PMID:19344873\|PMID:19376813\|PMID:19411838\|PMID:19915144\|PMID:20301365\|PMID:20354455\|PMID:21062266\|PMID:22177953\|PMID:22197931\|PMID:22327936\|PMID:22588879\|PMID:22848035\|PMID:23093928\|PMID:23321623\|PMID:24033266\|PMID:24101678\|PMID:24236184\|PMID:24637312\|PMID:25049390\|PMID:25157968\|PMID:25326635\|PMID:25423878\|PMID:25741868\|PMID:25741869\|PMID:26350204\|PMID:26619011\|PMID:26795593\|PMID:27862862\|PMID:28049852\|PMID:28492532\|PMID:28955999\|PMID:29402968\|PMID:30763456\|PMID:31487502\|PMID:31942422\|PMID:9536098
Map2k1	Rat	RASopathy		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: RASopathy \| ClinVar Annotator: match by term: rasopathies	ClinVar	PMID:10502786\|PMID:12370306\|PMID:12612583\|PMID:1430233\|PMID:15917206\|PMID:16199547\|PMID:16439621\|PMID:16450583\|PMID:16538226\|PMID:17366577\|PMID:17551924\|PMID:17567882\|PMID:17576681\|PMID:17704260\|PMID:17981815\|PMID:18039235\|PMID:1804226\|PMID:18042262\|PMID:18060073\|PMID:18413255\|PMID:18456719\|PMID:18632602\|PMID:18854871\|PMID:19156172\|PMID:19344873\|PMID:19376813\|PMID:19411838\|PMID:19915144\|PMID:20301365\|PMID:20354455\|PMID:21062266\|PMID:22177953\|PMID:22197931\|PMID:22327936\|PMID:22848035\|PMID:23093928\|PMID:23321623\|PMID:23569304\|PMID:24033266\|PMID:24101678\|PMID:24236184\|PMID:24458522\|PMID:24637312\|PMID:24803665\|PMID:24982505\|PMID:25049390\|PMID:25241384\|PMID:25326635\|PMID:25344691\|PMID:25423878\|PMID:25640679\|PMID:25741868\|PMID:25741869\|PMID:26343583\|PMID:26350204\|PMID:26607044\|PMID:26795593\|PMID:26918529\|PMID:27862862\|PMID:28049852\|PMID:28492532\|PMID:28624954\|PMID:28955999\|PMID:29402968\|PMID:29696744\|PMID:29753091\|PMID:29907801\|PMID:30087384\|PMID:30141192\|PMID:30763456\|PMID:31040167\|PMID:31487502\|PMID:31942422\|PMID:31972311\|PMID:32005694\|PMID:32978145\|PMID:32985417\|PMID:33057194\|PMID:33482860\|PMID:33502061\|PMID:34006472\|PMID:34308104\|PMID:34589056\|PMID:35322241\|PMID:35524774\|PMID:35982159\|PMID:39086472\|PMID:9536098
Map2k1	Rat	RASopathy		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: RASopathy \| ClinVar Annotator: match by term: rasopathies	ClinVar	PMID:12370306\|PMID:12612583\|PMID:15917206\|PMID:16199547\|PMID:16439621\|PMID:16538226\|PMID:17366577\|PMID:17551924\|PMID:17567882\|PMID:17576681\|PMID:17704260\|PMID:17981815\|PMID:18039235\|PMID:1804226\|PMID:18042262\|PMID:18060073\|PMID:18413255\|PMID:18456719\|PMID:18632602\|PMID:18854871\|PMID:19156172\|PMID:19344873\|PMID:19376813\|PMID:19411838\|PMID:19915144\|PMID:20301365\|PMID:20354455\|PMID:21062266\|PMID:21107320\|PMID:22177953\|PMID:22197931\|PMID:22327936\|PMID:22588879\|PMID:22848035\|PMID:23093928\|PMID:23321623\|PMID:23569304\|PMID:24033266\|PMID:24101678\|PMID:24236184\|PMID:24458522\|PMID:24637312\|PMID:24803665\|PMID:24982505\|PMID:25049390\|PMID:25157968\|PMID:25326635\|PMID:25344691\|PMID:25423878\|PMID:25640679\|PMID:25741868\|PMID:25741869\|PMID:26343583\|PMID:26350204\|PMID:26607044\|PMID:26619011\|PMID:26795593\|PMID:26918529\|PMID:27862862\|PMID:28049852\|PMID:28492532\|PMID:28955999\|PMID:29402968\|PMID:29696744\|PMID:29753091\|PMID:29907801\|PMID:30087384\|PMID:30141192\|PMID:30763456\|PMID:31487502\|PMID:31942422\|PMID:31972311\|PMID:32005694\|PMID:32978145\|PMID:33482860\|PMID:33502061\|PMID:34006472\|PMID:34308104\|PMID:9536098
Map2k1	Rat	RASopathy		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: RASopathy	ClinVar	PMID:12370306\|PMID:12612583\|PMID:15917206\|PMID:16439621\|PMID:16538226\|PMID:17366577\|PMID:17551924\|PMID:17567882\|PMID:17576681\|PMID:17704260\|PMID:17981815\|PMID:18039235\|PMID:1804226\|PMID:18042262\|PMID:18060073\|PMID:18413255\|PMID:18632602\|PMID:18854871\|PMID:19156172\|PMID:19344873\|PMID:19376813\|PMID:19411838\|PMID:19915144\|PMID:20301365\|PMID:20354455\|PMID:21062266\|PMID:22177953\|PMID:22197931\|PMID:22327936\|PMID:22588879\|PMID:22848035\|PMID:23093928\|PMID:23321623\|PMID:24033266\|PMID:24101678\|PMID:24236184\|PMID:24637312\|PMID:25049390\|PMID:25157968\|PMID:25326635\|PMID:25423878\|PMID:25741868\|PMID:25741869\|PMID:26350204\|PMID:26619011\|PMID:26795593\|PMID:27862862\|PMID:28049852\|PMID:28492532\|PMID:28955999\|PMID:29402968\|PMID:30087384\|PMID:30763456\|PMID:31487502\|PMID:31942422\|PMID:9536098
Map2k1	Rat	spermatogenic failure 57		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Male infertility with azoospermia or oligozoospermia due to single gene more ...	ClinVar	PMID:29493581
Map2k1	Rat	Sturge-Weber syndrome		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Parkes Weber syndrome	ClinVar	PMID:25741868
Map2k1	Rat	Vascular Malformations		ISO	MAP2K1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Vascular malformation	ClinVar	PMID:18632602\|PMID:25741868\|PMID:29643386\|PMID:39434542

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Map2k1	Rat	brain ischemia		ISO	MAP2K1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:17901229
Map2k1	Rat	cardiofaciocutaneous syndrome		ISO	MAP2K1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:16439621\|PMID:17703371
Map2k1	Rat	congestive heart failure		ISO	MAP2K1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:36071497
Map2k1	Rat	Costello syndrome		ISO	MAP2K1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:17703371
Map2k1	Rat	Familial Prostate Cancer		ISO	MAP2K1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:29892016
Map2k1	Rat	hairy cell leukemia		ISO	MAP2K1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:24241536
Map2k1	Rat	lung adenocarcinoma		ISO	MAP2K1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:22135231
Map2k1	Rat	melanoma		ISO	MAP2K1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:22197931
Map2k1	Rat	melorheostosis		ISO	MAP2K1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD
Map2k1	Rat	Noonan syndrome		ISO	MAP2K1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:17703371
Map2k1	Rat	Prostatic Neoplasms		ISO	MAP2K1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:32512071

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Map2k1	Rat	cardiofaciocutaneous syndrome		ISS	Map2k1 (Mus musculus)	13592920		MouseDO

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Map2k1	Rat	cardiofaciocutaneous syndrome 3		ISO	MAP2K1 (Homo sapiens)	7240710		OMIM
Map2k1	Rat	melorheostosis		ISO	MAP2K1 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Map2k1	Rat	(+)-catechin	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Catechin results in decreased expression of MAP2K1 mRNA; Catechin results in decreased expression of MAP2K1 more ...	CTD	PMID:15465739
Map2k1	Rat	(+)-catechin	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	Catechin inhibits the reaction [[4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone co-treated with Benzo(a)pyrene] results in increased phosphorylation of MAP2K1 protein]	CTD	PMID:21882252
Map2k1	Rat	(+)-catechin	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Catechin results in increased expression of MAP2K1 mRNA	CTD	PMID:15465739
Map2k1	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of MAP2K1 mRNA]	CTD	PMID:31150632
Map2k1	Rat	(20R)-protopanaxadiol	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	protopanaxadiol results in increased expression of MAP2K1 mRNA	CTD	PMID:31805304
Map2k1	Rat	(Z)-PUGNAc	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[N-acetylglucosaminono-1,5-lactone O-(phenylcarbamoyl)oxime co-treated with 2-(1H-indazol-4-yl)-6-(4-methanesulfonylpiperazin-1-ylmethyl)-4-morpholin-4-ylthieno(3,2-d)pyrimidine] results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:23029544
Map2k1	Rat	1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane	increases expression	ISO	Map2k1 (Mus musculus)	6480464	2,2-bis(4-hydroxyphenyl)-1,1,1-trichloroethane results in increased expression of MAP2K1 mRNA	CTD	PMID:25575267
Map2k1	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MAP2K1 mRNA	CTD	PMID:22206623
Map2k1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Map2k1 (Mus musculus)	6480464	1,2-Dimethylhydrazine results in decreased expression of MAP2K1 mRNA	CTD	PMID:22206623
Map2k1	Rat	1-(5-isoquinolinesulfonyl)-2-methylpiperazine	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	[1-(5-Isoquinolinesulfonyl)-2-Methylpiperazine co-treated with TNF protein] results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:14654170
Map2k1	Rat	1-(5-isoquinolinesulfonyl)-2-methylpiperazine	decreases phosphorylation	ISO	Map2k1 (Mus musculus)	6480464	1-(5-Isoquinolinesulfonyl)-2-Methylpiperazine results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:14654170
Map2k1	Rat	1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile	increases expression	EXP		6480464	Citalopram results in increased expression of MAP2K1 mRNA	CTD	PMID:28467792
Map2k1	Rat	17alpha-ethynylestradiol	affects expression	ISO	Map2k1 (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of MAP2K1 mRNA	CTD	PMID:17555576
Map2k1	Rat	17alpha-ethynylestradiol	increases expression	EXP		6480464	Ethinyl Estradiol results in increased expression of MAP2K1 mRNA	CTD	PMID:17108234
Map2k1	Rat	17beta-estradiol	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	ESR1 protein promotes the reaction [Estradiol results in increased expression of MAP2K1 mRNA]	CTD	PMID:25210133
Map2k1	Rat	17beta-estradiol	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	IGF1R mutant form inhibits the reaction [Estradiol results in increased expression of MAP2K1 mRNA]	CTD	PMID:23094148
Map2k1	Rat	17beta-estradiol	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Estradiol results in increased expression of MAP2K1 mRNA	CTD	PMID:12154049\|PMID:23094148
Map2k1	Rat	17beta-estradiol	affects expression	ISO	MAP2K1 (Homo sapiens)	6480464	Estradiol affects the expression of MAP2K1 mRNA	CTD	PMID:22574217
Map2k1	Rat	17beta-estradiol	affects expression	ISO	Map2k1 (Mus musculus)	6480464	Estradiol affects the expression of MAP2K1 mRNA	CTD	PMID:15598610
Map2k1	Rat	17beta-estradiol	increases activity	ISO	MAP2K1 (Homo sapiens)	6480464	Estradiol results in increased activity of MAP2K1 protein	CTD	PMID:15615701
Map2k1	Rat	17beta-estradiol	increases expression	ISO	Map2k1 (Mus musculus)	6480464	Estradiol results in increased expression of MAP2K1 mRNA	CTD	PMID:14664709\|PMID:25210133\|PMID:25575267
Map2k1	Rat	17beta-estradiol 3-benzoate	decreases phosphorylation	EXP		6480464	estradiol 3-benzoate results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:15778002
Map2k1	Rat	17beta-hydroxy-5alpha-androstan-3-one	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Dihydrotestosterone results in increased phosphorylation of and results in increased activity more ...	CTD	PMID:15466214
Map2k1	Rat	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of MAP2K1 protein	CTD	PMID:31675489
Map2k1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases activity	ISO	MAP2K1 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin results in increased activity of MAP2K1 protein	CTD	PMID:15313166
Map2k1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Map2k1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of MAP2K1 mRNA	CTD	PMID:21570461
Map2k1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	MAP2K1 protein promotes the reaction [Tetrachlorodibenzodioxin promotes the reaction [AHR protein modified form binds to more ...	CTD	PMID:12213569\|PMID:12758056\|PMID:20450880
Map2k1	Rat	2,4,6-tribromophenol	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	2,4,6-tribromophenol results in decreased expression of MAP2K1 mRNA	CTD	PMID:31675489
Map2k1	Rat	2,5-dimethylcelecoxib	decreases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	2,5-dimethylcelecoxib results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:16123214
Map2k1	Rat	2,5-dimethylcelecoxib	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	2,5-dimethylcelecoxib inhibits the reaction [IL6 protein results in increased phosphorylation of MAP2K1 protein]	CTD	PMID:16123214
Map2k1	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2,6-dinitrotoluene affects the expression of MAP2K1 mRNA	CTD	PMID:21346803
Map2k1	Rat	2-aminobiphenyl	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	MAP2K1 protein promotes the reaction [2-aminodiphenyl results in increased expression of PTGS2 protein]	CTD	PMID:22288910
Map2k1	Rat	2-arachidonoylglycerol	multiple interactions	EXP		6480464	2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [glyceryl 2-arachidonate results in increased phosphorylation of and results in increased more ...	CTD	PMID:12657697
Map2k1	Rat	2-methylcholine	affects expression	ISO	MAP2K1 (Homo sapiens)	6480464	beta-methylcholine affects the expression of MAP2K1 mRNA	CTD	PMID:21179406
Map2k1	Rat	3',5'-cyclic GMP	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	Cyclic GMP affects the reaction [NPPA protein alternative form results in decreased phosphorylation of and more ...	CTD	PMID:18225537
Map2k1	Rat	3',5'-cyclic GMP	decreases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Cyclic GMP results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:18225537
Map2k1	Rat	3,3',5,5'-tetrabromobisphenol A	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	tetrabromobisphenol A results in decreased expression of MAP2K1 protein	CTD	PMID:31675489
Map2k1	Rat	3,7-dihydropurine-6-thione	decreases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Mercaptopurine results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:12697733
Map2k1	Rat	3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	bisindolylmaleimide I inhibits the reaction [lead acetate results in increased phosphorylation of and results in more ...	CTD	PMID:11861786
Map2k1	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	EXP		6480464	[FSHB protein co-treated with 1-Methyl-3-isobutylxanthine] inhibits the reaction [Testosterone promotes the reaction [RAF1 results in more ...	CTD	PMID:21177760
Map2k1	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	[Colforsin co-treated with 1-Methyl-3-isobutylxanthine] results in increased phosphorylation of MAP2K1 protein; alisol B promotes the more ...	CTD	PMID:28051915
Map2k1	Rat	3-methylcholanthrene	increases expression	ISO	Map2k1 (Mus musculus)	6480464	Methylcholanthrene results in increased expression of MAP2K1 mRNA	CTD	PMID:25926378
Map2k1	Rat	3H-1,2-dithiole-3-thione	decreases expression	EXP		6480464	1,2-dithiol-3-thione results in decreased expression of MAP2K1 mRNA	CTD	PMID:19162173
Map2k1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	bisphenol S results in increased expression of MAP2K1 protein	CTD	PMID:34186270
Map2k1	Rat	4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone co-treated with Benzo(a)pyrene] results in increased phosphorylation of MAP2K1 protein; Catechin inhibits the reaction more ...	CTD	PMID:21882252
Map2k1	Rat	5-(2-methylpiperazine-1-sulfonyl)isoquinoline	decreases phosphorylation	ISO	Map2k1 (Mus musculus)	6480464	1-(5-Isoquinolinesulfonyl)-2-Methylpiperazine results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:14654170
Map2k1	Rat	5-(2-methylpiperazine-1-sulfonyl)isoquinoline	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	[1-(5-Isoquinolinesulfonyl)-2-Methylpiperazine co-treated with TNF protein] results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:14654170
Map2k1	Rat	5-aza-2'-deoxycytidine	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Decitabine results in increased expression of MAP2K1 mRNA	CTD	PMID:17785578
Map2k1	Rat	5-fluorouracil	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[U 0126 results in decreased activity of MAP2K1 protein] results in increased susceptibility to [Fluorouracil more ...	CTD	PMID:21444628
Map2k1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of MAP2K1 mRNA	CTD	PMID:30047161
Map2k1	Rat	9-cis,11-trans-octadecadienoic acid	multiple interactions	EXP		6480464	[cis-9, trans-11-conjugated linoleic acid co-treated with trans-10,cis-12-conjugated linoleic acid] results in increased phosphorylation of and more ...	CTD	PMID:17869086
Map2k1	Rat	acetylsalicylic acid	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Aspirin results in increased expression of MAP2K1 mRNA	CTD	PMID:20457246
Map2k1	Rat	acrolein	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ...	CTD	PMID:32699268
Map2k1	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of MAP2K1 mRNA	CTD	PMID:28959563
Map2k1	Rat	adenosine	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Adenosine results in increased phosphorylation of MAP2K1 protein	CTD	PMID:34070360
Map2k1	Rat	afimoxifene	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	afimoxifene results in increased expression of MAP2K1 mRNA	CTD	PMID:12154049
Map2k1	Rat	aflatoxin B1	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Aflatoxin B1 results in increased expression of MAP2K1 mRNA	CTD	PMID:27153756\|PMID:34396909
Map2k1	Rat	aflatoxin B1	increases methylation	ISO	MAP2K1 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of MAP2K1 intron	CTD	PMID:30157460
Map2k1	Rat	Alisol B	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	alisol B promotes the reaction [[Colforsin co-treated with 1-Methyl-3-isobutylxanthine] results in increased phosphorylation of MAP2K1 more ...	CTD	PMID:28051915
Map2k1	Rat	all-trans-retinoic acid	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [arsenic trioxide promotes the reaction [Tretinoin results in increased phosphorylation of more ...	CTD	PMID:18098270\|PMID:20615082
Map2k1	Rat	all-trans-retinoic acid	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Tretinoin results in increased phosphorylation of MAP2K1 protein	CTD	PMID:19038232
Map2k1	Rat	all-trans-retinoic acid	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Tretinoin results in decreased expression of MAP2K1 protein	CTD	PMID:18098270
Map2k1	Rat	all-trans-retinol	multiple interactions	EXP		6480464	6-hydroxy-2,5,7,8-tetramethylchroman-2-carboxylic acid inhibits the reaction [Vitamin A results in increased phosphorylation of MAP2K1 protein]; AG more ...	CTD	PMID:16510265
Map2k1	Rat	all-trans-retinol	increases phosphorylation	EXP		6480464	Vitamin A results in increased phosphorylation of MAP2K1 protein	CTD	PMID:16510265
Map2k1	Rat	alpha-mangostin	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	mangostin analog results in increased phosphorylation of MAP2K1 protein	CTD	PMID:28722351
Map2k1	Rat	alpha-pinene	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ...	CTD	PMID:32699268
Map2k1	Rat	amiodarone	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	MAP2K1 protein inhibits the reaction [Amiodarone results in decreased expression of SNAI1 protein]	CTD	PMID:26515726
Map2k1	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of MAP2K1 mRNA	CTD	PMID:30047161
Map2k1	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of MAP2K1 mRNA	CTD	PMID:16483693
Map2k1	Rat	ammonium chloride	increases expression	EXP		6480464	Ammonium Chloride results in increased expression of MAP2K1 mRNA	CTD	PMID:12420312
Map2k1	Rat	Ammothamnine	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	MAP2K1 protein inhibits the reaction [oxymatrine results in decreased phosphorylation of MAPK1 protein]; MAP2K1 protein more ...	CTD	PMID:39419199
Map2k1	Rat	amsacrine	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	MAP2K1 protein inhibits the reaction [Amsacrine results in decreased phosphorylation of MAPK1 protein]; MAP2K1 protein more ...	CTD	PMID:37451322
Map2k1	Rat	anandamide	multiple interactions	EXP		6480464	2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [anandamide results in increased phosphorylation of and results in increased activity more ...	CTD	PMID:12657697
Map2k1	Rat	anethole	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	anethole inhibits the reaction [TNF protein results in increased activity of MAP2K1 protein]	CTD	PMID:10871845
Map2k1	Rat	anthranilic acid	decreases activity	ISO	MAP2K1 (Homo sapiens)	6480464	anthranilic acid results in decreased activity of MAP2K1 protein	CTD	PMID:18393446
Map2k1	Rat	antimonite	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[Antimony Potassium Tartrate results in increased abundance of antimonite] which results in increased expression of more ...	CTD	PMID:32076005
Map2k1	Rat	Antrocin	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	antrocin analog results in decreased expression of MAP2K1 protein	CTD	PMID:36565974
Map2k1	Rat	Antrocin	decreases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	antrocin analog results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:36565974
Map2k1	Rat	arachidonic acid	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	FOS protein affects the reaction [MAP2K1 protein inhibits the reaction [Arachidonic Acid results in increased more ...	CTD	PMID:19720122
Map2k1	Rat	Aroclor 1254	decreases expression	ISO	Map2k1 (Mus musculus)	6480464	Chlorodiphenyl (54% Chlorine) results in decreased expression of MAP2K1 mRNA	CTD	PMID:23650126
Map2k1	Rat	arsane	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Map2k1	Rat	arsenic acid	increases activity	ISO	MAP2K1 (Homo sapiens)	6480464	arsenic acid results in increased activity of MAP2K1 protein	CTD	PMID:14674888
Map2k1	Rat	arsenic atom	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Map2k1	Rat	arsenite(3-)	increases activity	ISO	MAP2K1 (Homo sapiens)	6480464	arsenite results in increased activity of MAP2K1 protein	CTD	PMID:14674888
Map2k1	Rat	arsenous acid	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of MAP2K1 mRNA	CTD	PMID:22521957
Map2k1	Rat	arsenous acid	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Arsenic Trioxide promotes the reaction [Tretinoin results in increased phosphorylation of more ...	CTD	PMID:20615082
Map2k1	Rat	arsenous acid	decreases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Arsenic Trioxide results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:20592496
Map2k1	Rat	arsenous acid	decreases phosphorylation	ISO	Map2k1 (Mus musculus)	6480464	Arsenic Trioxide results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:28454374
Map2k1	Rat	arsenous acid	decreases activity	ISO	MAP2K1 (Homo sapiens)	6480464	Arsenic Trioxide results in decreased activity of MAP2K1 protein	CTD	PMID:11304686
Map2k1	Rat	ATP	affects binding	ISO	Map2k1 (Mus musculus)	6480464	Adenosine Triphosphate binds to MAP2K1 protein	CTD	PMID:17693661
Map2k1	Rat	atrazine	decreases expression	EXP		6480464	Atrazine results in decreased expression of MAP2K1 mRNA	CTD	PMID:30580161
Map2k1	Rat	azathioprine	decreases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Azathioprine results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:12697733
Map2k1	Rat	benzo[a]pyrene	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	AHR protein affects the reaction [Benzo(a)pyrene affects the expression of MAP2K1 mRNA]	CTD	PMID:22228805
Map2k1	Rat	benzo[a]pyrene	affects methylation	ISO	MAP2K1 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of MAP2K1 intron	CTD	PMID:30157460
Map2k1	Rat	benzo[a]pyrene	increases methylation	ISO	MAP2K1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of MAP2K1 promoter	CTD	PMID:27901495
Map2k1	Rat	benzo[a]pyrene	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone co-treated with Benzo(a)pyrene] results in increased phosphorylation of MAP2K1 protein; Catechin inhibits the reaction more ...	CTD	PMID:21882252
Map2k1	Rat	benzo[a]pyrene	increases expression	ISO	Map2k1 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of MAP2K1 mRNA	CTD	PMID:22228805
Map2k1	Rat	beryllium difluoride	increases phosphorylation	ISO	Map2k1 (Mus musculus)	6480464	beryllium fluoride results in increased phosphorylation of MAP2K1 protein	CTD	PMID:11867686
Map2k1	Rat	bicalutamide	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [bicalutamide results in increased phosphorylation of and results in increased activity more ...	CTD	PMID:15466214
Map2k1	Rat	bis(2-chloroethyl) sulfide	increases expression	ISO	Map2k1 (Mus musculus)	6480464	Mustard Gas results in increased expression of MAP2K1 mRNA	CTD	PMID:18955075
Map2k1	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	EXP		6480464	Zinc inhibits the reaction [Diethylhexyl Phthalate results in decreased phosphorylation of MAP2K1 protein]	CTD	PMID:35841924
Map2k1	Rat	bis(2-ethylhexyl) phthalate	decreases phosphorylation	EXP		6480464	Diethylhexyl Phthalate results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:35841924
Map2k1	Rat	bisphenol A	increases expression	ISO	Map2k1 (Mus musculus)	6480464	bisphenol A results in increased expression of MAP2K1 mRNA	CTD	PMID:25575267\|PMID:33221593
Map2k1	Rat	bisphenol A	decreases methylation	ISO	MAP2K1 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of MAP2K1 gene	CTD	PMID:31601247
Map2k1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of MAP2K1 mRNA	CTD	PMID:30816183\|PMID:32528016\|PMID:34947998\|PMID:38750585
Map2k1	Rat	bisphenol A	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	bisphenol A results in decreased expression of MAP2K1 mRNA; bisphenol A results in decreased expression more ...	CTD	PMID:29275510\|PMID:31675489
Map2k1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of MAP2K1 mRNA	CTD	PMID:25181051
Map2k1	Rat	bisphenol AF	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	bisphenol AF results in increased expression of MAP2K1 protein	CTD	PMID:34186270
Map2k1	Rat	Bisphenol B	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	bisphenol B results in increased expression of MAP2K1 protein	CTD	PMID:34186270
Map2k1	Rat	bortezomib	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[Bortezomib co-treated with Butyrates] results in decreased expression of MAP2K1 protein; [Bortezomib co-treated with vorinostat] more ...	CTD	PMID:12893773
Map2k1	Rat	cadmium acetate	affects expression	EXP		6480464	cadmium acetate affects the expression of MAP2K1 mRNA	CTD	PMID:16249259
Map2k1	Rat	cadmium atom	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Cadmium results in increased phosphorylation of MAP2K1 protein	CTD	PMID:14499349
Map2k1	Rat	cadmium atom	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	GPER1 mutant form inhibits the reaction [Cadmium results in increased activity of MAP2K1 protein]; MAP2K1 more ...	CTD	PMID:20153348\|PMID:25069788
Map2k1	Rat	cadmium atom	increases activity	ISO	MAP2K1 (Homo sapiens)	6480464	Cadmium results in increased activity of MAP2K1 protein	CTD	PMID:20153348
Map2k1	Rat	cadmium dichloride	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	1,2-bis(2-aminophenoxy)ethane N,N,N',N'-tetraacetic acid acetoxymethyl ester inhibits the reaction [Cadmium Chloride results in increased phosphorylation of more ...	CTD	PMID:11858940
Map2k1	Rat	cadmium dichloride	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of MAP2K1 mRNA	CTD	PMID:32512071
Map2k1	Rat	cadmium dichloride	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Cadmium Chloride results in increased phosphorylation of MAP2K1 protein	CTD	PMID:18703135
Map2k1	Rat	cadmium dichloride	increases phosphorylation	EXP		6480464	Cadmium Chloride results in increased phosphorylation of MAP2K1 protein	CTD	PMID:18703135
Map2k1	Rat	cadmium dichloride	multiple interactions	EXP		6480464	Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased phosphorylation of MAP2K1 protein]	CTD	PMID:18703135
Map2k1	Rat	cadmium dichloride	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased phosphorylation of MAP2K1 protein]	CTD	PMID:18703135
Map2k1	Rat	cadmium dichloride	increases phosphorylation	ISO	Map2k1 (Mus musculus)	6480464	Cadmium Chloride results in increased phosphorylation of MAP2K1 protein	CTD	PMID:11858940
Map2k1	Rat	calcium atom	multiple interactions	EXP		6480464	[Sumatriptan results in increased abundance of Calcium] inhibits the reaction [MAP2K1 protein results in increased more ...	CTD	PMID:12574409
Map2k1	Rat	calcium(0)	multiple interactions	EXP		6480464	[Sumatriptan results in increased abundance of Calcium] inhibits the reaction [MAP2K1 protein results in increased more ...	CTD	PMID:12574409
Map2k1	Rat	cannabidiol	affects methylation	EXP		6480464	Cannabidiol affects the methylation of MAP2K1 gene	CTD	PMID:30521419
Map2k1	Rat	cannabidiol	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[Cannabidiol co-treated with moringin] results in increased expression of MAP2K1 mRNA; [Oxygen co-treated with Ozone more ...	CTD	PMID:30096889\|PMID:32992648
Map2k1	Rat	cannabidiol	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Cannabidiol results in decreased expression of MAP2K1 mRNA	CTD	PMID:32992648
Map2k1	Rat	capsaicin	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Capsaicin results in increased expression of MAP2K1 mRNA	CTD	PMID:19502594
Map2k1	Rat	carbon nanotube	increases expression	ISO	Map2k1 (Mus musculus)	6480464	Nanotubes, Carbon analog results in increased expression of MAP2K1 mRNA; Nanotubes, Carbon results in increased more ...	CTD	PMID:25554681
Map2k1	Rat	celecoxib	decreases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Celecoxib results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:16123214
Map2k1	Rat	chenodeoxycholic acid	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ...	CTD	PMID:32152650
Map2k1	Rat	chloropicrin	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	chloropicrin results in decreased expression of MAP2K1 mRNA	CTD	PMID:28476498
Map2k1	Rat	chlorpyrifos	decreases expression	EXP		6480464	Chlorpyrifos results in decreased expression of MAP2K1 mRNA	CTD	PMID:18668222
Map2k1	Rat	choline	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	Choline inhibits the reaction [Sodium Fluoride results in decreased expression of MAP2K1 mRNA]	CTD	PMID:27664006
Map2k1	Rat	choline	increases expression	ISO	Map2k1 (Mus musculus)	6480464	Choline results in increased expression of MAP2K1 mRNA	CTD	PMID:27664006
Map2k1	Rat	cisplatin	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[Cisplatin co-treated with Quercetin] results in increased expression of MAP2K1 mRNA; [U 0126 results in more ...	CTD	PMID:21444628\|PMID:27514524
Map2k1	Rat	cisplatin	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	MAP2K1 protein promotes the reaction [Cisplatin results in increased activity of CASP3 protein]; MAP2K1 protein more ...	CTD	PMID:20547441
Map2k1	Rat	cisplatin	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Cisplatin results in increased phosphorylation of MAP2K1 protein	CTD	PMID:21444628
Map2k1	Rat	citalopram	increases expression	EXP		6480464	Citalopram results in increased expression of MAP2K1 mRNA	CTD	PMID:28467792
Map2k1	Rat	clobetasol	increases expression	ISO	Map2k1 (Mus musculus)	6480464	Clobetasol results in increased expression of MAP2K1 mRNA	CTD	PMID:27462272
Map2k1	Rat	clozapine	decreases expression	EXP		6480464	Clozapine results in decreased expression of MAP2K1 mRNA	CTD	PMID:15860345
Map2k1	Rat	cobalt dichloride	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one results in decreased activity of MAP2K1 protein] inhibits the reaction [cobaltous chloride results in more ...	CTD	PMID:14536030
Map2k1	Rat	cobalt dichloride	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	cobaltous chloride results in increased expression of MAP2K1 mRNA	CTD	PMID:19376846
Map2k1	Rat	cobalt dichloride	increases expression	EXP		6480464	cobaltous chloride results in increased expression of MAP2K1 mRNA	CTD	PMID:24386269
Map2k1	Rat	cocaine	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Cocaine results in decreased expression of MAP2K1 mRNA	CTD	PMID:12629581
Map2k1	Rat	cocaine	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	CDK5R1 protein inhibits the reaction [Cocaine results in increased phosphorylation of MAP2K1 protein]	CTD	PMID:15665076
Map2k1	Rat	cocaine	increases phosphorylation	ISO	Map2k1 (Mus musculus)	6480464	Cocaine results in increased phosphorylation of MAP2K1 protein	CTD	PMID:15665076
Map2k1	Rat	colforsin daropate hydrochloride	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	[Colforsin co-treated with 1-Methyl-3-isobutylxanthine] results in increased phosphorylation of MAP2K1 protein; alisol B promotes the more ...	CTD	PMID:28051915
Map2k1	Rat	copper atom	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[Chelating Agents binds to Copper] which results in increased expression of MAP2K1 mRNA	CTD	PMID:30911355
Map2k1	Rat	copper(0)	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[Chelating Agents binds to Copper] which results in increased expression of MAP2K1 mRNA	CTD	PMID:30911355
Map2k1	Rat	copper(II) chloride	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	cupric chloride results in increased expression of MAP2K1 mRNA	CTD	PMID:38568856
Map2k1	Rat	copper(II) sulfate	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Copper Sulfate results in increased expression of MAP2K1 mRNA	CTD	PMID:19549813
Map2k1	Rat	copper(II) sulfate	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	4-((3-bromophenyl)amino)-6,7-dimethoxyquinazoline inhibits the reaction [Copper Sulfate results in increased phosphorylation of MAP2K1 protein]; Copper Sulfate more ...	CTD	PMID:10564177
Map2k1	Rat	cordycepin	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	cordycepin results in increased phosphorylation of MAP2K1 protein	CTD	PMID:34070360
Map2k1	Rat	corn oil	increases expression	ISO	Map2k1 (Mus musculus)	6480464	Corn Oil results in increased expression of MAP2K1 mRNA	CTD	PMID:33263755
Map2k1	Rat	corticosterone	multiple interactions	EXP		6480464	astragaloside VI inhibits the reaction [Corticosterone results in decreased expression of and results in decreased more ...	CTD	PMID:36559001
Map2k1	Rat	crocidolite asbestos	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	MAP2K1 protein affects the reaction [Asbestos, Crocidolite results in increased expression of SCGB1A1 mRNA]; MAP2K1 more ...	CTD	PMID:18192500
Map2k1	Rat	crocidolite asbestos	affects expression	ISO	MAP2K1 (Homo sapiens)	6480464	Asbestos, Crocidolite affects the expression of MAP2K1 mRNA	CTD	PMID:24160326
Map2k1	Rat	crocidolite asbestos	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Asbestos, Crocidolite results in increased phosphorylation of MAP2K1 protein	CTD	PMID:18314537
Map2k1	Rat	cumene	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	[cumene co-treated with KRAS gene mutant form] results in increased expression of MAP2K1 mRNA; [cumene more ...	CTD	PMID:18648096
Map2k1	Rat	curcumin	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	MAP2K1 protein inhibits the reaction [Curcumin inhibits the reaction [Mitomycin results in increased expression of more ...	CTD	PMID:21810436
Map2k1	Rat	cycloheximide	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Cycloheximide results in increased expression of MAP2K1 mRNA]	CTD	PMID:23237828
Map2k1	Rat	cycloheximide	increases activity	ISO	Map2k1 (Mus musculus)	6480464	Cycloheximide results in increased activity of MAP2K1 protein	CTD	PMID:23237828
Map2k1	Rat	cyclosporin A	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Cyclosporine results in increased expression of MAP2K1 mRNA	CTD	PMID:25562108
Map2k1	Rat	cyclosporin A	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ...	CTD	PMID:32152650
Map2k1	Rat	D-mannitol	multiple interactions	EXP		6480464	Mannitol inhibits the reaction [Vitamin A results in increased phosphorylation of MAP2K1 protein]	CTD	PMID:16510265
Map2k1	Rat	dabrafenib	decreases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	dabrafenib results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:38641160
Map2k1	Rat	dabrafenib	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	decabromobiphenyl ether inhibits the reaction [dabrafenib results in decreased phosphorylation of MAP2K1 protein]	CTD	PMID:38641160
Map2k1	Rat	daunorubicin	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	MAP2K1 protein inhibits the reaction [Daunorubicin results in decreased expression of SP1 protein]; MAP2K1 protein more ...	CTD	PMID:34963561
Map2k1	Rat	decabromodiphenyl ether	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	decabromobiphenyl ether results in increased phosphorylation of MAP2K1 protein	CTD	PMID:38641160
Map2k1	Rat	decabromodiphenyl ether	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	decabromobiphenyl ether inhibits the reaction [dabrafenib results in decreased phosphorylation of MAP2K1 protein]	CTD	PMID:38641160
Map2k1	Rat	deguelin	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	deguelin metabolite results in decreased expression of MAP2K1 protein; deguelin results in decreased expression of more ...	CTD	PMID:19139008\|PMID:19336726
Map2k1	Rat	deoxycholic acid	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ...	CTD	PMID:32152650
Map2k1	Rat	dexamethasone	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	Dexamethasone inhibits the reaction [EGF protein results in increased phosphorylation of MAP2K1 protein]; Mifepristone inhibits more ...	CTD	PMID:10807665
Map2k1	Rat	dexamethasone	increases expression	ISO	Map2k1 (Mus musculus)	6480464	Dexamethasone results in increased expression of MAP2K1 mRNA	CTD	PMID:21041162
Map2k1	Rat	diarsenic trioxide	decreases activity	ISO	MAP2K1 (Homo sapiens)	6480464	Arsenic Trioxide results in decreased activity of MAP2K1 protein	CTD	PMID:11304686
Map2k1	Rat	diarsenic trioxide	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of MAP2K1 mRNA	CTD	PMID:22521957
Map2k1	Rat	diarsenic trioxide	decreases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Arsenic Trioxide results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:20592496
Map2k1	Rat	diarsenic trioxide	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Arsenic Trioxide promotes the reaction [Tretinoin results in increased phosphorylation of more ...	CTD	PMID:20615082
Map2k1	Rat	diarsenic trioxide	decreases phosphorylation	ISO	Map2k1 (Mus musculus)	6480464	Arsenic Trioxide results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:28454374
Map2k1	Rat	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of MAP2K1 mRNA	CTD	PMID:21266533
Map2k1	Rat	dichlorine	multiple interactions	EXP		6480464	[Ozone co-treated with Chlorine] results in decreased expression of MAP2K1 mRNA	CTD	PMID:18636392
Map2k1	Rat	dichlorine	increases expression	EXP		6480464	Chlorine results in increased expression of MAP2K1 mRNA	CTD	PMID:18636392
Map2k1	Rat	dieldrin	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	Dieldrin results in increased phosphorylation of and results in increased activity of MAP2K1 protein	CTD	PMID:15888667
Map2k1	Rat	diethylstilbestrol	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Diethylstilbestrol results in increased expression of MAP2K1 mRNA	CTD	PMID:15766595
Map2k1	Rat	diethylstilbestrol	increases expression	ISO	Map2k1 (Mus musculus)	6480464	Diethylstilbestrol results in increased expression of MAP2K1 mRNA	CTD	PMID:16636312\|PMID:25575267
Map2k1	Rat	dimethyl sulfoxide	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Dimethyl Sulfoxide results in increased expression of MAP2K1 mRNA	CTD	PMID:31265865
Map2k1	Rat	dimethyl sulfoxide	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	cucurbitacin IIa inhibits the reaction [Dimethyl Sulfoxide results in increased expression of MAP2K1 mRNA]	CTD	PMID:31265865
Map2k1	Rat	dioxygen	increases response to substance	EXP		6480464	MAP2K1 protein results in increased susceptibility to Oxygen	CTD	PMID:10780954
Map2k1	Rat	dioxygen	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of MAP2K1 mRNA; [Oxygen more ...	CTD	PMID:32992648
Map2k1	Rat	dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[Antimony Potassium Tartrate results in increased abundance of antimonite] which results in increased expression of more ...	CTD	PMID:32076005
Map2k1	Rat	diquat	increases expression	ISO	Map2k1 (Mus musculus)	6480464	Diquat results in increased expression of MAP2K1 protein	CTD	PMID:36851058
Map2k1	Rat	disodium selenite	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Sodium Selenite results in decreased expression of MAP2K1 mRNA	CTD	PMID:16705456
Map2k1	Rat	diuron	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Diuron results in decreased expression of MAP2K1 mRNA	CTD	PMID:35967413
Map2k1	Rat	doxorubicin	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Doxorubicin results in increased phosphorylation of MAP2K1 protein	CTD	PMID:17974986
Map2k1	Rat	doxorubicin	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of MAP2K1 mRNA	CTD	PMID:29803840
Map2k1	Rat	doxorubicin	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one results in decreased activity of MAP2K1 protein] affects the reaction [SOD2 protein results in more ...	CTD	PMID:18594523
Map2k1	Rat	doxorubicin	increases phosphorylation	ISO	Map2k1 (Mus musculus)	6480464	Doxorubicin results in increased phosphorylation of MAP2K1 protein	CTD	PMID:17974986
Map2k1	Rat	emodin	multiple interactions	EXP		6480464	Emodin inhibits the reaction [PDGFB protein results in increased phosphorylation of MAP2K1 protein]	CTD	PMID:15288473
Map2k1	Rat	endosulfan	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	Endosulfan results in increased phosphorylation of and results in increased activity of MAP2K1 protein	CTD	PMID:15888667
Map2k1	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of MAP2K1 mRNA	CTD	PMID:29391264
Map2k1	Rat	escitalopram	increases expression	EXP		6480464	Escitalopram results in increased expression of MAP2K1 mRNA	CTD	PMID:28467792
Map2k1	Rat	estriol	increases expression	ISO	Map2k1 (Mus musculus)	6480464	Estriol results in increased expression of MAP2K1 mRNA	CTD	PMID:25575267
Map2k1	Rat	etacrynic acid	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Ethacrynic Acid results in increased expression of MAP2K1 protein	CTD	PMID:14556662
Map2k1	Rat	ethanol	affects expression	EXP		6480464	Ethanol affects the expression of MAP2K1 mRNA	CTD	PMID:11772933
Map2k1	Rat	ethanol	affects splicing	ISO	Map2k1 (Mus musculus)	6480464	Ethanol affects the splicing of MAP2K1 mRNA	CTD	PMID:30319688
Map2k1	Rat	ethanol	increases expression	EXP		6480464	Ethanol results in increased expression of MAP2K1 protein	CTD	PMID:23702218
Map2k1	Rat	ethanol	multiple interactions	EXP		6480464	N-methyl-N-(6-methoxy-1-phenyl-1,2,3,4-tetrahydronaphthalen-2-ylmethyl)aminomethylcarboxylic acid inhibits the reaction [Ethanol results in decreased expression of MAP2K1 mRNA]	CTD	PMID:20655511
Map2k1	Rat	ethanol	decreases expression	EXP		6480464	Ethanol results in decreased expression of MAP2K1 mRNA	CTD	PMID:20655511
Map2k1	Rat	ethyl methanesulfonate	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Ethyl Methanesulfonate results in decreased expression of MAP2K1 mRNA	CTD	PMID:23649840
Map2k1	Rat	fipronil	decreases activity	ISO	Map2k1 (Mus musculus)	6480464	fipronil results in decreased activity of MAP2K1 protein	CTD	PMID:21167920
Map2k1	Rat	flavonoids	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Flavonoids results in decreased expression of MAP2K1 mRNA	CTD	PMID:15465739
Map2k1	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of MAP2K1 mRNA	CTD	PMID:24136188
Map2k1	Rat	folic acid	decreases expression	ISO	Map2k1 (Mus musculus)	6480464	Folic Acid results in decreased expression of MAP2K1 mRNA	CTD	PMID:25629700
Map2k1	Rat	folic acid	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MAP2K1 mRNA	CTD	PMID:22206623
Map2k1	Rat	gallic acid	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[MAP2K1 protein modified form co-treated with AKT1 protein modified form] inhibits the reaction [Gallic Acid more ...	CTD	PMID:21420233\|PMID:27087131\|PMID:27634460
Map2k1	Rat	gamma-hexachlorocyclohexane	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	Hexachlorocyclohexane results in increased phosphorylation of and results in increased activity of MAP2K1 protein	CTD	PMID:15888667
Map2k1	Rat	geldanamycin	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	geldanamycin inhibits the reaction [Tetradecanoylphorbol Acetate results in increased activity of MAP2K1 protein]	CTD	PMID:8816498
Map2k1	Rat	geldanamycin	decreases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	geldanamycin results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:19167484
Map2k1	Rat	genistein	decreases phosphorylation	EXP		6480464	Genistein results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:15781664
Map2k1	Rat	genistein	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Genistein results in increased phosphorylation of MAP2K1 protein	CTD	PMID:19038232
Map2k1	Rat	geraniol	multiple interactions	EXP		6480464	geraniol inhibits the reaction [Methylnitronitrosoguanidine results in increased expression of MAP2K1 mRNA]	CTD	PMID:28428697
Map2k1	Rat	glycochenodeoxycholic acid	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ...	CTD	PMID:32152650
Map2k1	Rat	glycocholic acid	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ...	CTD	PMID:32152650
Map2k1	Rat	glycodeoxycholic acid	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ...	CTD	PMID:32152650
Map2k1	Rat	glyphosate	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Glyphosate results in decreased expression of MAP2K1 mRNA	CTD	PMID:31295307
Map2k1	Rat	gold atom	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	MAP2K1 inhibits the reaction [[Gallic Acid binds to Gold] inhibits the reaction [EGF protein results more ...	CTD	PMID:27634460
Map2k1	Rat	gold(0)	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	MAP2K1 inhibits the reaction [[Gallic Acid binds to Gold] inhibits the reaction [EGF protein results more ...	CTD	PMID:27634460
Map2k1	Rat	GSK-J4	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	GSK-J4 results in increased expression of MAP2K1 mRNA	CTD	PMID:29301935
Map2k1	Rat	haloperidol	decreases expression	EXP		6480464	Haloperidol results in decreased expression of MAP2K1 mRNA	CTD	PMID:15860345
Map2k1	Rat	heparin	multiple interactions	EXP		6480464	Heparin inhibits the reaction [FGF1 protein results in increased phosphorylation of MAP2K1 protein]; Heparin inhibits more ...	CTD	PMID:14966081
Map2k1	Rat	heptachlor	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	Heptachlor results in increased phosphorylation of and results in increased activity of MAP2K1 protein	CTD	PMID:15888667
Map2k1	Rat	heptachlor	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Heptachlor results in decreased expression of MAP2K1 protein	CTD	PMID:9704902
Map2k1	Rat	hyaluronic acid	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Hyaluronic Acid analog results in increased phosphorylation of MAP2K1 protein	CTD	PMID:12402308
Map2k1	Rat	hydrogen peroxide	increases activity	ISO	MAP2K1 (Homo sapiens)	6480464	Hydrogen Peroxide results in increased activity of MAP2K1 protein	CTD	PMID:15242773\|PMID:19038233
Map2k1	Rat	hydrogen peroxide	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	MAP2K1 protein affects the reaction [Hydrogen Peroxide results in increased expression of MMP9 mRNA]	CTD	PMID:26514923
Map2k1	Rat	hydroquinone	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	MAP2K1 protein inhibits the reaction [hydroquinone results in decreased phosphorylation of MAPK1 protein]; MAP2K1 protein more ...	CTD	PMID:23288922
Map2k1	Rat	indometacin	increases expression	EXP		6480464	Indomethacin results in increased expression of MAP2K1 mRNA	CTD	PMID:18299717
Map2k1	Rat	ionomycin	multiple interactions	EXP		6480464	Ionomycin inhibits the reaction [MAP2K1 protein results in increased expression of CALCA mRNA]	CTD	PMID:12574409
Map2k1	Rat	isoprenaline	multiple interactions	EXP		6480464	MAP2K1 protein affects the reaction [Isoproterenol results in increased expression of NPPA mRNA]; MAP2K1 protein more ...	CTD	PMID:10888249
Map2k1	Rat	isoprenaline	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	MAP2K1 protein promotes the reaction [Isoproterenol results in decreased expression of COL2A1 mRNA]; MAP2K1 protein more ...	CTD	PMID:21177286
Map2k1	Rat	ivermectin	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Ivermectin results in decreased expression of MAP2K1 protein	CTD	PMID:32959892
Map2k1	Rat	ketamine	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	Ketamine inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity more ...	CTD	PMID:19540866
Map2k1	Rat	lead diacetate	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	bisindolylmaleimide I inhibits the reaction [lead acetate results in increased phosphorylation of and results in more ...	CTD	PMID:11861786
Map2k1	Rat	lead(0)	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Lead results in increased phosphorylation of MAP2K1 protein	CTD	PMID:19133285
Map2k1	Rat	lead(0)	decreases expression	EXP		6480464	Lead results in decreased expression of MAP2K1 mRNA; Lead results in decreased expression of MAP2K1 more ...	CTD	PMID:24960059
Map2k1	Rat	letrozole	increases expression	ISO	Map2k1 (Mus musculus)	6480464	letrozole results in increased expression of MAP2K1 protein	CTD	PMID:15967659
Map2k1	Rat	lipopolysaccharide	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Lipopolysaccharides results in increased phosphorylation of MAP2K1 protein	CTD	PMID:19010997
Map2k1	Rat	lipopolysaccharide	increases phosphorylation	EXP		6480464	Lipopolysaccharides results in increased phosphorylation of MAP2K1 protein	CTD	PMID:21247645
Map2k1	Rat	lipopolysaccharide	multiple interactions	EXP		6480464	MAP2K1 protein promotes the reaction [Lipopolysaccharides results in increased expression of IL6 protein]; MAP2K1 protein more ...	CTD	PMID:10469353\|PMID:21247645
Map2k1	Rat	lipopolysaccharide	increases expression	ISO	Map2k1 (Mus musculus)	6480464	Lipopolysaccharides results in increased expression of MAP2K1 mRNA	CTD	PMID:10975854
Map2k1	Rat	lipopolysaccharide	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	[Lipopolysaccharides co-treated with IFNG protein] results in increased phosphorylation of MAP2K1 protein; Ketamine inhibits the more ...	CTD	PMID:19540866\|PMID:21295571\|PMID:23362215
Map2k1	Rat	lipopolysaccharide	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	MAP2K1 protein mutant form inhibits the reaction [Lipopolysaccharides results in increased expression of IL6 mRNA]	CTD	PMID:18209571
Map2k1	Rat	lipoteichoic acid	increases phosphorylation	ISO	Map2k1 (Mus musculus)	6480464	lipoteichoic acid results in increased phosphorylation of MAP2K1 protein	CTD	PMID:19573522
Map2k1	Rat	lipoteichoic acid	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	Propofol inhibits the reaction [lipoteichoic acid results in increased phosphorylation of MAP2K1 protein]	CTD	PMID:19573522
Map2k1	Rat	lithium atom	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	[Lithium results in increased phosphorylation of and results in increased activity of MAP3K8 protein] which more ...	CTD	PMID:19159680
Map2k1	Rat	lithium hydride	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	[Lithium results in increased phosphorylation of and results in increased activity of MAP3K8 protein] which more ...	CTD	PMID:19159680
Map2k1	Rat	lithocholic acid	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	MAP2K1 protein promotes the reaction [Lithocholic Acid results in increased expression of PLAUR mRNA]	CTD	PMID:19782465
Map2k1	Rat	LY294002	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	MAP2K1 protein inhibits the reaction [[2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one co-treated with fludarabine] results in increased cleavage of CASP3 more ...	CTD	PMID:15850772
Map2k1	Rat	LY294002	multiple interactions	EXP		6480464	2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [MAP2K1 protein results in increased activity of RPS6KB1 protein]; 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits more ...	CTD	PMID:12411397
Map2k1	Rat	lycopene	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	lycopene results in increased expression of MAP2K1 mRNA	CTD	PMID:16886892
Map2k1	Rat	Maduramicin	multiple interactions	EXP		6480464	MAP2K1 protein inhibits the reaction [maduramicin results in decreased phosphorylation of MAPK1 protein]; MAP2K1 protein more ...	CTD	PMID:29241734
Map2k1	Rat	Maduramicin	decreases response to substance	EXP		6480464	MAP2K1 protein results in decreased susceptibility to maduramicin	CTD	PMID:29241734
Map2k1	Rat	maneb	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	[Maneb co-treated with Paraquat] results in decreased expression of MAP2K1 mRNA; Melatonin inhibits the reaction more ...	CTD	PMID:23963992
Map2k1	Rat	manganese atom	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Map2k1	Rat	manganese(0)	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Map2k1	Rat	manganese(II) chloride	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Map2k1	Rat	melatonin	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in decreased expression of MAP2K1 mRNA]	CTD	PMID:23963992
Map2k1	Rat	mercaptopurine	decreases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Mercaptopurine results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:12697733
Map2k1	Rat	methamphetamine	increases expression	EXP		6480464	Methamphetamine results in increased expression of MAP2K1 protein	CTD	PMID:19826936
Map2k1	Rat	methamphetamine	decreases expression	ISO	Map2k1 (Mus musculus)	6480464	Methamphetamine results in decreased expression of MAP2K1 protein	CTD	PMID:16192988
Map2k1	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of MAP2K1 mRNA	CTD	PMID:30047161
Map2k1	Rat	methylmercury chloride	affects expression	ISO	Map2k1 (Mus musculus)	6480464	methylmercuric chloride affects the expression of MAP2K1 mRNA	CTD	PMID:21613230
Map2k1	Rat	methylseleninic acid	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	methylselenic acid results in decreased expression of MAP2K1 mRNA	CTD	PMID:11830524
Map2k1	Rat	methylseleninic acid	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	methylselenic acid results in increased expression of MAP2K1 mRNA	CTD	PMID:12517777
Map2k1	Rat	mifepristone	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	Mifepristone inhibits the reaction [Dexamethasone inhibits the reaction [EGF protein results in increased phosphorylation of more ...	CTD	PMID:10807665
Map2k1	Rat	mitomycin C	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	MAP2K1 protein inhibits the reaction [Curcumin inhibits the reaction [Mitomycin results in increased expression of more ...	CTD	PMID:21810436
Map2k1	Rat	mono(2-ethylhexyl) phthalate	decreases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	mono-(2-ethylhexyl)phthalate results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:35841924
Map2k1	Rat	mono(2-ethylhexyl) phthalate	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	Zinc inhibits the reaction [mono-(2-ethylhexyl)phthalate results in decreased phosphorylation of MAP2K1 protein]	CTD	PMID:35841924
Map2k1	Rat	monosodium L-glutamate	decreases expression	EXP		6480464	Sodium Glutamate results in decreased expression of MAP2K1 mRNA	CTD	PMID:28954212
Map2k1	Rat	myricetin	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	myricetin binds to and results in decreased activity of MAP2K1 protein; myricetin inhibits the reaction more ...	CTD	PMID:17693661
Map2k1	Rat	N-acetyl-L-cysteine	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased phosphorylation of MAP2K1 protein]	CTD	PMID:18703135
Map2k1	Rat	N-acetyl-L-cysteine	multiple interactions	EXP		6480464	Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased phosphorylation of MAP2K1 protein]	CTD	PMID:18703135
Map2k1	Rat	N-methyl-4-phenylpyridinium	increases expression	ISO	Map2k1 (Mus musculus)	6480464	1-Methyl-4-phenylpyridinium results in increased expression of MAP2K1 protein	CTD	PMID:26558463
Map2k1	Rat	N-methyl-N'-nitro-N-nitrosoguanidine	increases expression	EXP		6480464	Methylnitronitrosoguanidine results in increased expression of MAP2K1 mRNA	CTD	PMID:28428697
Map2k1	Rat	N-methyl-N'-nitro-N-nitrosoguanidine	multiple interactions	EXP		6480464	geraniol inhibits the reaction [Methylnitronitrosoguanidine results in increased expression of MAP2K1 mRNA]	CTD	PMID:28428697
Map2k1	Rat	N-methyl-N-nitrosourea	multiple interactions	EXP		6480464	Methylnitrosourea results in increased phosphorylation of and results in increased activity of MAP2K1 protein	CTD	PMID:12693035
Map2k1	Rat	N-Nitroso-N-methylurethane	multiple interactions	EXP		6480464	Nitrosomethylurethane results in increased phosphorylation of and results in increased activity of MAP2K1 protein	CTD	PMID:12693035
Map2k1	Rat	N-nitrosodiethylamine	affects phosphorylation	ISO	Map2k1 (Mus musculus)	6480464	Diethylnitrosamine affects the phosphorylation of MAP2K1 protein	CTD	PMID:24535843
Map2k1	Rat	N-nitrosomorpholine	increases expression	EXP		6480464	N-nitrosomorpholine results in increased expression of MAP2K1 protein	CTD	PMID:21411721
Map2k1	Rat	nefazodone	increases expression	EXP		6480464	nefazodone results in increased expression of MAP2K1 mRNA	CTD	PMID:24136188
Map2k1	Rat	nickel dichloride	affects expression	EXP		6480464	nickel chloride affects the expression of MAP2K1 mRNA	CTD	PMID:22110744
Map2k1	Rat	nitrates	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of MAP2K1 more ...	CTD	PMID:35964746
Map2k1	Rat	ochratoxin A	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	ochratoxin A results in increased phosphorylation of MAP2K1 protein	CTD	PMID:25002221
Map2k1	Rat	okadaic acid	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Okadaic Acid results in increased expression of MAP2K1 mRNA	CTD	PMID:38832940
Map2k1	Rat	oxybenzone	decreases expression	ISO	Map2k1 (Mus musculus)	6480464	oxybenzone results in decreased expression of MAP2K1 mRNA	CTD	PMID:39343157
Map2k1	Rat	ozone	multiple interactions	EXP		6480464	[Ozone co-treated with Chlorine] results in decreased expression of MAP2K1 mRNA	CTD	PMID:18636392
Map2k1	Rat	ozone	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ...	CTD	PMID:32699268\|PMID:32992648\|PMID:35430440
Map2k1	Rat	p-menthan-3-ol	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Menthol results in decreased expression of MAP2K1 mRNA	CTD	PMID:26760959
Map2k1	Rat	paclitaxel	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one results in decreased activity of MAP2K1 protein] affects the reaction [SOD2 protein results in more ...	CTD	PMID:18098270\|PMID:18594523
Map2k1	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of MAP2K1 mRNA	CTD	PMID:33387578
Map2k1	Rat	paraquat	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	[Maneb co-treated with Paraquat] results in decreased expression of MAP2K1 mRNA; Melatonin inhibits the reaction more ...	CTD	PMID:23963992
Map2k1	Rat	PD 0325901	multiple interactions	EXP		6480464	mirdametinib inhibits the reaction [polyphyllin I inhibits the reaction [Dietary Fats results in decreased expression more ...	CTD	PMID:36120828
Map2k1	Rat	pentachlorophenol	increases expression	ISO	Map2k1 (Mus musculus)	6480464	Pentachlorophenol results in increased expression of MAP2K1 mRNA	CTD	PMID:23892564
Map2k1	Rat	perfluorooctane-1-sulfonic acid	increases expression	EXP		6480464	perfluorooctane sulfonic acid results in increased expression of MAP2K1 mRNA	CTD	PMID:20136073
Map2k1	Rat	perfluorooctanoic acid	increases expression	EXP		6480464	perfluorooctanoic acid results in increased expression of MAP2K1 mRNA	CTD	PMID:19162173
Map2k1	Rat	perifosine	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	MAP2K1 protein mutant form results in decreased activity of [perifosine co-treated with Butyrates]; MAP2K1 protein more ...	CTD	PMID:15781658
Map2k1	Rat	phenylephrine	multiple interactions	EXP		6480464	MAP2K1 protein affects the reaction [Phenylephrine results in increased expression of NPPA mRNA]; MAP2K1 protein more ...	CTD	PMID:10888249
Map2k1	Rat	PhIP	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in increased phosphorylation of MAP2K1 protein	CTD	PMID:22307971
Map2k1	Rat	phorbol 13-acetate 12-myristate	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one results in decreased activity of MAP2K1 protein] inhibits the reaction [Tetradecanoylphorbol Acetate results in more ...	CTD	PMID:11861786\|PMID:16945329\|PMID:20479004
Map2k1	Rat	phorbol 13-acetate 12-myristate	increases activity	ISO	Map2k1 (Mus musculus)	6480464	Tetradecanoylphorbol Acetate results in increased activity of MAP2K1 protein	CTD	PMID:17693661\|PMID:18767048\|PMID:8816498
Map2k1	Rat	phorbol 13-acetate 12-myristate	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	3,5,3',4',5'-pentahydroxy-stilbene inhibits the reaction [Tetradecanoylphorbol Acetate results in increased activity of MAP2K1 protein]; geldanamycin inhibits more ...	CTD	PMID:17693661\|PMID:18767048\|PMID:8816498
Map2k1	Rat	phorbol 13-acetate 12-myristate	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Tetradecanoylphorbol Acetate results in increased phosphorylation of MAP2K1 protein	CTD	PMID:20479004
Map2k1	Rat	prednisone	decreases expression	ISO	Map2k1 (Mus musculus)	6480464	Prednisone results in decreased expression of MAP2K1 mRNA	CTD	PMID:38439560
Map2k1	Rat	propiconazole	increases expression	ISO	Map2k1 (Mus musculus)	6480464	propiconazole results in increased expression of MAP2K1 mRNA	CTD	PMID:21278054
Map2k1	Rat	propofol	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	Propofol inhibits the reaction [lipoteichoic acid results in increased phosphorylation of MAP2K1 protein]	CTD	PMID:19573522
Map2k1	Rat	prostaglandin F2alpha	increases phosphorylation	ISO	Map2k1 (Mus musculus)	6480464	Dinoprost results in increased phosphorylation of MAP2K1 protein	CTD	PMID:24333336
Map2k1	Rat	prostaglandin F2alpha	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	resveratrol inhibits the reaction [Dinoprost results in increased phosphorylation of MAP2K1 protein]; SRT1720 inhibits the more ...	CTD	PMID:24333336
Map2k1	Rat	purine-6-thiol	decreases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Mercaptopurine results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:12697733
Map2k1	Rat	pyocyanine	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Pyocyanine results in increased phosphorylation of MAP2K1 protein	CTD	PMID:24015256
Map2k1	Rat	quercetin	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[Cisplatin co-treated with Quercetin] results in increased expression of MAP2K1 mRNA	CTD	PMID:27514524
Map2k1	Rat	quercetin	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	Quercetin binds to and results in decreased activity of MAP2K1 protein	CTD	PMID:18245498
Map2k1	Rat	quinoline	decreases activity	ISO	MAP2K1 (Homo sapiens)	6480464	quinoline results in decreased activity of MAP2K1 protein	CTD	PMID:18393446
Map2k1	Rat	quinomethionate	affects expression	ISO	MAP2K1 (Homo sapiens)	6480464	quinomethionate affects the expression of MAP2K1 mRNA	CTD	PMID:15387888
Map2k1	Rat	reactive oxygen species	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one results in decreased activity of MAP2K1 protein] inhibits the reaction [Tetradecanoylphorbol Acetate results in more ...	CTD	PMID:16945329
Map2k1	Rat	resveratrol	decreases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	resveratrol results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:16761963
Map2k1	Rat	resveratrol	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	resveratrol inhibits the reaction [Dinoprost results in increased phosphorylation of MAP2K1 protein]	CTD	PMID:24333336
Map2k1	Rat	resveratrol	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	MAP2K1 protein inhibits the reaction [resveratrol results in decreased expression of XRCC1 protein]	CTD	PMID:26046675
Map2k1	Rat	resveratrol	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	resveratrol results in increased expression of MAP2K1 mRNA	CTD	PMID:12154049
Map2k1	Rat	resveratrol	increases activity	ISO	MAP2K1 (Homo sapiens)	6480464	resveratrol results in increased activity of MAP2K1 protein	CTD	PMID:15615701
Map2k1	Rat	resveratrol	decreases activity	ISO	MAP2K1 (Homo sapiens)	6480464	resveratrol results in decreased activity of MAP2K1 protein	CTD	PMID:15698585
Map2k1	Rat	rotenone	decreases expression	EXP		6480464	Rotenone results in decreased expression of MAP2K1 protein	CTD	PMID:35544339
Map2k1	Rat	rottlerin	decreases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	rottlerin results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:15949478
Map2k1	Rat	SCH772984	increases phosphorylation	EXP		6480464	SCH772984 results in increased phosphorylation of MAP2K1 protein	CTD	PMID:28087833
Map2k1	Rat	serpentine asbestos	affects expression	ISO	MAP2K1 (Homo sapiens)	6480464	Asbestos, Serpentine affects the expression of MAP2K1 mRNA	CTD	PMID:24160326
Map2k1	Rat	sirolimus	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[7-hydroxystaurosporine co-treated with Sirolimus] results in decreased expression of MAP2K1 protein; [7-hydroxystaurosporine co-treated with Sirolimus] more ...	CTD	PMID:15767555
Map2k1	Rat	sirolimus	multiple interactions	EXP		6480464	Sirolimus inhibits the reaction [MAP2K1 protein results in increased activity of RPS6KB1 protein]; Sirolimus inhibits more ...	CTD	PMID:12411397
Map2k1	Rat	sodium arsenite	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	4-((3-bromophenyl)amino)-6,7-dimethoxyquinazoline inhibits the reaction [sodium arsenite results in increased phosphorylation of MAP2K1 protein]; [[sodium arsenite more ...	CTD	PMID:10564177\|PMID:11943669\|PMID:21642427\|PMID:39836092
Map2k1	Rat	sodium arsenite	decreases expression	ISO	Map2k1 (Mus musculus)	6480464	sodium arsenite results in decreased expression of MAP2K1 mRNA	CTD	PMID:31233874
Map2k1	Rat	sodium arsenite	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	sodium arsenite results in increased phosphorylation of MAP2K1 protein	CTD	PMID:11943669
Map2k1	Rat	sodium arsenite	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	sodium arsenite results in increased expression of MAP2K1 mRNA	CTD	PMID:24431212\|PMID:38568856
Map2k1	Rat	sodium arsenite	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of MAP2K1 mRNA	CTD	PMID:12016162
Map2k1	Rat	sodium arsenite	affects expression	ISO	MAP2K1 (Homo sapiens)	6480464	sodium arsenite affects the expression of MAP2K1 mRNA; sodium arsenite affects the expression of MAP2K1 more ...	CTD	PMID:17384772\|PMID:29319823\|PMID:34032870
Map2k1	Rat	sodium fluoride	increases phosphorylation	EXP		6480464	Sodium Fluoride results in increased phosphorylation of MAP2K1 protein	CTD	PMID:19900517
Map2k1	Rat	sodium fluoride	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	Choline inhibits the reaction [Sodium Fluoride results in decreased expression of MAP2K1 mRNA]	CTD	PMID:27664006
Map2k1	Rat	sodium fluoride	decreases expression	ISO	Map2k1 (Mus musculus)	6480464	Sodium Fluoride results in decreased expression of MAP2K1 mRNA	CTD	PMID:27664006
Map2k1	Rat	sorafenib	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[MAP2K1 protein results in increased phosphorylation of MAPK1 protein] which results in decreased susceptibility to more ...	CTD	PMID:20117835\|PMID:21187475
Map2k1	Rat	sorafenib	decreases phosphorylation	EXP		6480464	sorafenib results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:17341847
Map2k1	Rat	sorafenib	decreases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	sorafenib results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:17341847\|PMID:18200035\|PMID:19139124
Map2k1	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of MAP2K1 mRNA	CTD	PMID:30047161
Map2k1	Rat	sulfates	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[Soot co-treated with Sulfates] affects the methylation of MAP2K1 promoter	CTD	PMID:25395096
Map2k1	Rat	sulindac sulfide	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	MAP2K1 protein inhibits the reaction [sulindac sulfide results in decreased phosphorylation of MAPK1 protein]; MAP2K1 more ...	CTD	PMID:15548677\|PMID:16079301
Map2k1	Rat	sulindac sulfone	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	MAP2K1 protein inhibits the reaction [sulindac sulfone results in decreased phosphorylation of MAPK1 protein]; MAP2K1 more ...	CTD	PMID:15548677
Map2k1	Rat	sumatriptan	multiple interactions	EXP		6480464	[Sumatriptan results in increased abundance of Calcium] inhibits the reaction [MAP2K1 protein results in increased more ...	CTD	PMID:12574409
Map2k1	Rat	sunitinib	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Sunitinib results in increased expression of MAP2K1 mRNA	CTD	PMID:31533062
Map2k1	Rat	tamoxifen	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	Tamoxifen promotes the reaction [PIN1 protein binds to MAP2K1 protein]	CTD	PMID:20479004
Map2k1	Rat	tamoxifen	increases expression	EXP		6480464	Tamoxifen results in increased expression of MAP2K1 protein modified form	CTD	PMID:17901229
Map2k1	Rat	tamoxifen	decreases expression	EXP		6480464	Tamoxifen results in decreased expression of MAP2K1 protein modified form	CTD	PMID:17901229
Map2k1	Rat	teriflunomide	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	teriflunomide inhibits the reaction [TNF protein results in increased activity of MAP2K1 protein]	CTD	PMID:9973483
Map2k1	Rat	testosterone	increases activity	ISO	MAP2K1 (Homo sapiens)	6480464	[Testosterone results in increased activity of RAF1 protein] which results in increased activity of MAP2K1 more ...	CTD	PMID:20372086
Map2k1	Rat	testosterone	multiple interactions	EXP		6480464	[FSHB protein co-treated with 1-Methyl-3-isobutylxanthine] inhibits the reaction [Testosterone promotes the reaction [RAF1 results in more ...	CTD	PMID:21177760
Map2k1	Rat	tetrachloromethane	affects expression	EXP		6480464	Carbon Tetrachloride affects the expression of MAP2K1 mRNA	CTD	PMID:17805973
Map2k1	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of MAP2K1 mRNA	CTD	PMID:31150632
Map2k1	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of MAP2K1 mRNA]	CTD	PMID:31150632
Map2k1	Rat	tetrachloromethane	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	Silymarin inhibits the reaction [Carbon Tetrachloride results in increased phosphorylation of MAP2K1 protein]	CTD	PMID:32956689
Map2k1	Rat	tetrachloromethane	increases phosphorylation	ISO	Map2k1 (Mus musculus)	6480464	Carbon Tetrachloride results in increased phosphorylation of MAP2K1 protein	CTD	PMID:32956689
Map2k1	Rat	Theaflavin 3,3'-digallate	decreases expression	EXP		6480464	theaflavin-3,3'-digallate results in decreased expression of MAP2K1 mRNA; theaflavin-3,3'-digallate results in decreased expression of MAP2K1 more ...	CTD	PMID:32964953
Map2k1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of MAP2K1 mRNA	CTD	PMID:34492290
Map2k1	Rat	thiram	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Thiram results in increased expression of MAP2K1 mRNA	CTD	PMID:38568856
Map2k1	Rat	titanium dioxide	increases phosphorylation	ISO	Map2k1 (Mus musculus)	6480464	titanium dioxide analog results in increased phosphorylation of MAP2K1 protein	CTD	PMID:25111187
Map2k1	Rat	titanium dioxide	decreases methylation	ISO	Map2k1 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of MAP2K1 gene; titanium dioxide results in decreased methylation more ...	CTD	PMID:35295148
Map2k1	Rat	toluene	affects expression	EXP		6480464	Toluene affects the expression of MAP2K1 mRNA	CTD	PMID:21827849
Map2k1	Rat	toosendanin	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	toosendanin results in decreased expression of MAP2K1 protein modified form	CTD	PMID:23111283
Map2k1	Rat	trametinib	decreases response to substance	ISO	MAP2K1 (Homo sapiens)	6480464	MAP2K1 protein mutant form results in decreased susceptibility to trametinib	CTD	PMID:29768711
Map2k1	Rat	trametinib	decreases phosphorylation	ISO	Map2k1 (Mus musculus)	6480464	trametinib results in decreased phosphorylation of MAP2K1 protein	CTD	PMID:37116855
Map2k1	Rat	trametinib	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[MAP2K1 protein mutant form results in decreased susceptibility to trametinib] inhibits the reaction [trametinib results more ...	CTD	PMID:29768711
Map2k1	Rat	trans-anethole	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	anethole inhibits the reaction [TNF protein results in increased activity of MAP2K1 protein]	CTD	PMID:10871845
Map2k1	Rat	trichostatin A	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	MAP2K1 protein mutant form results in decreased activity of [perifosine co-treated with trichostatin A]	CTD	PMID:15781658
Map2k1	Rat	trichostatin A	affects expression	ISO	MAP2K1 (Homo sapiens)	6480464	trichostatin A affects the expression of MAP2K1 mRNA	CTD	PMID:28542535
Map2k1	Rat	trimethyltin	increases expression	ISO	Map2k1 (Mus musculus)	6480464	trimethyltin results in increased expression of MAP2K1 mRNA	CTD	PMID:20833246
Map2k1	Rat	triphenyl phosphate	affects expression	ISO	MAP2K1 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of MAP2K1 mRNA	CTD	PMID:37042841
Map2k1	Rat	troglitazone	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	MAP2K1 protein promotes the reaction [troglitazone results in increased expression of ATF3 mRNA]	CTD	PMID:16079301
Map2k1	Rat	tyrphostin AG 1478	multiple interactions	EXP		6480464	RTKI cpd inhibits the reaction [Oleylethanolamide results in increased phosphorylation of MAP2K1 protein]	CTD	PMID:16269455
Map2k1	Rat	urethane	increases expression	ISO	MAP2K1 (Homo sapiens)	6480464	Urethane results in increased expression of MAP2K1 mRNA	CTD	PMID:28818685
Map2k1	Rat	vanadyl sulfate	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	4-((3-bromophenyl)amino)-6,7-dimethoxyquinazoline inhibits the reaction [vanadyl sulfate results in increased phosphorylation of MAP2K1 protein]; MRAS mutant more ...	CTD	PMID:10564177\|PMID:11943669
Map2k1	Rat	vanadyl sulfate	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	vanadyl sulfate results in increased phosphorylation of MAP2K1 protein	CTD	PMID:11943669
Map2k1	Rat	vorinostat	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	[Bortezomib co-treated with vorinostat] results in decreased expression of MAP2K1 protein; MAP2K1 protein mutant form more ...	CTD	PMID:12893773\|PMID:15781658
Map2k1	Rat	vorinostat	decreases expression	ISO	MAP2K1 (Homo sapiens)	6480464	vorinostat results in decreased expression of MAP2K1 protein	CTD	PMID:12893773
Map2k1	Rat	wogonin	multiple interactions	ISO	Map2k1 (Mus musculus)	6480464	wogonin inhibits the reaction [[Lipopolysaccharides co-treated with IFNG protein] results in increased phosphorylation of MAP2K1 more ...	CTD	PMID:23362215
Map2k1	Rat	zearalenone	decreases expression	ISO	Map2k1 (Mus musculus)	6480464	Zearalenone results in decreased expression of MAP2K1 protein	CTD	PMID:36252740
Map2k1	Rat	zinc atom	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	Zinc inhibits the reaction [mono-(2-ethylhexyl)phthalate results in decreased phosphorylation of MAP2K1 protein]	CTD	PMID:35841924
Map2k1	Rat	zinc atom	multiple interactions	EXP		6480464	Zinc inhibits the reaction [Diethylhexyl Phthalate results in decreased phosphorylation of MAP2K1 protein]	CTD	PMID:35841924
Map2k1	Rat	zinc sulfate	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	4-((3-bromophenyl)amino)-6,7-dimethoxyquinazoline inhibits the reaction [Zinc Sulfate results in increased phosphorylation of MAP2K1 protein]; MRAS mutant more ...	CTD	PMID:10564177\|PMID:11943669
Map2k1	Rat	zinc sulfate	increases phosphorylation	ISO	MAP2K1 (Homo sapiens)	6480464	Zinc Sulfate results in increased phosphorylation of MAP2K1 protein	CTD	PMID:11943669
Map2k1	Rat	zinc(0)	multiple interactions	ISO	MAP2K1 (Homo sapiens)	6480464	Zinc inhibits the reaction [mono-(2-ethylhexyl)phthalate results in decreased phosphorylation of MAP2K1 protein]	CTD	PMID:35841924
Map2k1	Rat	zinc(0)	multiple interactions	EXP		6480464	Zinc inhibits the reaction [Diethylhexyl Phthalate results in decreased phosphorylation of MAP2K1 protein]	CTD	PMID:35841924

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Map2k1	Rat	Bergmann glial cell differentiation	acts_upstream_of_or_within	ISO	Map2k1 (Mus musculus)	1624291	MGI:99511 PMID:24431450	RGD	PMID:24431450
Map2k1	Rat	Bergmann glial cell differentiation	acts_upstream_of_or_within	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	cell motility	acts_upstream_of_or_within	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	cell motility	acts_upstream_of_or_within	ISO	Map2k1 (Mus musculus)	1624291	MGI:2178132 PMID:10209122	RGD	PMID:10209122
Map2k1	Rat	cellular senescence	involved_in	IEA	UniProtKB:Q02750\|ensembl:ENSP00000302486	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	cellular senescence	involved_in	ISO	MAP2K1 (Homo sapiens)	1624291	PMID:9765203	RGD	PMID:9765203
Map2k1	Rat	central nervous system neuron differentiation	acts_upstream_of_or_within	ISO	Map2k1 (Mus musculus)	1624291	PMID:15145949	RGD	PMID:15145949
Map2k1	Rat	central nervous system neuron differentiation	acts_upstream_of_or_within	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	cerebellar cortex formation	acts_upstream_of_or_within	ISO	Map2k1 (Mus musculus)	1624291	MGI:99511 PMID:24431450	RGD	PMID:24431450
Map2k1	Rat	cerebellar cortex formation	acts_upstream_of_or_within	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	endodermal cell differentiation	acts_upstream_of	ISO	Map2k1 (Mus musculus)	1624291	PMID:16908534	RGD	PMID:16908534
Map2k1	Rat	endodermal cell differentiation	acts_upstream_of	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	epithelial cell proliferation involved in lung morphogenesis	acts_upstream_of_or_within	ISO	Map2k1 (Mus musculus)	1624291	MGI:1346867 PMID:25100655	RGD	PMID:25100655
Map2k1	Rat	epithelial cell proliferation involved in lung morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	ERBB2-ERBB3 signaling pathway	involved_in	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	ERBB2-ERBB3 signaling pathway	involved_in	ISO	Map2k1 (Mus musculus)	1624291	PMID:24493648	RGD	PMID:24493648
Map2k1	Rat	ERK1 and ERK2 cascade	acts_upstream_of_or_within	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	ERK1 and ERK2 cascade	acts_upstream_of_or_within	ISO	Map2k1 (Mus musculus)	1624291	MGI:1346867 PMID:25100655	RGD	PMID:25100655
Map2k1	Rat	face development	acts_upstream_of_or_within	ISO	Map2k1 (Mus musculus)	1624291	MGI:1346867 PMID:18952847	RGD	PMID:18952847
Map2k1	Rat	face development	acts_upstream_of_or_within	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	Golgi inheritance		IMP		2293212	Golgi fragmentation during mitosis	RGD
Map2k1	Rat	heart development	acts_upstream_of_or_within	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	heart development	acts_upstream_of_or_within	ISO	Map2k1 (Mus musculus)	1624291	MGI:1346867 PMID:18952847	RGD	PMID:18952847
Map2k1	Rat	insulin-like growth factor receptor signaling pathway	involved_in	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	insulin-like growth factor receptor signaling pathway	involved_in	ISO	Map2k1 (Mus musculus)	1624291	PMID:21699731	RGD	PMID:21699731
Map2k1	Rat	intracellular signal transduction		TAS		70317		RGD
Map2k1	Rat	keratinocyte differentiation	acts_upstream_of_or_within	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	keratinocyte differentiation	acts_upstream_of_or_within	ISO	Map2k1 (Mus musculus)	1624291	PMID:11841548	RGD	PMID:11841548
Map2k1	Rat	labyrinthine layer development	acts_upstream_of_or_within	ISO	Map2k1 (Mus musculus)	1624291	MGI:2178132 PMID:10209122	RGD	PMID:10209122
Map2k1	Rat	labyrinthine layer development	acts_upstream_of_or_within	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	lung morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	lung morphogenesis	acts_upstream_of_or_within	ISO	Map2k1 (Mus musculus)	1624291	MGI:1346867 PMID:25100655	RGD	PMID:25100655
Map2k1	Rat	MAPK cascade	involved_in	IEA	GO:0004708	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Map2k1	Rat	MAPK cascade	involved_in	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	MAPK cascade	involved_in	ISO	Map2k1 (Mus musculus)	1624291	MGI:1346867\|MGI:4430550 PMID:21220101, PMID:24493648	RGD	PMID:21220101\|PMID:24493648
Map2k1	Rat	MAPK cascade	involved_in	IBA	FB:FBgn0010269\|FB:FBgn0024326\|FB:FBgn0261524\|MGI:1346345\|MGI:1346866\|MGI:1346867\|MGI:1346868\|MGI:1346869\|MGI:1346870\|MGI:1346871\|PANTHER:PTN000684494\|PomBase:SPAC1D4.13\|PomBase:SPBC409.07c\|PomBase:SPBC543.07\|RGD:1560043\|RGD:61890\|SGD:S000002318\|SGD:S000003664\|SGD:S000005757\|SGD:S000006061\|UniProtKB:O14733\|UniProtKB:P36507\|UniProtKB:P46734\|UniProtKB:P52564\|WB:WBGene00003185\|WB:WBGene00003186\|WB:WBGene00003368\|WB:WBGene00004758	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Map2k1	Rat	melanosome transport		IDA		2293208	positive regulation of bidirectional melanosome transport along microtubules	RGD
Map2k1	Rat	myelination	involved_in	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	myelination	involved_in	ISO	Map2k1 (Mus musculus)	1624291	MGI:1929598\|MGI:2177256\|MGI:2448075 PMID:10704452, PMID:18760695	RGD	PMID:10704452\|PMID:18760695
Map2k1	Rat	negative regulation of cell population proliferation	involved_in	IEA	UniProtKB:Q02750\|ensembl:ENSP00000302486	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	negative regulation of cell population proliferation	involved_in	ISO	MAP2K1 (Homo sapiens)	1624291	PMID:9765203	RGD	PMID:9765203
Map2k1	Rat	negative regulation of gene expression	involved_in	IGI	UniProtKB:P36506	13524616	PMID:28947594	BHF-UCL
Map2k1	Rat	negative regulation of gene expression	involved_in	IEA	ARBA:ARBA00026647	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Map2k1	Rat	negative regulation of homotypic cell-cell adhesion		IMP		2292641	IEC6 cells	RGD
Map2k1	Rat	negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway	involved_in	IMP		12793039	PMID:15459207	CAFA
Map2k1	Rat	negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway	involved_in	IGI	UniProtKB:P06733	12793039	PMID:15459207	CAFA
Map2k1	Rat	neuron differentiation		IMP		2292642		RGD
Map2k1	Rat	neuron differentiation	involved_in	IBA	MGI:1346866\|PANTHER:PTN000684587\|RGD:70495	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Map2k1	Rat	neuron projection morphogenesis		IMP		2292642		RGD
Map2k1	Rat	placenta blood vessel development	acts_upstream_of_or_within	ISO	Map2k1 (Mus musculus)	1624291	MGI:2178132 PMID:10209122	RGD	PMID:10209122
Map2k1	Rat	placenta blood vessel development	acts_upstream_of_or_within	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	positive regulation of ATP biosynthetic process	involved_in	IMP		12793039	PMID:15459207	CAFA
Map2k1	Rat	positive regulation of ATP biosynthetic process	involved_in	IGI	UniProtKB:P06733	12793039	PMID:15459207	CAFA
Map2k1	Rat	positive regulation of autophagy		IDA		12879823		RGD
Map2k1	Rat	positive regulation of axonogenesis	acts_upstream_of_or_within	ISO	Map2k1 (Mus musculus)	1624291	MGI:1346867\|MGI:88190 PMID:24733831	RGD	PMID:24733831
Map2k1	Rat	positive regulation of axonogenesis	acts_upstream_of_or_within	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	positive regulation of cell migration		IMP		2292641	IEC6 cells	RGD
Map2k1	Rat	positive regulation of DNA-templated transcription	involved_in	IEA	UniProtKB:Q02750\|ensembl:ENSP00000302486	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	positive regulation of DNA-templated transcription	involved_in	ISO	MAP2K1 (Homo sapiens)	1624291	PMID:24375836	RGD	PMID:24375836
Map2k1	Rat	positive regulation of endodermal cell differentiation	acts_upstream_of_or_within	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	positive regulation of endodermal cell differentiation	acts_upstream_of_or_within	ISO	Map2k1 (Mus musculus)	1624291	PMID:16908534	RGD	PMID:16908534
Map2k1	Rat	positive regulation of ERK1 and ERK2 cascade	involved_in	ISO	MAP2K1 (Homo sapiens)	1624291	PMID:24375836	RGD	PMID:24375836
Map2k1	Rat	positive regulation of ERK1 and ERK2 cascade	involved_in	IEA	UniProtKB:Q02750\|ensembl:ENSP00000302486	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	positive regulation of gene expression	involved_in	IMP		12793039	PMID:15459207	CAFA
Map2k1	Rat	positive regulation of gene expression	involved_in	ISO	MAP2K1 (Homo sapiens)	1624291	PMID:15155804, PMID:24375836	RGD	PMID:15155804\|PMID:24375836
Map2k1	Rat	positive regulation of gene expression	involved_in	IEA	UniProtKB:Q02750\|ensembl:ENSP00000302486	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	positive regulation of gene expression	involved_in	IGI	UniProtKB:P09416	12793039	PMID:15459207	CAFA
Map2k1	Rat	positive regulation of GTPase activity		IMP		2292641	basal and EGF-activated Rac1	RGD
Map2k1	Rat	positive regulation of MAPK cascade		IDA		2293305		RGD
Map2k1	Rat	positive regulation of MAPK cascade	acts_upstream_of_or_within	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	positive regulation of MAPK cascade	acts_upstream_of_or_within	ISO	Map2k1 (Mus musculus)	1624291	PMID:15896720	RGD	PMID:15896720
Map2k1	Rat	positive regulation of muscle contraction	involved_in	IGI	UniProtKB:P06733	12793039	PMID:15459207	CAFA
Map2k1	Rat	positive regulation of muscle contraction	involved_in	IMP		12793039	PMID:15459207	CAFA
Map2k1	Rat	positive regulation of protein serine/threonine kinase activity	involved_in	ISO	MAP2K1 (Homo sapiens)	1624291	PMID:8388392	RGD	PMID:8388392
Map2k1	Rat	positive regulation of Ras protein signal transduction	acts_upstream_of_or_within	IMP		8553977	PMID:19029245	MGI
Map2k1	Rat	positive regulation of transcription elongation by RNA polymerase II		IMP		2292639		RGD
Map2k1	Rat	protein phosphorylation		TAS		70317		RGD
Map2k1	Rat	protein phosphorylation		IDA		2298674		RGD
Map2k1	Rat	protein phosphorylation		IDA		61657		RGD
Map2k1	Rat	protein phosphorylation	acts_upstream_of_or_within	ISO	Map2k1 (Mus musculus)	1624291	MGI:1346867 PMID:15896720, PMID:19047410	RGD	PMID:15896720\|PMID:19047410
Map2k1	Rat	protein phosphorylation		IDA		2293209	MAPK K52R mutant	RGD
Map2k1	Rat	regulation of axon regeneration	acts_upstream_of_or_within	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	regulation of axon regeneration	acts_upstream_of_or_within	ISO	Map2k1 (Mus musculus)	1624291	MGI:1346867\|MGI:88190 PMID:24733831	RGD	PMID:24733831
Map2k1	Rat	regulation of early endosome to late endosome transport	involved_in	TAS		8553538	PMID:19565474	UniProt
Map2k1	Rat	regulation of early endosome to late endosome transport	involved_in	IEA	ARBA:ARBA00028332	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Map2k1	Rat	regulation of ERK1 and ERK2 cascade		IDA		12879823		RGD
Map2k1	Rat	regulation of Golgi inheritance	involved_in	TAS		8553538	PMID:19565474	UniProt
Map2k1	Rat	regulation of Golgi inheritance	involved_in	IEA	ARBA:ARBA00028400	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Map2k1	Rat	regulation of neurotransmitter receptor localization to postsynaptic specialization membrane	involved_in	IDA		13702166	PMID:12202034	SynGO
Map2k1	Rat	regulation of neurotransmitter receptor localization to postsynaptic specialization membrane	involved_in	EXP		13702166	PMID:12202034	SynGO
Map2k1	Rat	regulation of stress-activated MAPK cascade	involved_in	IEA	ARBA:ARBA00026638	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Map2k1	Rat	regulation of stress-activated MAPK cascade	involved_in	TAS		8553538	PMID:19565474	UniProt
Map2k1	Rat	regulation of vascular associated smooth muscle contraction		IMP		2293329	inhibition decreases both calcium-stimulated and unstimulated myogenic tone in middle cerebral arteries p<0.001	RGD
Map2k1	Rat	response to axon injury		IMP		2293210	protection from axon degeneration following transection or NGF deprivation	RGD
Map2k1	Rat	response to glucocorticoid		IDA		625388		RGD
Map2k1	Rat	response to oxidative stress		IDA		1582172		RGD
Map2k1	Rat	Schwann cell development	involved_in	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	Schwann cell development	involved_in	ISO	Map2k1 (Mus musculus)	1624291	MGI:2177256 PMID:10704452	RGD	PMID:10704452
Map2k1	Rat	thymus development	acts_upstream_of_or_within	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	thymus development	acts_upstream_of_or_within	ISO	Map2k1 (Mus musculus)	1624291	MGI:1346867 PMID:18952847	RGD	PMID:18952847
Map2k1	Rat	thyroid gland development	acts_upstream_of_or_within	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	thyroid gland development	acts_upstream_of_or_within	ISO	Map2k1 (Mus musculus)	1624291	MGI:1346867 PMID:18952847	RGD	PMID:18952847
Map2k1	Rat	trachea formation	acts_upstream_of_or_within	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	trachea formation	acts_upstream_of_or_within	ISO	Map2k1 (Mus musculus)	1624291	MGI:1346867 PMID:25100655	RGD	PMID:25100655
Map2k1	Rat	triglyceride homeostasis		IDA		12879823		RGD
Map2k1	Rat	type B pancreatic cell proliferation	acts_upstream_of_positive_effect	ISO	Map2k1 (Mus musculus)	1624291	PMID:18202127	RGD	PMID:18202127
Map2k1	Rat	type B pancreatic cell proliferation	acts_upstream_of_positive_effect	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	vesicle transport along microtubule		IDA		2293208	positive regulation of bidirectional melanosome transport along microtubules	RGD

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Map2k1	Rat	axon		IDA		2293331	cytoplasm	RGD
Map2k1	Rat	cell cortex	located_in	IEA	ARBA:ARBA00028374	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Map2k1	Rat	cell cortex		IDA		2298675		RGD
Map2k1	Rat	centrosome	located_in	IEA	UniProtKB-SubCell:SL-0048	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Map2k1	Rat	ciliary basal body	located_in	IEA	UniProtKB:A4QPA9\|ensembl:ENSP00000302486	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	ciliary basal body	located_in	IEA	UniProtKB:Q02750\|ensembl:ENSP00000302486	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	ciliary basal body	located_in	ISO	RGD:732023\|UniProtKB:Q02750-1	1624291		RGD	GO_REF:0000052
Map2k1	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Map2k1	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Map2k1	Rat	cytoskeleton	located_in	IEA	UniProtKB-KW:KW-0206	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Map2k1	Rat	cytosol	located_in	ISO	RGD:732023\|UniProtKB:Q02750-1	1624291		RGD	GO_REF:0000052
Map2k1	Rat	cytosol	located_in	IEA	UniProtKB:A4QPA9\|ensembl:ENSP00000302486	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	cytosol	located_in	TAS		8553538	PMID:19565474	UniProt
Map2k1	Rat	cytosol	located_in	IEA	UniProtKB:Q02750\|ensembl:ENSP00000302486	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	cytosol	located_in	IEA	ARBA:ARBA00029243	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Map2k1	Rat	dendrite		IDA		2293321		RGD
Map2k1	Rat	dendrite cytoplasm		IDA		2293331		RGD
Map2k1	Rat	early endosome	located_in	TAS		8553538	PMID:19565474	UniProt
Map2k1	Rat	early endosome	located_in	IEA	ARBA:ARBA00028567	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Map2k1	Rat	endoplasmic reticulum	located_in	ISO	MAP2K1 (Homo sapiens)	1624291	PMID:22572157	RGD	PMID:22572157
Map2k1	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB:Q02750\|ensembl:ENSP00000302486	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	focal adhesion	located_in	TAS		8553538	PMID:19565474	UniProt
Map2k1	Rat	focal adhesion	located_in	IEA	ARBA:ARBA00028361	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Map2k1	Rat	glutamatergic synapse	is_active_in	IDA		13702166	PMID:12202034	SynGO
Map2k1	Rat	glutamatergic synapse	is_active_in	EXP		13702166	PMID:12202034	SynGO
Map2k1	Rat	Golgi apparatus	located_in	TAS		8553538	PMID:19565474	UniProt
Map2k1	Rat	late endosome	located_in	TAS		8553538	PMID:19565474	UniProt
Map2k1	Rat	late endosome	located_in	IEA	ARBA:ARBA00028569	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Map2k1	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Map2k1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Map2k1	Rat	microtubule	located_in	IDA		2293321	partial colocalization	RGD
Map2k1	Rat	mitochondrion	located_in	IEA	ARBA:ARBA00026962	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Map2k1	Rat	mitochondrion	located_in	TAS		8553538	PMID:19565474	UniProt
Map2k1	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Map2k1	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Map2k1	Rat	nucleus	located_in	TAS		8553538	PMID:19565474	UniProt
Map2k1	Rat	perikaryon		IDA		2293331		RGD
Map2k1	Rat	perikaryon		IDA		2293321		RGD
Map2k1	Rat	perinuclear region of cytoplasm		IDA		2293211	phosphorylated p-S298 Map2k1 during cell adhesion	RGD
Map2k1	Rat	plasma membrane	located_in	ISO	RGD:732023\|UniProtKB:Q02750-1	1624291		RGD	GO_REF:0000052
Map2k1	Rat	plasma membrane	located_in	IEA	UniProtKB:Q02750\|ensembl:ENSP00000302486	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	plasma membrane	located_in	IEA	UniProtKB:A4QPA9\|ensembl:ENSP00000302486	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	postsynaptic density	is_active_in	IDA		13702331	PMID:7478291	SynGO
Map2k1	Rat	postsynaptic density	is_active_in	IEP		13702331	PMID:7478291	SynGO

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Map2k1	Rat	ATP binding	enables	IEA	UniRule:UR001503341	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Map2k1	Rat	ATP binding		IDA		2298674		RGD
Map2k1	Rat	ATP binding	enables	IEA	UniProtKB-KW:KW-0067	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Map2k1	Rat	ATP binding	enables	IEA	InterPro:IPR000719\|InterPro:IPR017441	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Map2k1	Rat	kinase activity	enables	IEA	UniProtKB-KW:KW-0418	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Map2k1	Rat	MAP kinase kinase activity		TAS		70317		RGD
Map2k1	Rat	MAP kinase kinase activity		IDA		61657		RGD
Map2k1	Rat	MAP kinase kinase activity		IDA		2298674		RGD
Map2k1	Rat	MAP kinase kinase activity	enables	IEA	UniProtKB:Q02750\|ensembl:ENSP00000302486	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	MAP kinase kinase activity	enables	IEA	EC:2.7.12.2	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Map2k1	Rat	MAP kinase kinase activity	enables	ISO	Map2k1 (Mus musculus)	1624291	PMID:11841548, PMID:1411546	RGD	PMID:11841548\|PMID:1411546
Map2k1	Rat	MAP kinase kinase activity	enables	IBA	CGD:CAL0000184846\|FB:FBgn0010269\|FB:FBgn0261524\|MGI:1346345\|MGI:1346866\|MGI:1346867\|MGI:1346868\|MGI:1346870\|MGI:1346871\|PANTHER:PTN000684494\|PomBase:SPAC1D4.13\|PomBase:SPBC409.07c\|PomBase:SPBC543.07\|RGD:1560043\|RGD:61888\|RGD:620666\|RGD:70495\|SGD:S000002318\|SGD:S000003664\|TAIR:locus:2170578\|UniProtKB:O14733\|UniProtKB:P36507\|UniProtKB:P46734\|UniProtKB:P52564\|UniProtKB:Q02750\|UniProtKB:Q5BEU9\|WB:WBGene00002177\|WB:WBGene00003185\|WB:WBGene00004758	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Map2k1	Rat	MAP kinase kinase activity	enables	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	MAP kinase kinase activity	enables	IEA	ARBA:ARBA00043555	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Map2k1	Rat	MAP kinase kinase activity	enables	ISO	MAP2K1 (Homo sapiens)	1624291	PMID:28166211, PMID:8388392	RGD	PMID:28166211\|PMID:8388392
Map2k1	Rat	MAP kinase kinase activity		IDA		2293305		RGD
Map2k1	Rat	MAP kinase kinase activity		IDA		1582177		RGD
Map2k1	Rat	MAP-kinase scaffold activity	enables	IEA	UniProtKB:Q02750\|ensembl:ENSP00000302486	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	MAP-kinase scaffold activity	enables	ISO	MAP2K1 (Homo sapiens)	1624291	PMID:29433126	RGD	PMID:29433126
Map2k1	Rat	mitogen-activated protein kinase kinase kinase binding		IDA		2293209	Chinese hamster c-Raf-1	RGD
Map2k1	Rat	mitogen-activated protein kinase kinase kinase binding		IPI	Map3k1 (Rattus norvegicus)	2293486		RGD
Map2k1	Rat	nucleotide binding	enables	IEA	UniRule:UR001503341	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Map2k1	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Map2k1	Rat	protein binding	enables	ISO	Map2k1 (Mus musculus)	1624291	UniProtKB:Q13526\|UniProtKB:Q8CFP6\|UniProtKB:Q9ESN9-2 PMID:10523642, PMID:20179103, PMID:24746703	RGD	PMID:10523642\|PMID:20179103\|PMID:24746703
Map2k1	Rat	protein binding		IPI	Ksr1 (Rattus norvegicus)	2298675		RGD
Map2k1	Rat	protein binding	enables	ISO	MAP2K1 (Homo sapiens)	1624291	UniProtKB:O15519-1\|UniProtKB:P00540\|UniProtKB:P04049\|UniProtKB:P15056\|UniProtKB:P27361\|UniProtKB:P28482\|UniProtKB:P46937\|UniProtKB:P63085\|UniProtKB:Q13526\|UniProtKB:Q61097\|UniProtKB:Q86Y07\|UniProtKB:Q86Y07-1\|UniProtKB:Q8IVT5\|UniProtKB:Q8N9N5\|UniProtKB:Q8N9N5-2\|UniProtKB:Q8WWU5-7\|UniProtKB:Q96RU7\|UniProtKB:Q96RU8\|UniProtKB:Q9H8W4\|UniProtKB:Q9NR09\|UniProtKB:Q9Y297 PMID:15299019, PMID:17110930, PMID:17255949, PMID:17724343, PMID:17979178, PMID:18329369, PMID:19197339, PMID:20179161, PMID:20554783, PMID:20679487, PMID:21441104, PMID:22572157, PMID:22752157, more ...	RGD	PMID:15299019\|PMID:17110930\|PMID:17255949\|PMID:17724343\|PMID:17979178\|PMID:18329369\|PMID:19197339\|PMID:20179161\|PMID:20554783\|PMID:20679487\|PMID:21441104\|PMID:22572157\|PMID:22752157\|PMID:23241949\|PMID:23934108\|PMID:24211253\|PMID:24746704\|PMID:25155755\|PMID:25416956\|PMID:25437913\|PMID:25600339\|PMID:26496610\|PMID:29433126\|PMID:31980649\|PMID:32296183\|PMID:32707033\|PMID:32721402\|PMID:33961781\|PMID:34779126\|PMID:35271311\|PMID:35512704
Map2k1	Rat	protein kinase activator activity	enables	ISO	MAP2K1 (Homo sapiens)	1624291	PMID:10644344	RGD	PMID:10644344
Map2k1	Rat	protein kinase activator activity	enables	IEA	UniProtKB:Q02750\|ensembl:ENSP00000302486	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	protein kinase activity	enables	IEA	InterPro:IPR000719\|InterPro:IPR008271	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Map2k1	Rat	protein kinase binding		IPI	DYRK1A (Homo sapiens)	2292643		RGD
Map2k1	Rat	protein serine kinase activity	enables	IEA	RHEA:17989	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Map2k1	Rat	protein serine/threonine kinase activator activity	enables	IEA	UniProtKB:Q02750\|ensembl:ENSP00000302486	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	protein serine/threonine kinase activator activity	enables	ISO	MAP2K1 (Homo sapiens)	1624291	PMID:8388392	RGD	PMID:8388392
Map2k1	Rat	protein serine/threonine kinase activity	enables	IEA	UniProtKB:P31938\|ensembl:ENSMUSP00000005066	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	protein serine/threonine kinase activity	enables	ISO	Map2k1 (Mus musculus)	1624291	PMID:23283332, PMID:24493648	RGD	PMID:23283332\|PMID:24493648
Map2k1	Rat	protein serine/threonine kinase activity	enables	IEA	UniProtKB-KW:KW-0723	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Map2k1	Rat	protein serine/threonine/tyrosine kinase activity	enables	TAS		8553538	PMID:19565474	UniProt
Map2k1	Rat	protein tyrosine kinase activity	enables	IEA	UniProtKB-KW:KW-0829	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Map2k1	Rat	protein tyrosine kinase activity	enables	IEA	RHEA:10596	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Map2k1	Rat	protein-containing complex binding		IPI	RGD:737237\|RGD:2827\|RGD:619908	2292643	heterooligomerization	RGD
Map2k1	Rat	scaffold protein binding	enables	IEA	UniProtKB:Q02750\|ensembl:ENSP00000302486	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Map2k1	Rat	scaffold protein binding	enables	ISO	MAP2K1 (Homo sapiens)	1624291	UniProtKB:Q61097 PMID:10409742	RGD	PMID:10409742
Map2k1	Rat	small GTPase binding		IPI	HRAS (Homo sapiens)	2293305		RGD
Map2k1	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Map2k1	Rat	altered extracellular signal-regulated Raf/Mek/Erk signaling pathway		ISO	BRAF (Homo sapiens)	5133243		RGD
Map2k1	Rat	altered extracellular signal-regulated Raf/Mek/Erk signaling pathway		ISO	MAP2K1 (Homo sapiens)	5133242		RGD
Map2k1	Rat	non-small cell lung carcinoma pathway		ISO	MAP2K1 (Homo sapiens)	5133243		RGD
Map2k1	Rat	non-small cell lung carcinoma pathway		ISO	MAP2K1 (Homo sapiens)	5133242		RGD
Map2k1	Rat	the extracellular signal-regulated Raf/Mek/Erk signaling pathway		TAS		70317		RGD
Map2k1	Rat	the extracellular signal-regulated Raf/Mek/Erk signaling pathway		IMP		1626216		RGD

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Map2k1	Rat	Fc epsilon receptor mediated signaling pathway		ISO	MAP2K1 (Homo sapiens)	10402751		SMPDB	SMP:00358
Map2k1	Rat	insulin signaling pathway		ISO	MAP2K1 (Homo sapiens)	10402751		SMPDB	SMP:00391

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Map2k1	Rat	acute myeloid leukemia pathway		IEA		6907045		KEGG	rno:05221
Map2k1	Rat	B cell receptor signaling pathway		IEA		6907045		KEGG	rno:04662
Map2k1	Rat	ceramide signaling pathway		IEA		6907045		KEGG	rno:05212
Map2k1	Rat	chemokine mediated signaling pathway		IEA		6907045		KEGG	rno:04062
Map2k1	Rat	chronic myeloid leukemia pathway		IEA		6907045		KEGG	rno:05220
Map2k1	Rat	colorectal cancer pathway		IEA		6907045		KEGG	rno:05210
Map2k1	Rat	endometrial cancer pathway		IEA		6907045		KEGG	rno:05213
Map2k1	Rat	epidermal growth factor/neuregulin signaling pathway		IEA		6907045		KEGG	rno:04012
Map2k1	Rat	Fc epsilon receptor mediated signaling pathway		IEA		6907045		KEGG	rno:04664
Map2k1	Rat	Fc gamma receptor mediated signaling pathway		IEA		6907045		KEGG	rno:04666
Map2k1	Rat	glioma pathway		IEA		6907045		KEGG	rno:05214
Map2k1	Rat	gonadotropin-releasing hormone signaling pathway		IEA		6907045		KEGG	rno:04912
Map2k1	Rat	influenza A pathway		IEA		6907045		KEGG	rno:05164
Map2k1	Rat	insulin signaling pathway		IEA		6907045		KEGG	rno:04910
Map2k1	Rat	long term depression		IEA		6907045		KEGG	rno:04730
Map2k1	Rat	long term potentiation		IEA		6907045		KEGG	rno:04720
Map2k1	Rat	melanoma pathway		IEA		6907045		KEGG	rno:05218
Map2k1	Rat	mitogen activated protein kinase signaling pathway		IEA		6907045		KEGG	rno:04010
Map2k1	Rat	neurotrophic factor signaling pathway		IEA		6907045		KEGG	rno:04722
Map2k1	Rat	non-small cell lung carcinoma pathway		IEA		6907045		KEGG	rno:05223
Map2k1	Rat	pancreatic cancer pathway		IEA		6907045		KEGG	rno:05212
Map2k1	Rat	prion disease pathway		IEA		6907045		KEGG	rno:05020
Map2k1	Rat	prostate cancer pathway		IEA		6907045		KEGG	rno:05215
Map2k1	Rat	renal cell carcinoma pathway		IEA		6907045		KEGG	rno:05211
Map2k1	Rat	T cell receptor signaling pathway		IEA		6907045		KEGG	rno:04660
Map2k1	Rat	thyroid cancer pathway		IEA		6907045		KEGG	rno:05216
Map2k1	Rat	Toll-like receptor signaling pathway		IEA		6907045		KEGG	rno:04620
Map2k1	Rat	urinary bladder cancer pathway		IEA		6907045		KEGG	rno:05219
Map2k1	Rat	vascular endothelial growth factor signaling pathway		IEA		6907045		KEGG	rno:04370

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Map2k1	Rat	ceramide signaling pathway		ISO	MAP2K1 (Homo sapiens)	6484113		PID	PID:200119
Map2k1	Rat	endothelin signaling pathway		ISO	MAP2K1 (Homo sapiens)	6484113		PID	PID:200005
Map2k1	Rat	ephrin - ephrin receptor bidirectional signaling axis		ISO	MAP2K1 (Homo sapiens)	6484113		PID	PID:200052
Map2k1	Rat	granulocyte-macrophage colony-stimulating factor signaling pathway		ISO	MAP2K1 (Homo sapiens)	6484113		PID	PID:200019
Map2k1	Rat	Hedgehog signaling pathway		ISO	MAP2K1 (Homo sapiens)	6484113		PID	PID:200172
Map2k1	Rat	interleukin-2 signaling pathway		ISO	MAP2K1 (Homo sapiens)	6484113		PID	PID:200098
Map2k1	Rat	mTOR signaling pathway		ISO	MAP2K1 (Homo sapiens)	6484113		PID	PID:200096
Map2k1	Rat	platelet-derived growth factor signaling pathway		ISO	MAP2K1 (Homo sapiens)	6484113		PID	PID:200149
Map2k1	Rat	type II interferon signaling pathway		ISO	MAP2K1 (Homo sapiens)	6484113		PID	PID:200129
Map2k1	Rat	vascular endothelial growth factor signaling pathway		ISO	MAP2K1 (Homo sapiens)	6484113		PID	PID:200188

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Map2k1	Rat	impaired smooth muscle contractility		IDA		2293329	inhibition decreases both calcium-stimulated and unstimulated myogenic tone in middle cerebral arteries p<0.001	RGD

#	Reference Title	Reference Citation
1.	Signaling via mitogen-activated protein kinase kinase (MEK1) is required for Golgi fragmentation during mitosis.	Acharya U, etal., Cell. 1998 Jan 23;92(2):183-92.
2.	MEK1 protein kinase inhibition protects against damage resulting from focal cerebral ischemia.	Alessandrini A, etal., Proc Natl Acad Sci U S A. 1999 Oct 26;96(22):12866-9.
3.	c-Raf, but not B-Raf, is essential for development of K-Ras oncogene-driven non-small cell lung carcinoma.	Blasco RB, etal., Cancer Cell. 2011 May 17;19(5):652-63. doi: 10.1016/j.ccr.2011.04.002. Epub 2011 Apr 21.
4.	Inhibitors of farnesyl protein transferase and MEK1,2 induce apoptosis in fibroblasts transformed with farnesylated but not geranylgeranylated H-Ras.	Brassard DL, etal., Exp Cell Res. 2002 Feb 15;273(2):138-46.
5.	A proline-rich sequence unique to MEK1 and MEK2 is required for raf binding and regulates MEK function.	Catling AD, etal., Mol Cell Biol. 1995 Oct;15(10):5214-25.
6.	MiR-339 inhibits proliferation of pulmonary artery smooth muscle cell by targeting FGF signaling.	Chen J, etal., Physiol Rep. 2017 Sep;5(18). pii: 5/18/e13441. doi: 10.14814/phy2.13441.
7.	Oncogenomics of c-Myc transgenic mice reveal novel regulators of extracellular signaling, angiogenesis and invasion with clinical significance for human lung adenocarcinoma.	Ciribilli Y and Borlak J, Oncotarget. 2017 Oct 23;8(60):101808-101831. doi: 10.18632/oncotarget.21981. eCollection 2017 Nov 24.
8.	RAF1-activated MEK1 is found on the Golgi apparatus in late prophase and is required for Golgi complex fragmentation in mitosis.	Colanzi A, etal., J Cell Biol. 2003 Apr 14;161(1):27-32.
9.	Regulation of bidirectional melanosome transport by organelle bound MAP kinase.	Deacon SW, etal., Curr Biol. 2005 Mar 8;15(5):459-63.
10.	Cloning and sequencing of a cDNA encoding rat brain mitogen-activated protein (MAP) kinase activator.	Doring F, etal., Gene 1993 Sep 15;131(2):303-4.
11.	Activation of MAP kinase kinase (MEK) and Ras by cholecystokinin in rat pancreatic acini.	Duan RD, etal., Am J Physiol. 1995 Jun;268(6 Pt 1):G1060-5.
12.	Insulin receptor, insulin receptor substrate-1, Raf-1, and Mek-1 during hormonal hepatocarcinogenesis by intrahepatic pancreatic islet transplantation in diabetic rats.	Evert M, etal., Cancer Res. 2004 Nov 1;64(21):8093-100.
13.	Immunolocalization of the mitogen-activated protein kinases p42MAPK and JNK1, and their regulatory kinases MEK1 and MEK4, in adult rat central nervous system.	Flood DG, etal., J Comp Neurol. 1998 Aug 31;398(3):373-92.
14.	Up-regulation of P-TEFb by the MEK1-extracellular signal-regulated kinase signaling pathway contributes to stimulated transcription elongation of immediate early genes in neuroendocrine cells.	Fujita T, etal., Mol Cell Biol. 2008 Mar;28(5):1630-43. Epub 2007 Dec 17.
15.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
16.	Embryonic death of Mek1-deficient mice reveals a role for this kinase in angiogenesis in the labyrinthine region of the placenta.	Giroux S, etal., Curr Biol 1999 Apr 8;9(7):369-72.
17.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
18.	Development of cataractous macrophthalmia in mice expressing an active MEK1 in the lens.	Gong X, etal., Invest Ophthalmol Vis Sci. 2001 Mar;42(3):539-48.
19.	Individualized drug screening based on next generation sequencing and patient derived xenograft model for pancreatic cancer with bone metastasis.	Guan Z, etal., Mol Med Rep. 2017 Oct;16(4):4784-4790. doi: 10.3892/mmr.2017.7213. Epub 2017 Aug 10.
20.	Mitogen-activated Protein Kinase Kinase Activity Maintains Acinar-to-Ductal Metaplasia and Is Required for Organ Regeneration in Pancreatitis.	Halbrook CJ, etal., Cell Mol Gastroenterol Hepatol. 2017 Jan;3(1):99-118. doi: 10.1016/j.jcmgh.2016.09.009.
21.	Inhibition of MAPK kinase signaling pathways suppressed renal cell carcinoma growth and angiogenesis in vivo.	Huang D, etal., Cancer Res. 2008 Jan 1;68(1):81-8.
22.	DYRK1A enhances the mitogen-activated protein kinase cascade in PC12 cells by forming a complex with Ras, B-Raf, and MEK1.	Kelly PA and Rahmani Z, Mol Biol Cell. 2005 Aug;16(8):3562-73. Epub 2005 May 25.
23.	Neural cell adhesion molecule (NCAM) induces neuronal phenotype acquisition in dominant negative MEK1-expressing hippocampal neural progenitor cells.	Kim BW and Son H, Exp Mol Med. 2006 Dec 31;38(6):732-8.
24.	Expression of mitogen-activated protein kinase pathways during postnatal development of rat heart.	Kim SO, etal., J Cell Biochem 1998 Nov 1;71(2):286-301.
25.	Evaluation of clinical significance of TP53, BCL-2, BAX and MEK1 expression in 229 ovarian carcinomas treated with platinum-based regimen.	Kupryjanczyk J, etal., Br J Cancer. 2003 Mar 24;88(6):848-54.
26.	Insulin and oxidative stress modulate proliferation of rat ovarian theca-interstitial cells through diverse signal transduction pathways.	Kwintkiewicz J, etal., Biol Reprod. 2006 Jun;74(6):1034-40. Epub 2006 Feb 15.
27.	Nonspecific inhibition of myogenic tone by PD98059, a MEK1 inhibitor, in rat middle cerebral arteries.	Lagaud GJ, etal., Biochem Biophys Res Commun. 1999 Apr 13;257(2):523-7.
28.	Regulation of Wallerian degeneration and nerve growth factor withdrawal-induced pruning of axons of sympathetic neurons by the proteasome and the MEK/Erk pathway.	MacInnis BL and Campenot RB, Mol Cell Neurosci. 2005 Mar;28(3):430-9.
29.	Ubiquitin (UbC) expression in muscle cells is increased by glucocorticoids through a mechanism involving Sp1 and MEK1.	Marinovic AC, etal., J Biol Chem 2002 May 10;277(19):16673-81.
30.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
31.	ERK1/2 regulates intracellular ATP levels through alpha-enolase expression in cardiomyocytes exposed to ischemic hypoxia and reoxygenation.	Mizukami Y, etal., J Biol Chem. 2004 Nov 26;279(48):50120-31. Epub 2004 Sep 30.
32.	Association of MEK1 with p21ras.GMPPNP is dependent on B-Raf.	Moodie SA, etal., Mol Cell Biol. 1994 Nov;14(11):7153-62.
33.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
34.	Constitutive activation of mitogen-activated protein (MAP) kinases in human renal cell carcinoma.	Oka H, etal., Cancer Res. 1995 Sep 15;55(18):4182-7.
35.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
36.	Isolation of two members of the rat MAP kinase kinase gene family.	Otsu M, etal., FEBS Lett 1993 Apr 12;320(3):246-50.
37.	New driver mutations in non-small-cell lung cancer.	Pao W and Girard N, Lancet Oncol. 2011 Feb;12(2):175-80.
38.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
39.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
40.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
41.	MEK/ERK regulates adherens junctions and migration through Rac1.	Ray RM, etal., Cell Motil Cytoskeleton. 2007 Mar;64(3):143-56.
42.	GOA pipeline	RGD automated data pipeline
43.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
44.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
45.	Activated MEK cooperates with Ink4a/Arf loss or Akt activation to induce gliomas in vivo.	Robinson JP, etal., Oncogene. 2011 Mar 17;30(11):1341-50. doi: 10.1038/onc.2010.513. Epub 2010 Nov 8.
46.	Germline mutations in genes within the MAPK pathway cause cardio-facio-cutaneous syndrome.	Rodriguez-Viciana P, etal., Science. 2006 Mar 3;311(5765):1287-90. Epub 2006 Jan 26.
47.	Investigation of the Mek-MAP kinase-Rsk pathway in human breast cancer.	Salh B, etal., Anticancer Res. 1999 Jan-Feb;19(1B):731-40.
48.	Somatic mutations of signaling genes in non-small-cell lung cancer.	Sanders HR and Albitar M, Cancer Genet Cytogenet. 2010 Nov;203(1):7-15.
49.	Growth factor-induced MAPK network topology shapes Erk response determining PC-12 cell fate.	Santos SD, etal., Nat Cell Biol. 2007 Mar;9(3):324-30. Epub 2007 Feb 18.
50.	The topography and subcellular distribution of mitogen-activated protein kinase kinase1 (MEK1) in adult rat brain and differentiating PC12 cells.	Schipper HM, etal., Neuroscience. 1999;93(2):585-95.
51.	PAK1 phosphorylation of MEK1 regulates fibronectin-stimulated MAPK activation.	Slack-Davis JK, etal., J Cell Biol. 2003 Jul 21;162(2):281-91.
52.	Depleting MEKK1 expression inhibits the ability of invasion and migration of human pancreatic cancer cells.	Su F, etal., J Cancer Res Clin Oncol. 2009 Dec;135(12):1655-63. doi: 10.1007/s00432-009-0612-6. Epub 2009 Jun 10.
53.	Involvement of ERK1/2 in invasiveness and metastatic development of rat prostatic adenocarcinoma.	Suthiphongchai T, etal., Oncol Res. 2003;13(5):253-9.
54.	ERK2-type mitogen-activated protein kinase (MAPK) and its substrates in postsynaptic density fractions from the rat brain.	Suzuki T, etal., Neurosci Res. 1995 Jun;22(3):277-85.
55.	A subdomain of MEKK1 that is critical for binding to MKK4.	Tu Z, etal., Cell Signal. 2003 Jan;15(1):65-77.
56.	The protein phosphatase 2A regulatory subunits B'beta and B'delta mediate sustained TrkA neurotrophin receptor autophosphorylation and neuronal differentiation.	Van Kanegan MJ and Strack S, Mol Cell Biol. 2009 Feb;29(3):662-74. doi: 10.1128/MCB.01242-08. Epub 2008 Nov 24.
57.	Activation of MEK1 or MEK2 isoform is sufficient to fully transform intestinal epithelial cells and induce the formation of metastatic tumors.	Voisin L, etal., BMC Cancer. 2008 Nov 17;8:337. doi: 10.1186/1471-2407-8-337.
58.	MEKK1 controls neurite regrowth after experimental injury by balancing ERK1/2 and JNK2 signaling.	Waetzig V and Herdegen T, Mol Cell Neurosci. 2005 Sep;30(1):67-78.
59.	Rat thy-1 antigens from thymus and brain: their tissue distribution, purification, and chemical composition.	Williams AF, etal., Cold Spring Harb Symp Quant Biol 1977;41 Pt 1:51-61.
60.	Renaturation and partial peptide sequencing of mitogen-activated protein kinase (MAP kinase) activator from rabbit skeletal muscle.	Wu J, etal., Biochem J 1992 Aug 1;285 ( Pt 3):701-5.
61.	Identification and characterization of a new mammalian mitogen-activated protein kinase kinase, MKK2.	Wu J, etal., Mol Cell Biol 1993 Aug;13(8):4539-48.
62.	Molecular structure of a protein-tyrosine/threonine kinase activating p42 mitogen-activated protein (MAP) kinase: MAP kinase kinase.	Wu J, etal., Proc Natl Acad Sci U S A 1993 Jan 1;90(1):173-7.
63.	Activation of ERK1/2 Ameliorates Liver Steatosis in Leptin Receptor-Deficient (db/db) Mice via Stimulating ATG7-Dependent Autophagy.	Xiao Y, etal., Diabetes. 2016 Feb;65(2):393-405. doi: 10.2337/db15-1024. Epub 2015 Nov 18.
64.	Insulin enhances growth hormone induction of the MEK/ERK signaling pathway.	Xu J, etal., J Biol Chem. 2006 Jan 13;281(2):982-92. Epub 2005 Nov 4.
65.	MEKK1 phosphorylates MEK1 and MEK2 but does not cause activation of mitogen-activated protein kinase.	Xu S, etal., Proc Natl Acad Sci U S A. 1995 Jul 18;92(15):6808-12.
66.	The ERK signaling cascade--views from different subcellular compartments.	Yao Z and Seger R, Biofactors. 2009 Sep-Oct;35(5):407-16. doi: 10.1002/biof.52.
67.	Ras and Rap control AMPA receptor trafficking during synaptic plasticity.	Zhu JJ, etal., Cell. 2002 Aug 23;110(4):443-55.

PMID:8026469	PMID:8388392	PMID:8889548	PMID:9765203	PMID:10407019	PMID:10409742	PMID:10644344	PMID:11841548	PMID:12477932	PMID:12624112	PMID:14963006	PMID:15145949
PMID:15155804	PMID:15469737	PMID:15782137	PMID:15896720	PMID:16737746	PMID:16908534	PMID:17498664	PMID:18006605	PMID:18270979	PMID:18952847	PMID:19047410	PMID:19249349
PMID:19340459	PMID:19447520	PMID:19453943	PMID:19462441	PMID:20001965	PMID:20942268	PMID:21263381	PMID:21777515	PMID:22294037	PMID:22572157	PMID:23096919	PMID:23376485
PMID:23626836	PMID:24126801	PMID:24375836	PMID:24431450	PMID:24610459	PMID:24733831	PMID:25100655	PMID:26272725	PMID:26514923	PMID:28166211	PMID:28975447	PMID:29433126
PMID:29476059	PMID:30053369	PMID:30206251	PMID:30876692	PMID:31505169	PMID:32357304

Map2k1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	73,578,747 - 73,650,184 (-)	NCBI		GRCr8
GRCr8 Ensembl	8	73,578,752 - 73,650,184 (-)	Ensembl		GRCr8 Ensembl
mRatBN7.2	8	64,683,449 - 64,754,900 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	64,683,449 - 64,755,147 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	70,198,296 - 70,269,639 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	68,470,887 - 68,542,228 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	66,340,874 - 66,412,220 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	69,134,218 - 69,722,573 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	69,134,223 - 69,164,758 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	68,840,454 - 68,877,679 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	68,379,074 - 68,451,554 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	64,090,188 - 64,161,314 (-)	NCBI		Celera
RGSC_v3.1	8	68,398,125 - 68,470,608 (-)	NCBI
Cytogenetic Map	8	q24	NCBI

MAP2K1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	66,386,912 - 66,491,544 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	66,386,837 - 66,491,656 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	66,679,250 - 66,783,882 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	64,466,679 - 64,570,936 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	64,466,678 - 64,570,935	NCBI
Celera	15	43,568,908 - 43,673,089 (+)	NCBI		Celera
Cytogenetic Map	15	q22.31	NCBI
HuRef	15	43,515,493 - 43,620,002 (+)	NCBI		HuRef
CHM1_1	15	66,797,173 - 66,901,898 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	15	64,208,363 - 64,313,019 (+)	NCBI		T2T-CHM13v2.0

Map2k1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	64,093,066 - 64,160,887 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	64,093,052 - 64,160,913 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	64,185,769 - 64,253,605 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	64,185,770 - 64,253,631 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	64,033,600 - 64,101,412 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	63,983,794 - 64,051,338 (-)	NCBI		MGSCv36	mm8
Celera	9	61,410,935 - 61,478,604 (-)	NCBI		Celera
Cytogenetic Map	9	C	NCBI
cM Map	9	34.55	NCBI

Map2k1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955450	9,181,851 - 9,239,648 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955450	9,181,851 - 9,205,277 (-)	NCBI	ChiLan1.0	ChiLan1.0

MAP2K1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	55,642,226 - 55,744,013 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	59,814,985 - 59,916,768 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	45,337,117 - 45,438,826 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	63,613,988 - 63,714,928 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	63,613,961 - 63,714,161 (+)	Ensembl	panpan1.1		panPan2

MAP2K1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	30,683,192 - 30,760,479 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	30,683,107 - 30,760,479 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	30,613,296 - 30,690,593 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	30,879,701 - 30,957,083 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	30,878,118 - 30,957,083 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	30,809,219 - 30,886,485 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	30,868,842 - 30,945,867 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	31,110,222 - 31,187,514 (+)	NCBI		UU_Cfam_GSD_1.0

Map2k1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	108,704,376 - 108,780,234 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	26,589,161 - 26,628,302 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	26,589,251 - 26,628,302 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MAP2K1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	164,381,845 - 164,471,226 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	164,381,892 - 164,469,313 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	182,187,631 - 182,196,671 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MAP2K1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	17,059,122 - 17,168,787 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	17,060,054 - 17,168,782 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	124,281,623 - 124,391,821 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Map2k1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624781	6,222,365 - 6,285,531 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624781	6,222,365 - 6,285,398 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Map2k1
286 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	39
Count of miRNA genes:	39
Interacting mature miRNAs:	39
Transcripts:	ENSRNOT00000013933
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30856404	75856404	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1582222	Epfw2	Epididymal fat weight QTL 2	3.2	0.0005	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	8	31737729	76737729	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	50095249	82460899	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1300146	Rf17	Renal function QTL 17	2.9		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	8	28242912	73242912	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	29502665	70386295	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	22662330	67662330	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	41866876	75097878	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	54237644	85365202	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
631216	Stl9	Serum triglyceride level QTL 9	4.71	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	8	41867010	70386132	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	54237644	85365202	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	50095249	82460899	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	50095249	82460899	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	54043744	98968765	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2303564	Gluco43	Glucose level QTL 43	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	26130187	71130187	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
2303572	Insul13	Insulin level QTL 13	2		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	8	26130187	71130187	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat

RH140096

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	64,693,122 - 64,693,339 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	69,143,892 - 69,144,108	NCBI	Rnor6.0
Rnor_5.0	8	68,850,128 - 68,850,344	UniSTS	Rnor5.0
RGSC_v3.4	8	68,388,746 - 68,388,962	UniSTS	RGSC3.4
Celera	8	64,099,862 - 64,100,078	UniSTS
RH 3.4 Map	8	809.9	UniSTS
Cytogenetic Map	8	q24	UniSTS

RH143905

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	64,754,956 - 64,755,187 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	69,722,309 - 69,722,539	NCBI	Rnor6.0
Rnor_5.0	8	69,431,673 - 69,431,903	UniSTS	Rnor5.0
Celera	8	64,161,371 - 64,161,600	UniSTS
RH 3.4 Map	8	808.2	UniSTS
Cytogenetic Map	8	q24	UniSTS

RH137806

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	64,729,870 - 64,730,025 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	69,179,742 - 69,179,896	NCBI	Rnor6.0
Rnor_5.0	8	68,886,035 - 68,886,189	UniSTS	Rnor5.0
RGSC_v3.4	8	68,426,345 - 68,426,499	UniSTS	RGSC3.4
Celera	8	64,136,284 - 64,136,438	UniSTS
RH 3.4 Map	8	806.9	UniSTS
Cytogenetic Map	8	q24	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_031643	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017595427	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080739	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AI603089	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC089772	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D13341	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D14591	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213946	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X62313	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Z16415	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000013933 ⟹ ENSRNOP00000013933

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	73,578,752 - 73,611,016 (-)	Ensembl
mRatBN7.2 Ensembl	8	64,683,490 - 64,755,147 (-)	Ensembl
Rnor_6.0 Ensembl	8	69,134,223 - 69,164,758 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097110 ⟹ ENSRNOP00000092766

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	73,579,649 - 73,650,184 (-)	Ensembl
mRatBN7.2 Ensembl	8	64,684,351 - 64,715,956 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097536 ⟹ ENSRNOP00000081692

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	64,683,449 - 64,715,956 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102833 ⟹ ENSRNOP00000086602

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	73,578,752 - 73,637,801 (-)	Ensembl
mRatBN7.2 Ensembl	8	64,683,449 - 64,743,030 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000120242 ⟹ ENSRNOP00000084527

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	73,578,752 - 73,650,184 (-)	Ensembl
mRatBN7.2 Ensembl	8	64,683,449 - 64,715,723 (-)	Ensembl

RefSeq Acc Id:

NM_031643 ⟹ NP_113831

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	73,578,747 - 73,650,184 (-)	NCBI
mRatBN7.2	8	64,683,449 - 64,754,900 (-)	NCBI
Rnor_6.0	8	69,134,218 - 69,722,252 (-)	NCBI
Rnor_5.0	8	68,840,454 - 68,877,679 (-)	NCBI
RGSC_v3.4	8	68,379,074 - 68,451,554 (-)	RGD
Celera	8	64,090,188 - 64,161,314 (-)	NCBI

Sequence:

show sequence

CGGCCGCGCGCTCCCTGCTGAGTTGCAGGCTGTTTCCCGGCTGCAAGATGCCCAAGAAGAAGCCGACGCCCATCCAGCTGAACCCGGCCCCCGATGGCTCCGCGGTTAACGGGACCAGCTCGGCCGAG
ACCAACCTGGAGGCCTTGCAGAAGAAGCTGGAGGAGCTGGAGCTGGACGAGCAGCAGCGGAAGCGCCTTGAGGCCTTTCTGACGCAGAAGCAGAAGGTGGGAGAGTTGAAGGATGATGACTTTGAGAA
GATCAGTGAACTGGGGGCTGGCAATGGTGGAGTGGTGTTCAAGGTCTCCCACAAGCCATCTGGCCTGGTTATGGCTAGGAAGCTAATTCACCTGGAGATCAAACCCGCAATCCGGAACCAGATCATCC
GGGAGCTGCAGGTGCTGCATGAGTGCAACTCCCCGTACATAGTGGGCTTCTACGGGGCCTTCTACAGTGACGGCGAGATCAGCATCTGCATGGAGCACATGGATGGTGGGTCCTTGGATCAAGTGCTG
AAGAAAGCTGGAAGAATTCCTGAGCAAATTTTAGGAAAAGTCAGCATCGCTGTGATAAAAGGCCTGACATATCTACGAGAGAAGCACAAGATTATGCACAGAGATGTCAAGCCTTCCAACATTCTAGT
GAACTCACGTGGGGAGATCAAACTCTGCGATTTTGGGGTCAGCGGGCAGCTAATTGACTCCATGGCCAACTCCTTCGTGGGAACAAGGTCCTACATGTCGCCTGAGAGACTCCAGGGGACTCACTACT
CTGTGCAGTCGGACATCTGGAGCATGGGGCTCTCTCTGGTGGAGATGGCAGTTGGAAGATACCCCATTCCTCCTCCTGATGCCAAGGAGCTGGAGCTGCTGTTTGGATGCCAGGTGGAAGGAGACGCG
GCCGAAACGCCACCCAGGCCAAGGACCCCTGGGAGGCCCCTCAGCTCATATGGAATGGATAGCCGACCTCCCATGGCAATTTTTGAGTTGTTGGATTACATCGTCAATGAGCCTCCTCCAAAACTGCC
CAGTGGAGTATTCAGTCTGGAATTTCAGGATTTTGTGAATAAGTGCTTAATAAAGAACCCTGCAGAGAGAGCAGATCTGAAGCAGCTCATGGTACATGCTTTCATCAAGAGATCTGATGCCGAGGAGG
TAGACTTCGCAGGCTGGCTCTGCTCCACCATTGGGCTTAACCAGCCCAGCACACCAACCCACGCTGCCAGCATCTGAGCCTTTGGGAAGCAGCAGAGAGGAATCCTCTGCCCAGTGGCATGCCATGTT
GCTTTCAGGCCTCTCCCATGCTTGTCTATGTTCAGATGTGCATCTCATCTGTGACAAAGGATGAAGAACACAGCATGTGCCAAATCGTACTTGTGTCATTTTTAATATTGTCTTTATCGCTATGGTTA
CTCCCCTAAGTGGATTGGCTTTGTGCTTGGGGCTATTTGTCTGTTCATCAAATACATGCCAGGTTGAACTACAGTGAAACCCTGGTGACCTGGGTGGTCTTCTTACTGATGTTTGCGCTGCTGTTCAT
CGTGACTCACTAGCTGGCTGCCTGTATTGTCAGGATTCTCGGACCCTTGGTACTTCACTCTTGCTGGTGACCTCTCAGTCTGAGGAGAGGGGGCCTTCTGAGACCCTTCACAGGCAGTGCATGCATGA
AAAGCATGCTTTGCTGCTACTGAAATGAGCACCAGAACGTGTACATCATGGTATTTTATTTTTGCTTTTGGTATAGAACTCAGCAGTTCCCATTTAAAAAAAAAATCTAACCAGAGCCCATCACTGCC
ATGATAGCTGGGGCTTCAGTCTGTCTACTGTGGTGATTTTTAGACTTCTGGTTGTATTTCTATATTTATTTTTAAATATACTGTGTGGGATACTTAGTGGTATATGTCTCTGAGTTTGGATTAGTGTT
TCTAAATTGGTAGTTATTTTGAATGTCACAAATGGATTAAGGAATCAACGTATCAAGAGTTCTATCTTTCTTCCAGTCTAAGTACCAATGCTATTGTAAACGTGTATAGTGCCTACAAATTGTATGAA
AACCCTTTTAACCACTTTACTCAAGATGTTTATCAAATCTAATCTCTTATTCTAATAAAAATACTATCAAGTTAAAGTAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039080739 ⟹ XP_038936667

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	73,578,747 - 73,639,637 (-)	NCBI
mRatBN7.2	8	64,683,449 - 64,742,332 (-)	NCBI


Protein RefSeqs	NP_113831	(Get FASTA)	NCBI Sequence Viewer
	XP_038936667	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH89772	(Get FASTA)	NCBI Sequence Viewer
	BAA02603	(Get FASTA)	NCBI Sequence Viewer
	BAA03441	(Get FASTA)	NCBI Sequence Viewer
	CAA44192	(Get FASTA)	NCBI Sequence Viewer
	CAA78905	(Get FASTA)	NCBI Sequence Viewer
	EDL95791	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000084527
	ENSRNOP00000086602
GenBank Protein	Q01986	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_113831 ⟸ NM_031643

- UniProtKB:

Q5EBD5 (UniProtKB/Swiss-Prot), Q01986 (UniProtKB/Swiss-Prot), A6J5B8 (UniProtKB/TrEMBL), A0A0H2UHI2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVG
FYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEM
AVGRYPIPPPDAKELELLFGCQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQP
STPTHAASI

hide sequence

Ensembl Acc Id:

ENSRNOP00000013933 ⟸ ENSRNOT00000013933

RefSeq Acc Id:	XP_038936667 ⟸ XM_039080739
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A1J3 (UniProtKB/TrEMBL), A0A8I5ZT77 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000084527 ⟸ ENSRNOT00000120242

Ensembl Acc Id:

ENSRNOP00000086602 ⟸ ENSRNOT00000102833

Protein Domains

Protein kinase

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q01986-F1-model_v2	AlphaFold	Q01986	1-393	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-30104	BioCyc
Ensembl Genes	ENSRNOG00000010176	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000102833	ENTREZGENE
	ENSRNOT00000120242	ENTREZGENE
Gene3D-CATH	Phosphorylase Kinase, domain 1	UniProtKB/Swiss-Prot
	Transferase(Phosphotransferase) domain 1	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7382030	IMAGE-MGC_LOAD
InterPro	Kinase-like_dom_sf	UniProtKB/Swiss-Prot
	MAP_kinase_kinase	UniProtKB/Swiss-Prot
	Prot_kinase_dom	UniProtKB/Swiss-Prot
	Protein_kinase_ATP_BS	UniProtKB/Swiss-Prot
	Ser/Thr_kinase_AS	UniProtKB/Swiss-Prot
KEGG Report	rno:170851	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108573	IMAGE-MGC_LOAD
NCBI Gene	170851	ENTREZGENE
PANTHER	DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE KINASE DSOR1-LIKE PROTEIN	UniProtKB/Swiss-Prot
	MITOGEN-ACTIVATED PROTEIN KINASE KINASE 1	UniProtKB/Swiss-Prot
Pfam	Pkinase	UniProtKB/Swiss-Prot
PharmGKB	MAP2K1	RGD
PhenoGen	Map2k1	PhenoGen
PROSITE	PROTEIN_KINASE_ATP	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_DOM	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_ST	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000010176	RatGTEx
SMART	S_TKc	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF56112	UniProtKB/Swiss-Prot
UniProt	A0A0H2UHI2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZT77	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A048_RAT	UniProtKB/TrEMBL
	A0A8I6A1J3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AEA6_RAT	UniProtKB/TrEMBL
	A6J5B8	ENTREZGENE, UniProtKB/TrEMBL
	MP2K1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q5EBD5	ENTREZGENE
UniProt Secondary	Q5EBD5	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2003-04-09	Map2k1	mitogen activated protein kinase kinase 1			Symbol and Name status set to approved	629479	APPROVED
2002-06-10	Map2k1	mitogen activated protein kinase kinase 1			Symbol and Name status set to provisional	70585	PROVISIONAL

Note Type	Note	Reference
gene_expression	expression high in brain, lung, and liver	70317
gene_expression	expression decreases in cardiac ventricles after birth	70317
gene_expression	expression decreases in cardiac ventricles after birth; expression high in brain, lung, and liver	70317
gene_function	phosphorylates and activates Mapk1 and Mapk3	70317
gene_protein	contains 393 amino acids	729191
gene_regulation	phosphorylated by Raf; nitric oxide enhances phosphorylation	70317

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype