Symbol:
Akr1a1
Name:
aldo-keto reductase family 1 member A1
RGD ID:
68346
Description:
Enables L-glucuronate reductase activity and glucuronolactone reductase activity. Involved in carboxylic acid metabolic process; cellular detoxification of aldehyde; and negative regulation of apoptotic process. Predicted to be located in apical plasma membrane. Predicted to be active in cytosol and synapse. Orthologous to human AKR1A1 (aldo-keto reductase family 1 member A1); PARTICIPATES IN doxorubicin pharmacokinetics pathway; prostaglandin biosynthetic pathway; gluconeogenesis pathway; INTERACTS WITH 2,2,2-tetramine; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
3-DG-reducing enzyme; Akr1a4; alcohol dehydrogenase; alcohol dehydrogenase [NADP(+)]; alcohol dehydrogenase [NADP+]; aldehyde reductase; aldo-keto reductase family 1 member A1 (aldehyde reductase); aldo-keto reductase family 1, member A1; aldo-keto reductase family 1, member A1 (aldehyde reductase); glucuronate reductase; glucuronolactone reductase; S-nitroso-CoA reductase; scorR
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
AKR1A1 (aldo-keto reductase family 1 member A1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Akr1a1 (aldo-keto reductase family 1, member A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Akr1a1 (aldo-keto reductase family 1 member A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
AKR1A1 (aldo-keto reductase family 1 member A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
AKR1A1 (aldo-keto reductase family 1 member A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Akr1a1 (aldo-keto reductase family 1 member A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
AKR1A1 (aldo-keto reductase family 1 member A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
AKR1A1 (aldo-keto reductase family 1 member A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Akr1a1 (aldo-keto reductase family 1 member A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
NSUN2 (NOP2/Sun RNA methyltransferase 2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
AKR1A1 (aldo-keto reductase family 1 member A1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Akr1a1 (aldo-keto reductase family 1, member A1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
akr1a1b (aldo-keto reductase family 1, member A1b (aldehyde reductase))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
Y39G8B.1
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoInspector|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
YPR1
Alliance
DIOPT (InParanoid|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
akr1a1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 135,329,605 - 135,367,037 (-) NCBI GRCr8 mRatBN7.2 5 130,092,945 - 130,130,277 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 130,092,732 - 130,113,674 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 132,717,057 - 132,734,057 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 134,471,650 - 134,488,650 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 134,494,047 - 134,511,049 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 135,482,068 - 135,498,693 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 135,482,068 - 135,498,822 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 139,278,242 - 139,294,867 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 136,920,561 - 136,937,422 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 136,925,785 - 136,942,923 (-) NCBI Celera 5 128,620,481 - 128,637,092 (-) NCBI Celera Cytogenetic Map 5 q35 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Akr1a1 Rat (1->4)-beta-D-glucan multiple interactions ISO Akr1a1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of AKR1A1 mRNA CTD PMID:36331819 Akr1a1 Rat (S)-nicotine multiple interactions ISO Akr1a1 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Akr1a1 Rat 1,2-dimethylhydrazine multiple interactions ISO Akr1a1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of AKR1A1 mRNA] CTD PMID:22206623 Akr1a1 Rat 1,2-dimethylhydrazine increases expression ISO Akr1a1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of AKR1A1 mRNA CTD PMID:22206623 Akr1a1 Rat 1,2-naphthoquinone increases reduction ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 protein results in increased reduction of 1 and 2-naphthoquinone CTD PMID:10510318 Akr1a1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases expression ISO Akr1a1 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Akr1a1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Akr1a1 (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Akr1a1 Rat 13-dihydrodaunorubicin multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [AKR1A1 results in increased metabolism of Daunorubicin] which results in increased chemical synthesis of daunorubicinol CTD PMID:18276838 Akr1a1 Rat 16-Ketoestrone increases reduction ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 protein results in increased reduction of 16-ketoestrone CTD PMID:10510318 Akr1a1 Rat 17alpha-ethynylestradiol increases expression ISO Akr1a1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of AKR1A1 mRNA CTD PMID:17942748 Akr1a1 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO AKR1A1 (Homo sapiens) 6480464 Metribolone results in increased expression of AKR1A1 protein CTD PMID:17152098 Akr1a1 Rat 1H-pyrazole multiple interactions ISO Akr1a1 (Mus musculus) 6480464 pyrazole inhibits the reaction [AKR1A1 protein results in increased reduction of muconaldehyde] CTD PMID:16289176 Akr1a1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO AKR1A1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Akr1a1 Rat 2,2,2-tetramine multiple interactions EXP 6480464 Trientine inhibits the reaction [Streptozocin results in increased expression of AKR1A1 protein] CTD PMID:19634143 Akr1a1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Akr1a1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of AKR1A1 mRNA CTD PMID:16214954 Akr1a1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of AKR1A1 mRNA CTD PMID:33387578 Akr1a1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of AKR1A1 mRNA CTD PMID:32109520 Akr1a1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Akr1a1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of AKR1A1 mRNA CTD PMID:21570461 Akr1a1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Akr1a1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of AKR1A1 mRNA CTD PMID:18796159 Akr1a1 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of AKR1A1 mRNA CTD PMID:21346803 Akr1a1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:19954255 Akr1a1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of AKR1A1 mRNA CTD PMID:21346803 Akr1a1 Rat 2,6-dimethoxyphenol multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Akr1a1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of AKR1A1 mRNA CTD PMID:21346803 Akr1a1 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin analog results in decreased expression of AKR1A1 protein and alpha-Chlorohydrin results in decreased expression of AKR1A1 protein CTD PMID:26597043 Akr1a1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of AKR1A1 mRNA CTD PMID:28628672 Akr1a1 Rat 3-methylcholanthrene increases expression ISO AKR1A1 (Homo sapiens) 6480464 Methylcholanthrene results in increased expression of AKR1A1 mRNA CTD PMID:9973208 Akr1a1 Rat 3-nitrobenzaldehyde increases reduction ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 protein results in increased reduction of 3-nitrobenzaldehyde CTD PMID:10510318 Akr1a1 Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of AKR1A1 mRNA CTD PMID:19162173 Akr1a1 Rat 4,4'-sulfonyldiphenol increases expression ISO Akr1a1 (Mus musculus) 6480464 bisphenol S results in increased expression of AKR1A1 mRNA CTD PMID:39298647 Akr1a1 Rat 4,4'-sulfonyldiphenol increases expression ISO AKR1A1 (Homo sapiens) 6480464 bisphenol S results in increased expression of AKR1A1 protein CTD PMID:34186270 Akr1a1 Rat 4-formylbenzoic acid increases reduction ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 protein results in increased reduction of 4-carboxybenzaladehyde CTD PMID:10510318 Akr1a1 Rat 4-hydroxynon-2-enal increases expression ISO Akr1a1 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in increased expression of AKR1A1 mRNA CTD PMID:19191707 Akr1a1 Rat 4-hydroxynon-2-enal increases reduction ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 protein results in increased reduction of 4-hydroxy-2-nonenal CTD PMID:10510318 Akr1a1 Rat 4-nitrobenzaldehyde increases reduction ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 protein results in increased reduction of 4-nitrobenzaldehyde CTD PMID:10510318 Akr1a1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of AKR1A1 mRNA CTD PMID:19483382 Akr1a1 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of AKR1A1 mRNA CTD PMID:19483382 Akr1a1 Rat 9,10-phenanthroquinone multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 protein results in increased reduction of and affects the activity of 9 and 10-phenanthrenequinone CTD PMID:21910479 Akr1a1 Rat acrolein increases reduction ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 protein results in increased reduction of Acrolein CTD PMID:10510318 Akr1a1 Rat acrolein affects reduction EXP 6480464 AKR1A1 protein affects the reduction of Acrolein CTD PMID:12604195 Akr1a1 Rat actinomycin D multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of AKR1A1 protein CTD PMID:38460933 Akr1a1 Rat aflatoxin B1 decreases expression ISO AKR1A1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of AKR1A1 mRNA CTD PMID:27153756 Akr1a1 Rat aldehydo-D-glucose multiple interactions ISO Akr1a1 (Mus musculus) 6480464 fidarestat inhibits the reaction [Glucose results in decreased expression of AKR1A1 mRNA] CTD PMID:16805838 Akr1a1 Rat aldehydo-D-glucose decreases expression ISO Akr1a1 (Mus musculus) 6480464 Glucose results in decreased expression of AKR1A1 mRNA CTD PMID:16805838 Akr1a1 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of AKR1A1 mRNA CTD PMID:19483382 Akr1a1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of AKR1A1 mRNA CTD PMID:16483693 Akr1a1 Rat antirheumatic drug decreases expression ISO AKR1A1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of AKR1A1 mRNA CTD PMID:24449571 Akr1a1 Rat arecoline decreases expression ISO AKR1A1 (Homo sapiens) 6480464 Arecoline results in decreased expression of AKR1A1 mRNA CTD PMID:17682004 Akr1a1 Rat aristolochic acid A increases expression ISO AKR1A1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of AKR1A1 protein CTD PMID:33212167 Akr1a1 Rat arsane multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AKR1A1 mRNA CTD PMID:39836092 Akr1a1 Rat arsenic atom multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AKR1A1 mRNA CTD PMID:39836092 Akr1a1 Rat arsenous acid multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to AKR1A1 protein] CTD PMID:26598702 Akr1a1 Rat atrazine increases expression ISO AKR1A1 (Homo sapiens) 6480464 Atrazine results in increased expression of AKR1A1 mRNA CTD PMID:22378314 Akr1a1 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of AKR1A1 mRNA CTD PMID:19483382 Akr1a1 Rat benzo[a]pyrene affects methylation ISO AKR1A1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of AKR1A1 promoter CTD PMID:27901495 Akr1a1 Rat benzo[a]pyrene decreases expression ISO AKR1A1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of AKR1A1 mRNA CTD PMID:32234424 Akr1a1 Rat benzo[a]pyrene diol epoxide I increases expression ISO AKR1A1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Akr1a1 Rat Benzo[a]pyrene-7,8-diol multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [AKR1A1 protein co-treated with NADP] results in increased oxidation of and affects the activity of benzo(a)pyrene 7 more ... CTD PMID:15720144 more ... Akr1a1 Rat Benzo[a]pyrene-7,8-diol decreases response to substance ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 protein results in decreased susceptibility to benzo(a)pyrene 7 and 8-dihydrodiol CTD PMID:22053912 Akr1a1 Rat benzo[a]pyrene-7,8-dione multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [AKR1A1 protein co-treated with NADP] results in increased reduction of and affects the activity of benzo(a)pyrene-7 more ... CTD PMID:15720144 and PMID:21910479 Akr1a1 Rat benzo[a]pyrene-7,8-dione increases expression ISO AKR1A1 (Homo sapiens) 6480464 benzo(a)pyrene-7 and 8-dione results in increased expression of AKR1A1 mRNA CTD PMID:9973208 Akr1a1 Rat benzo[a]pyrene-7,8-dione increases chemical synthesis ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 protein results in increased chemical synthesis of benzo(a)pyrene-7 and 8-dione CTD PMID:16411658 Akr1a1 Rat benzo[a]pyrene-7,8-dione affects chemical synthesis ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 protein affects the chemical synthesis of benzo(a)pyrene-7 and 8-dione CTD PMID:15720144 Akr1a1 Rat beta-naphthoflavone increases expression ISO AKR1A1 (Homo sapiens) 6480464 beta-Naphthoflavone results in increased expression of AKR1A1 mRNA CTD PMID:9973208 Akr1a1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Akr1a1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of AKR1A1 mRNA CTD PMID:34319233 Akr1a1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of AKR1A1 mRNA CTD PMID:25181051 more ... Akr1a1 Rat bisphenol A increases expression ISO AKR1A1 (Homo sapiens) 6480464 bisphenol A results in increased expression of AKR1A1 protein CTD PMID:37567409 Akr1a1 Rat bisphenol A decreases expression ISO AKR1A1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of AKR1A1 protein CTD PMID:34186270 Akr1a1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of AKR1A1 gene CTD PMID:28505145 Akr1a1 Rat bisphenol AF increases expression ISO AKR1A1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of AKR1A1 protein CTD PMID:34186270 Akr1a1 Rat bisphenol F multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of AKR1A1 mRNA CTD PMID:28628672 Akr1a1 Rat bisphenol F increases expression ISO AKR1A1 (Homo sapiens) 6480464 bisphenol F results in increased expression of AKR1A1 protein CTD PMID:34186270 Akr1a1 Rat cadmium atom multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of AKR1A1 mRNA CTD PMID:35301059 Akr1a1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of AKR1A1 protein CTD PMID:21699967 Akr1a1 Rat cadmium dichloride multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of AKR1A1 mRNA CTD PMID:35301059 Akr1a1 Rat cadmium dichloride decreases expression ISO AKR1A1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of AKR1A1 mRNA CTD PMID:38568856 Akr1a1 Rat cadmium dichloride increases expression ISO AKR1A1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of AKR1A1 protein CTD PMID:24527689 Akr1a1 Rat caffeine multiple interactions ISO Akr1a1 (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Akr1a1 Rat capsaicin multiple interactions EXP 6480464 Capsaicin inhibits the reaction [Dietary Fats results in decreased expression of AKR1A1 protein] CTD PMID:20359164 Akr1a1 Rat carbamazepine affects expression ISO AKR1A1 (Homo sapiens) 6480464 Carbamazepine affects the expression of AKR1A1 mRNA CTD PMID:25979313 Akr1a1 Rat chenodeoxycholic acid multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of AKR1A1 mRNA CTD PMID:32152650 Akr1a1 Rat chlorpyrifos increases expression ISO Akr1a1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of AKR1A1 mRNA CTD PMID:37019170 Akr1a1 Rat cisplatin multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of AKR1A1 mRNA CTD PMID:27392435 Akr1a1 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of AKR1A1 mRNA CTD PMID:19483382 Akr1a1 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of AKR1A1 mRNA CTD PMID:17602206 Akr1a1 Rat cobalt dichloride decreases expression ISO AKR1A1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of AKR1A1 mRNA CTD PMID:19376846 Akr1a1 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of AKR1A1 mRNA CTD PMID:22465980 Akr1a1 Rat copper atom affects binding ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 protein binds to Copper CTD PMID:15359738 Akr1a1 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of AKR1A1 mRNA CTD PMID:22465980 Akr1a1 Rat copper(0) affects binding ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 protein binds to Copper CTD PMID:15359738 Akr1a1 Rat copper(II) chloride increases expression ISO Akr1a1 (Mus musculus) 6480464 cupric chloride results in increased expression of AKR1A1 protein CTD PMID:29617964 Akr1a1 Rat copper(II) sulfate decreases expression ISO AKR1A1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of AKR1A1 mRNA CTD PMID:19549813 Akr1a1 Rat crotonaldehyde affects reduction EXP 6480464 AKR1A1 protein affects the reduction of 2-butenal CTD PMID:12604195 Akr1a1 Rat cyclosporin A multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of AKR1A1 mRNA CTD PMID:32152650 Akr1a1 Rat D-glucose multiple interactions ISO Akr1a1 (Mus musculus) 6480464 fidarestat inhibits the reaction [Glucose results in decreased expression of AKR1A1 mRNA] CTD PMID:16805838 Akr1a1 Rat D-glucose decreases expression ISO Akr1a1 (Mus musculus) 6480464 Glucose results in decreased expression of AKR1A1 mRNA CTD PMID:16805838 Akr1a1 Rat D-glyceraldehyde decreases activity ISO AKR1A1 (Homo sapiens) 6480464 Glyceraldehyde results in decreased activity of AKR1A1 protein CTD PMID:30469331 Akr1a1 Rat daunorubicin increases reduction ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 protein results in increased reduction of Daunorubicin CTD PMID:18322072 Akr1a1 Rat daunorubicin affects metabolic processing ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 SNP affects the metabolism of Daunorubicin CTD PMID:18276838 Akr1a1 Rat daunorubicin multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [AKR1A1 results in increased metabolism of Daunorubicin] which results in increased chemical synthesis of daunorubicinol CTD PMID:18276838 Akr1a1 Rat daunorubicin increases metabolic processing ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 results in increased metabolism of Daunorubicin CTD PMID:18276838 Akr1a1 Rat deoxycholic acid multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of AKR1A1 mRNA CTD PMID:32152650 Akr1a1 Rat dexamethasone multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of AKR1A1 mRNA CTD PMID:28628672 Akr1a1 Rat Diallyl sulfide affects expression EXP 6480464 allyl sulfide affects the expression of AKR1A1 mRNA CTD PMID:19768707 Akr1a1 Rat diarsenic trioxide multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to AKR1A1 protein] CTD PMID:26598702 Akr1a1 Rat Dibutyl phosphate affects expression ISO AKR1A1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of AKR1A1 mRNA CTD PMID:37042841 Akr1a1 Rat dichlorine increases expression EXP 6480464 Chlorine results in increased expression of AKR1A1 mRNA CTD PMID:18636392 Akr1a1 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of AKR1A1 mRNA CTD PMID:18636392 Akr1a1 Rat diethyl maleate increases expression EXP 6480464 diethyl maleate results in increased expression of AKR1A1 protein CTD PMID:21161181 Akr1a1 Rat diuron decreases expression ISO AKR1A1 (Homo sapiens) 6480464 Diuron results in decreased expression of AKR1A1 mRNA CTD PMID:35967413 Akr1a1 Rat doxorubicin increases reduction ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 protein results in increased reduction of Doxorubicin CTD PMID:18322072 Akr1a1 Rat doxorubicin affects metabolic processing ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 SNP affects the metabolism of Doxorubicin CTD PMID:18276838 Akr1a1 Rat doxorubicin multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [AKR1A1 results in increased metabolism of Doxorubicin] which results in increased chemical synthesis of adriamycinol CTD PMID:18276838 Akr1a1 Rat doxorubicin increases metabolic processing ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 results in increased metabolism of Doxorubicin CTD PMID:18276838 Akr1a1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of AKR1A1 mRNA CTD PMID:29391264 Akr1a1 Rat enzyme inhibitor multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of AKR1A1 protein CTD PMID:23301498 Akr1a1 Rat ethanol affects splicing ISO Akr1a1 (Mus musculus) 6480464 Ethanol affects the splicing of AKR1A1 mRNA CTD PMID:30319688 Akr1a1 Rat Fidarestat multiple interactions ISO Akr1a1 (Mus musculus) 6480464 fidarestat inhibits the reaction [Glucose results in decreased expression of AKR1A1 mRNA] CTD PMID:16805838 Akr1a1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of AKR1A1 mRNA CTD PMID:24136188 Akr1a1 Rat folic acid multiple interactions ISO Akr1a1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of AKR1A1 mRNA] CTD PMID:22206623 Akr1a1 Rat fumonisin B1 increases expression ISO Akr1a1 (Mus musculus) 6480464 fumonisin B1 results in increased expression of AKR1A1 mRNA CTD PMID:16221962 Akr1a1 Rat furan increases expression EXP 6480464 furan results in increased expression of AKR1A1 mRNA CTD PMID:25539665 and PMID:26194646 Akr1a1 Rat furfural multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Akr1a1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of AKR1A1 mRNA CTD PMID:22061828 Akr1a1 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of AKR1A1 mRNA CTD PMID:24136188 Akr1a1 Rat glucose multiple interactions ISO Akr1a1 (Mus musculus) 6480464 fidarestat inhibits the reaction [Glucose results in decreased expression of AKR1A1 mRNA] CTD PMID:16805838 Akr1a1 Rat glucose decreases expression ISO Akr1a1 (Mus musculus) 6480464 Glucose results in decreased expression of AKR1A1 mRNA CTD PMID:16805838 Akr1a1 Rat glucuronic acid increases reduction ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 protein results in increased reduction of Glucuronic Acid CTD PMID:10510318 Akr1a1 Rat glucuronic acid increases reduction EXP 6480464 AKR1A1 protein results in increased reduction of Glucuronic Acid CTD PMID:29763686 Akr1a1 Rat glyceraldehyde decreases activity ISO AKR1A1 (Homo sapiens) 6480464 Glyceraldehyde results in decreased activity of AKR1A1 protein CTD PMID:30469331 Akr1a1 Rat glycidyl methacrylate decreases expression ISO AKR1A1 (Homo sapiens) 6480464 glycidyl methacrylate results in decreased expression of AKR1A1 protein CTD PMID:36641056 Akr1a1 Rat glycochenodeoxycholic acid multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of AKR1A1 mRNA CTD PMID:32152650 Akr1a1 Rat glycocholic acid multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of AKR1A1 mRNA CTD PMID:32152650 Akr1a1 Rat glycodeoxycholic acid multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of AKR1A1 mRNA CTD PMID:32152650 Akr1a1 Rat hexane-2,3-dione increases reduction ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 protein results in increased reduction of 2 and 3-hexanedione CTD PMID:10510318 Akr1a1 Rat hydralazine multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of AKR1A1 mRNA CTD PMID:17183730 Akr1a1 Rat hypochlorous acid increases expression ISO Akr1a1 (Mus musculus) 6480464 Hypochlorous Acid results in increased expression of AKR1A1 mRNA CTD PMID:19376150 Akr1a1 Rat indometacin multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of AKR1A1 mRNA CTD PMID:28628672 Akr1a1 Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of AKR1A1 mRNA CTD PMID:36868495 Akr1a1 Rat inulin multiple interactions ISO Akr1a1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of AKR1A1 mRNA CTD PMID:36331819 Akr1a1 Rat isotretinoin decreases expression ISO AKR1A1 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of AKR1A1 mRNA CTD PMID:20436886 Akr1a1 Rat ivermectin decreases expression ISO AKR1A1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of AKR1A1 protein CTD PMID:32959892 Akr1a1 Rat L-ascorbic acid decreases abundance ISO Akr1a1 (Mus musculus) 6480464 AKR1A1 gene mutant form results in decreased abundance of Ascorbic Acid CTD PMID:32805337 Akr1a1 Rat L-ascorbic acid multiple interactions ISO Akr1a1 (Mus musculus) 6480464 [AKR1A1 gene mutant form results in increased susceptibility to Diethylnitrosamine] which results in decreased abundance of Ascorbic Acid and AKR1A1 gene mutant form promotes the reaction [Diethylnitrosamine results in decreased abundance of Ascorbic Acid] CTD PMID:32805337 Akr1a1 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of AKR1A1 mRNA CTD PMID:19483382 Akr1a1 Rat manganese atom multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AKR1A1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of AKR1A1 mRNA CTD PMID:39836092 Akr1a1 Rat manganese(0) multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AKR1A1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of AKR1A1 mRNA CTD PMID:39836092 Akr1a1 Rat manganese(II) chloride multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AKR1A1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of AKR1A1 mRNA CTD PMID:39836092 Akr1a1 Rat methidathion increases expression ISO Akr1a1 (Mus musculus) 6480464 methidathion results in increased expression of AKR1A1 mRNA CTD PMID:34813904 Akr1a1 Rat methylglyoxal increases reduction ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 protein results in increased reduction of Pyruvaldehyde CTD PMID:10510318 Akr1a1 Rat methylglyoxal increases reduction EXP 6480464 AKR1A1 protein results in increased reduction of Pyruvaldehyde CTD PMID:29763686 Akr1a1 Rat monosodium L-glutamate increases expression ISO Akr1a1 (Mus musculus) 6480464 Sodium Glutamate results in increased expression of AKR1A1 mRNA and Sodium Glutamate results in increased expression of AKR1A1 protein CTD PMID:25473020 Akr1a1 Rat Muconic dialdehyde increases reduction ISO Akr1a1 (Mus musculus) 6480464 AKR1A1 protein results in increased reduction of muconaldehyde CTD PMID:16289176 Akr1a1 Rat Muconic dialdehyde multiple interactions ISO Akr1a1 (Mus musculus) 6480464 pyrazole inhibits the reaction [AKR1A1 protein results in increased reduction of muconaldehyde] CTD PMID:16289176 Akr1a1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of AKR1A1 mRNA CTD PMID:17602206 Akr1a1 Rat N-nitrosodiethylamine increases response to substance ISO Akr1a1 (Mus musculus) 6480464 AKR1A1 gene mutant form results in increased susceptibility to Diethylnitrosamine CTD PMID:32805337 Akr1a1 Rat N-nitrosodiethylamine multiple interactions ISO Akr1a1 (Mus musculus) 6480464 [AKR1A1 gene mutant form results in increased susceptibility to Diethylnitrosamine] which results in decreased abundance of Ascorbic Acid and AKR1A1 gene mutant form promotes the reaction [Diethylnitrosamine results in decreased abundance of Ascorbic Acid] CTD PMID:32805337 Akr1a1 Rat NAD zwitterion multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 NAD promotes the reaction [AKR1A1 protein affects the chemical synthesis of benzo(a)pyrene-7 more ... CTD PMID:15720144 Akr1a1 Rat NAD(+) multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 NAD promotes the reaction [AKR1A1 protein affects the chemical synthesis of benzo(a)pyrene-7 more ... CTD PMID:15720144 Akr1a1 Rat NADP zwitterion multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [AKR1A1 protein co-treated with NADP] results in increased oxidation of and affects the activity of benzo(a)pyrene 7 more ... CTD PMID:15720144 and PMID:21910479 Akr1a1 Rat NADP(+) multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [AKR1A1 protein co-treated with NADP] results in increased oxidation of and affects the activity of benzo(a)pyrene 7 more ... CTD PMID:15720144 and PMID:21910479 Akr1a1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of AKR1A1 mRNA CTD PMID:24136188 Akr1a1 Rat nicotine multiple interactions ISO Akr1a1 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Akr1a1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of AKR1A1 mRNA CTD PMID:24136188 Akr1a1 Rat nitrates multiple interactions ISO Akr1a1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of AKR1A1 mRNA CTD PMID:35964746 Akr1a1 Rat Nutlin-3 multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of AKR1A1 protein CTD PMID:38460933 Akr1a1 Rat ochratoxin A decreases expression ISO AKR1A1 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of AKR1A1 mRNA CTD PMID:32905824 Akr1a1 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of AKR1A1 mRNA CTD PMID:19483382 Akr1a1 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of AKR1A1 mRNA CTD PMID:18636392 Akr1a1 Rat pentachlorophenol increases expression ISO Akr1a1 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of AKR1A1 mRNA CTD PMID:23892564 Akr1a1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Akr1a1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of AKR1A1 mRNA more ... CTD PMID:36331819 Akr1a1 Rat perfluorooctanoic acid affects expression ISO Akr1a1 (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of AKR1A1 mRNA CTD PMID:18281256 Akr1a1 Rat phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of AKR1A1 mRNA CTD PMID:19768707 Akr1a1 Rat phenobarbital affects expression ISO AKR1A1 (Homo sapiens) 6480464 Phenobarbital affects the expression of AKR1A1 mRNA CTD PMID:19159669 Akr1a1 Rat Phenylglyoxal increases reduction ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 protein results in increased reduction of Phenylglyoxal CTD PMID:10510318 Akr1a1 Rat phlorizin decreases expression ISO Akr1a1 (Mus musculus) 6480464 Phlorhizin results in decreased expression of AKR1A1 mRNA CTD PMID:22538082 Akr1a1 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of AKR1A1 mRNA CTD PMID:19483382 Akr1a1 Rat pyrogallol increases expression ISO Akr1a1 (Mus musculus) 6480464 Pyrogallol results in increased expression of AKR1A1 mRNA CTD PMID:20362636 Akr1a1 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of AKR1A1 mRNA CTD PMID:19072884 Akr1a1 Rat sodium arsenite multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AKR1A1 mRNA CTD PMID:39836092 Akr1a1 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of AKR1A1 protein CTD PMID:29459688 Akr1a1 Rat sodium chloride multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of AKR1A1 protein more ... CTD PMID:38598786 Akr1a1 Rat sodium dichromate increases expression ISO Akr1a1 (Mus musculus) 6480464 sodium bichromate results in increased expression of AKR1A1 mRNA CTD PMID:22155349 Akr1a1 Rat sodium dichromate decreases expression ISO AKR1A1 (Homo sapiens) 6480464 sodium bichromate results in decreased expression of AKR1A1 mRNA CTD PMID:17685462 Akr1a1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of AKR1A1 mRNA CTD PMID:22561333 Akr1a1 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of AKR1A1 protein CTD PMID:19634143 Akr1a1 Rat streptozocin multiple interactions EXP 6480464 Trientine inhibits the reaction [Streptozocin results in increased expression of AKR1A1 protein] CTD PMID:19634143 Akr1a1 Rat succinic semialdehyde increases reduction ISO AKR1A1 (Homo sapiens) 6480464 AKR1A1 protein results in increased reduction of succinic semialdehyde CTD PMID:10510318 and PMID:21276435 Akr1a1 Rat tetrachloroethene decreases expression ISO Akr1a1 (Mus musculus) 6480464 Tetrachloroethylene results in decreased expression of AKR1A1 mRNA CTD PMID:28973375 Akr1a1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of AKR1A1 mRNA CTD PMID:19483382 Akr1a1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of AKR1A1 mRNA CTD PMID:34492290 Akr1a1 Rat thioacetamide multiple interactions ISO Akr1a1 (Mus musculus) 6480464 AKR1A1 protein affects the reaction [Thioacetamide results in increased activity of GPT protein] and AKR1A1 protein affects the reaction [Thioacetamide results in increased expression of DDIT3 protein] CTD PMID:29763686 Akr1a1 Rat thioacetamide increases response to substance ISO Akr1a1 (Mus musculus) 6480464 AKR1A1 protein results in increased susceptibility to Thioacetamide CTD PMID:29763686 Akr1a1 Rat urethane decreases expression ISO AKR1A1 (Homo sapiens) 6480464 Urethane results in decreased expression of AKR1A1 mRNA CTD PMID:28818685 Akr1a1 Rat valproic acid multiple interactions ISO AKR1A1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of AKR1A1 mRNA CTD PMID:17183730 Akr1a1 Rat valproic acid affects expression ISO AKR1A1 (Homo sapiens) 6480464 Valproic Acid affects the expression of AKR1A1 mRNA CTD PMID:25979313 Akr1a1 Rat valproic acid affects expression ISO Akr1a1 (Mus musculus) 6480464 Valproic Acid affects the expression of AKR1A1 mRNA CTD PMID:17292431 Akr1a1 Rat Yessotoxin increases expression ISO AKR1A1 (Homo sapiens) 6480464 yessotoxin analog results in increased expression of AKR1A1 mRNA CTD PMID:30679557 Akr1a1 Rat zinc atom decreases expression EXP 6480464 Zinc deficiency results in decreased expression of AKR1A1 mRNA CTD PMID:11717422 Akr1a1 Rat zinc(0) decreases expression EXP 6480464 Zinc deficiency results in decreased expression of AKR1A1 mRNA CTD PMID:11717422 Akr1a1 Rat zoledronic acid increases expression ISO AKR1A1 (Homo sapiens) 6480464 zoledronic acid results in increased expression of AKR1A1 mRNA CTD PMID:24714768
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 1,2-naphthoquinone (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 13-dihydrodaunorubicin (ISO) 16-Ketoestrone (ISO) 17alpha-ethynylestradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 1H-pyrazole (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2,2-tetramine (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrotoluene (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (ISO) 3-nitrobenzaldehyde (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-formylbenzoic acid (ISO) 4-hydroxynon-2-enal (ISO) 4-nitrobenzaldehyde (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) 9,10-phenanthroquinone (ISO) acrolein (EXP,ISO) actinomycin D (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) amiodarone (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) arecoline (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atrazine (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) Benzo[a]pyrene-7,8-diol (ISO) benzo[a]pyrene-7,8-dione (ISO) beta-naphthoflavone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) capsaicin (EXP) carbamazepine (ISO) chenodeoxycholic acid (ISO) chlorpyrifos (ISO) cisplatin (ISO) clofibrate (EXP) clofibric acid (EXP) cobalt dichloride (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) crotonaldehyde (EXP) cyclosporin A (ISO) D-glucose (ISO) D-glyceraldehyde (ISO) daunorubicin (ISO) deoxycholic acid (ISO) dexamethasone (ISO) Diallyl sulfide (EXP) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dichlorine (EXP) diethyl maleate (EXP) diuron (ISO) doxorubicin (ISO) endosulfan (EXP) enzyme inhibitor (ISO) ethanol (ISO) Fidarestat (ISO) flutamide (EXP) folic acid (ISO) fumonisin B1 (ISO) furan (EXP) furfural (ISO) gentamycin (EXP) glafenine (EXP) glucose (ISO) glucuronic acid (EXP,ISO) glyceraldehyde (ISO) glycidyl methacrylate (ISO) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) hexane-2,3-dione (ISO) hydralazine (ISO) hypochlorous acid (ISO) indometacin (EXP,ISO) inulin (ISO) isotretinoin (ISO) ivermectin (ISO) L-ascorbic acid (ISO) L-ethionine (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methidathion (ISO) methylglyoxal (EXP,ISO) monosodium L-glutamate (ISO) Muconic dialdehyde (ISO) N-nitrosodiethylamine (EXP,ISO) NAD zwitterion (ISO) NAD(+) (ISO) NADP zwitterion (ISO) NADP(+) (ISO) nefazodone (EXP) nicotine (ISO) nimesulide (EXP) nitrates (ISO) Nutlin-3 (ISO) ochratoxin A (ISO) omeprazole (EXP) ozone (EXP) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP,ISO) Phenylglyoxal (ISO) phlorizin (ISO) pirinixic acid (EXP) pyrogallol (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) sodium dichromate (EXP,ISO) streptozocin (EXP) succinic semialdehyde (ISO) tetrachloroethene (ISO) thioacetamide (EXP,ISO) urethane (ISO) valproic acid (ISO) Yessotoxin (ISO) zinc atom (EXP) zinc(0) (EXP) zoledronic acid (ISO)
Biological Process
aldehyde catabolic process (IEA,ISO) cellular detoxification of aldehyde (IDA,IEA,ISO) D-glucuronate catabolic process (IEA,IMP,ISO) D-glucuronate catabolic process to D-xylulose 5-phosphate (IEA,ISO) daunorubicin metabolic process (IEA,ISO) doxorubicin metabolic process (IEA,ISO) L-ascorbic acid biosynthetic process (IEA,IMP,ISO) lipid metabolic process (IEA) negative regulation of apoptotic process (IDA)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
The role of cytochromes p450 and aldo-keto reductases in prognosis of breast carcinoma patients.
Hlaváč V, etal., Medicine (Baltimore). 2014 Dec;93(28):e255. doi: 10.1097/MD.0000000000000255.
3.
Mice deficient in aldo-keto reductase 1a (Akr1a) are resistant to thioacetamide-induced liver injury.
Homma T, etal., Toxicol Lett. 2018 Sep 15;294:37-43. doi: 10.1016/j.toxlet.2018.05.015. Epub 2018 May 12.
4.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
5.
Reductive detoxification of acrolein as a potential role for aldehyde reductase (AKR1A) in mammals.
Kurahashi T, etal., Biochem Biophys Res Commun. 2014 Sep 12;452(1):136-41. doi: 10.1016/j.bbrc.2014.08.072. Epub 2014 Aug 21.
6.
Evaluation of the prostaglandin F synthase activity of human and bovine aldo-keto reductases: AKR1A1s complement AKR1B1s as potent PGF synthases.
Lacroix Pepin N, etal., Prostaglandins Other Lipid Mediat. 2013 Oct;106:124-32. doi: 10.1016/j.prostaglandins.2013.05.005. Epub 2013 Jun 6.
7.
Identification of a novel glycolysis-related gene signature that can predict the survival of patients with lung adenocarcinoma.
Liu C, etal., Cell Cycle. 2019 Mar;18(5):568-579. doi: 10.1080/15384101.2019.1578146. Epub 2019 Feb 17.
8.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
9.
New developments in anthracycline-induced cardiotoxicity.
Mordente A, etal., Curr Med Chem. 2009;16(13):1656-72.
10.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
13.
GOA pipeline
RGD automated data pipeline
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Comprehensive gene review and curation
RGD comprehensive gene curation
16.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
17.
Overexpression of aldehyde reductase protects PC12 cells from the cytotoxicity of methylglyoxal or 3-deoxyglucosone.
Suzuki K, etal., J Biochem. 1998 Feb;123(2):353-7.
18.
In vivo role of aldehyde reductase.
Takahashi M, etal., Biochim Biophys Acta. 2012 Nov;1820(11):1787-96. doi: 10.1016/j.bbagen.2012.07.003. Epub 2012 Jul 20.
19.
Identity of a major 3-deoxyglucosone-reducing enzyme with aldehyde reductase in rat liver established by amino acid sequencing and cDNA expression.
Takahashi M, etal., Gene 1993 May 30;127(2):249-53.
20.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
21.
Doxorubicin pathways: pharmacodynamics and adverse effects.
Thorn CF, etal., Pharmacogenet Genomics. 2011 Jul;21(7):440-6. doi: 10.1097/FPC.0b013e32833ffb56.
22.
Author Correction: Metabolic reprogramming by the S-nitroso-CoA reductase system protects against kidney injury.
Zhou HL, etal., Nature. 2019 Jun;570(7759):E23. doi: 10.1038/s41586-019-1225-0.
Akr1a1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 135,329,605 - 135,367,037 (-) NCBI GRCr8 mRatBN7.2 5 130,092,945 - 130,130,277 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 130,092,732 - 130,113,674 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 132,717,057 - 132,734,057 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 134,471,650 - 134,488,650 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 134,494,047 - 134,511,049 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 135,482,068 - 135,498,693 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 135,482,068 - 135,498,822 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 139,278,242 - 139,294,867 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 136,920,561 - 136,937,422 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 136,925,785 - 136,942,923 (-) NCBI Celera 5 128,620,481 - 128,637,092 (-) NCBI Celera Cytogenetic Map 5 q35 NCBI
AKR1A1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 45,550,826 - 45,570,049 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 45,550,543 - 45,570,049 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 46,016,498 - 46,035,721 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 45,789,085 - 45,808,308 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 45,685,590 - 45,704,813 NCBI Celera 1 44,300,464 - 44,319,706 (+) NCBI Celera Cytogenetic Map 1 p34.1 NCBI HuRef 1 44,127,818 - 44,147,063 (+) NCBI HuRef CHM1_1 1 46,133,579 - 46,152,870 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 45,423,192 - 45,442,415 (+) NCBI T2T-CHM13v2.0
Akr1a1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 116,493,707 - 116,508,871 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 116,493,707 - 116,508,877 (-) Ensembl GRCm39 Ensembl GRCm38 4 116,636,510 - 116,651,674 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 116,636,510 - 116,651,680 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 116,309,115 - 116,324,256 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 116,134,442 - 116,149,583 (-) NCBI MGSCv36 mm8 Celera 4 115,370,207 - 115,385,626 (-) NCBI Celera Cytogenetic Map 4 D1 NCBI cM Map 4 53.26 NCBI
Akr1a1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955464 12,714,717 - 12,729,662 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955464 12,715,238 - 12,729,034 (-) NCBI ChiLan1.0 ChiLan1.0
AKR1A1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 181,239,683 - 181,257,580 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 180,381,197 - 180,399,087 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 44,853,867 - 44,871,764 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 46,211,859 - 46,230,072 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 46,211,859 - 46,230,072 (+) Ensembl panpan1.1 panPan2
AKR1A1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 14,792,398 - 14,808,805 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 14,742,012 - 14,808,592 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 14,913,465 - 14,929,729 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 14,947,192 - 14,963,694 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 14,896,489 - 14,963,353 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 14,744,329 - 14,760,787 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 14,814,053 - 14,828,473 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 14,884,045 - 14,900,543 (-) NCBI UU_Cfam_GSD_1.0
Akr1a1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 60,855,920 - 60,872,212 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 26,680,676 - 26,697,214 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 26,680,736 - 26,696,996 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
AKR1A1
AKR1A1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 87,228,348 - 87,245,511 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 87,228,189 - 87,245,466 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 29,719,096 - 29,738,521 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Akr1a1
.
Predicted Target Of
Count of predictions: 81 Count of miRNA genes: 69 Interacting mature miRNAs: 72 Transcripts: ENSRNOT00000023072 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 1300122 Wbc1 White blood cell count QTL 1 2.75 leukocyte quantity (VT:0000217) total white blood cell count (CMO:0000365) 5 125392826 139989768 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 7411582 Foco3 Food consumption QTL 3 7.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 7411564 Bw135 Body weight QTL 135 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 87468046 132468046 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 7365049 Bp359 Blood pressure QTL 359 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128071929 134724733 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 1331803 Rf32 Renal function QTL 32 2.798 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 129132428 143070159 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 1581505 Rf54 Renal function QTL 54 kidney physiology trait (VT:0002136) kidney 20-HETE level (CMO:0001854) 5 128033842 133011550 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 7411601 Foco12 Food consumption QTL 12 19.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 7394710 Emca12 Estrogen-induced mammary cancer QTL 12 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 124160767 133749643 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 6903316 Bw113 Body weight QTL 113 2 0.0103 body mass (VT:0001259) body weight (CMO:0000012) 5 87765973 132765973 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000023072 ⟹ ENSRNOP00000023072
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 130,092,963 - 130,113,674 (-) Ensembl Rnor_6.0 Ensembl 5 135,482,068 - 135,498,822 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000101228 ⟹ ENSRNOP00000092196
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 130,092,732 - 130,097,916 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114894 ⟹ ENSRNOP00000081527
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 130,094,166 - 130,113,674 (-) Ensembl
RefSeq Acc Id:
NM_031000 ⟹ NP_112262
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 135,329,606 - 135,346,231 (-) NCBI mRatBN7.2 5 130,092,946 - 130,109,575 (-) NCBI Rnor_6.0 5 135,482,068 - 135,498,693 (-) NCBI Rnor_5.0 5 139,278,242 - 139,294,867 (-) NCBI RGSC_v3.4 5 136,920,561 - 136,937,422 (-) RGD Celera 5 128,620,481 - 128,637,092 (-) RGD
Sequence:
GAATTCTGGCCACTTTGTCTTCTCCACAGCCTGTGCTCATTGCCAAGGGGACAATGACGGCCTCCAGTGTCCTCCTGCACACTGGACAGAAGATGCCTCTGATTGGTCTGGGGACATGGAAGAGTGAG
hide sequence
RefSeq Acc Id:
XM_039110816 ⟹ XP_038966744
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 135,329,605 - 135,367,037 (-) NCBI mRatBN7.2 5 130,092,945 - 130,130,277 (-) NCBI
RefSeq Acc Id:
NP_112262 ⟸ NM_031000
- UniProtKB:
P51635 (UniProtKB/Swiss-Prot), A6JZ88 (UniProtKB/TrEMBL), A0A8I6AVC9 (UniProtKB/TrEMBL)
- Sequence:
MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKN
hide sequence
Ensembl Acc Id:
ENSRNOP00000023072 ⟸ ENSRNOT00000023072
RefSeq Acc Id:
XP_038966744 ⟸ XM_039110816
- Peptide Label:
isoform X1
- UniProtKB:
P51635 (UniProtKB/Swiss-Prot), A6JZ88 (UniProtKB/TrEMBL), A0A8I6AVC9 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000081527 ⟸ ENSRNOT00000114894
Ensembl Acc Id:
ENSRNOP00000092196 ⟸ ENSRNOT00000101228
RGD ID: 13693937 Promoter ID: EPDNEW_R4462 Type: initiation region Name: Akr1a1_1 Description: aldo-keto reductase family 1 member A1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 135,498,706 - 135,498,766 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-06-08
Akr1a1
aldo-keto reductase family 1 member A1
Akr1a1
aldo-keto reductase family 1, member A1 (aldehyde reductase)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-18
Akr1a1
aldo-keto reductase family 1, member A1 (aldehyde reductase)
Akr1a1
aldo-keto reductase family 1, member A1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Akr1a1
aldo-keto reductase family 1, member A1
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_function
catalyzes the NADPH-dependent reduction of 3-deoxyglucosone (3-DG)
724707
