Symbol:
Pik3r2
Name:
phosphoinositide-3-kinase regulatory subunit 2
RGD ID:
68341
Description:
Predicted to enable several functions, including 1-phosphatidylinositol-3-kinase regulator activity; enzyme binding activity; and phosphatidylinositol 3-kinase regulatory subunit binding activity. Involved in negative regulation of cell migration involved in sprouting angiogenesis. Predicted to be located in focal adhesion and nucleus. Predicted to be part of phosphatidylinositol 3-kinase complex, class IA. Biomarker of hepatocellular carcinoma. Human ortholog(s) of this gene implicated in pancreatic ductal adenocarcinoma. Orthologous to human PIK3R2 (phosphoinositide-3-kinase regulatory subunit 2); PARTICIPATES IN epidermal growth factor/neuregulin signaling pathway; FasL mediated signaling pathway; phosphatidylinositol 3-kinase class I signaling pathway; INTERACTS WITH 2,6-dinitrotoluene; ammonium chloride; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MGC108697; phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta; phosphatidylinositol 3-kinase regulartory subunit polypeptide 2; phosphatidylinositol 3-kinase regulatory subunit beta; phosphatidylinositol 3-kinase regulatory subunit polypeptide 2 (p85 beta); phosphatidylinositol 3-kinase, regulartory subunit, polypeptide 2; phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 2; phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 2 (p85 beta); phosphoinositide-3-kinase, regulatory subunit 2 (beta); PI3-kinase p85 subunit beta; PI3-kinase regulatory subunit beta; PI3-kinase subunit p85-beta; PI3K regulatory subunit beta; ptdIns-3-kinase p85-beta; ptdIns-3-kinase regulatory subunit beta; ptdIns-3-kinase regulatory subunit p85-beta
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 18,699,389 - 18,708,045 (+) NCBI GRCr8 mRatBN7.2 16 18,665,517 - 18,674,067 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 18,665,457 - 18,674,065 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 18,707,923 - 18,716,460 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 19,840,602 - 19,849,140 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 18,760,867 - 18,769,404 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 20,415,109 - 20,424,982 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 20,416,432 - 20,424,980 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 20,273,500 - 20,282,051 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 19,171,101 - 19,179,650 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 19,171,098 - 19,179,648 (+) NCBI Celera 16 18,857,756 - 18,866,282 (+) NCBI Celera Cytogenetic Map 16 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pik3r2 Rat (-)-demecolcine decreases expression ISO PIK3R2 (Homo sapiens) 6480464 Demecolcine results in decreased expression of PIK3R2 mRNA CTD PMID:23649840 Pik3r2 Rat 1,2-dimethylhydrazine decreases expression ISO Pik3r2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PIK3R2 mRNA CTD PMID:22206623 Pik3r2 Rat 1,2-dimethylhydrazine multiple interactions ISO Pik3r2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PIK3R2 mRNA CTD PMID:22206623 Pik3r2 Rat 17beta-estradiol decreases expression ISO PIK3R2 (Homo sapiens) 6480464 Estradiol results in decreased expression of PIK3R2 mRNA CTD PMID:16705744 and PMID:23373633 Pik3r2 Rat 17beta-estradiol increases expression ISO Pik3r2 (Mus musculus) 6480464 Estradiol results in increased expression of PIK3R2 mRNA CTD PMID:39298647 Pik3r2 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO PIK3R2 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Pik3r2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Pik3r2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PIK3R2 mRNA CTD PMID:19465110 Pik3r2 Rat 2,4,6-tribromophenol decreases expression ISO PIK3R2 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Pik3r2 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PIK3R2 mRNA CTD PMID:21346803 Pik3r2 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO PIK3R2 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of PIK3R2 protein CTD PMID:31675489 Pik3r2 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Pik3r2 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of PIK3R2 mRNA CTD PMID:20188158 Pik3r2 Rat 4,4'-sulfonyldiphenol affects methylation ISO Pik3r2 (Mus musculus) 6480464 bisphenol S affects the methylation of PIK3R2 exon and bisphenol S affects the methylation of PIK3R2 gene CTD PMID:31683443 and PMID:33297965 Pik3r2 Rat 4-hydroxynon-2-enal decreases expression ISO PIK3R2 (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of PIK3R2 mRNA CTD PMID:12419474 Pik3r2 Rat acrolein multiple interactions ISO PIK3R2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PIK3R2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of PIK3R2 mRNA CTD PMID:32699268 Pik3r2 Rat acrylamide decreases expression ISO PIK3R2 (Homo sapiens) 6480464 Acrylamide results in decreased expression of PIK3R2 mRNA CTD PMID:32763439 Pik3r2 Rat acrylamide increases expression ISO Pik3r2 (Mus musculus) 6480464 Acrylamide results in increased expression of PIK3R2 mRNA CTD PMID:38152866 Pik3r2 Rat aflatoxin B1 decreases methylation ISO PIK3R2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PIK3R2 exon CTD PMID:30157460 Pik3r2 Rat Aflatoxin B2 alpha increases methylation ISO PIK3R2 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of PIK3R2 intron CTD PMID:30157460 Pik3r2 Rat alpha-pinene multiple interactions ISO PIK3R2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PIK3R2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of PIK3R2 mRNA CTD PMID:32699268 Pik3r2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PIK3R2 mRNA CTD PMID:16483693 Pik3r2 Rat antimonite multiple interactions ISO PIK3R2 (Homo sapiens) 6480464 [Antimony Potassium Tartrate results in increased abundance of antimonite] which results in decreased expression of PIK3R2 mRNA CTD PMID:32076005 Pik3r2 Rat arsenous acid decreases expression ISO PIK3R2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of PIK3R2 mRNA CTD PMID:20458559 Pik3r2 Rat benzo[a]pyrene affects expression ISO PIK3R2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the expression of PIK3R2 mRNA CTD PMID:21873647 Pik3r2 Rat benzo[a]pyrene increases expression ISO Pik3r2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PIK3R2 mRNA CTD PMID:22228805 Pik3r2 Rat benzo[a]pyrene decreases expression ISO Pik3r2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PIK3R2 mRNA CTD PMID:22228805 Pik3r2 Rat beta-lapachone increases expression ISO PIK3R2 (Homo sapiens) 6480464 beta-lapachone results in increased expression of PIK3R2 mRNA CTD PMID:38218311 Pik3r2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PIK3R2 mRNA CTD PMID:25181051 more ... Pik3r2 Rat bisphenol A decreases methylation ISO PIK3R2 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of PIK3R2 gene CTD PMID:31601247 Pik3r2 Rat bisphenol A decreases expression ISO PIK3R2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PIK3R2 protein CTD PMID:31675489 Pik3r2 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of PIK3R2 mRNA CTD PMID:19167457 Pik3r2 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of PIK3R2 mRNA CTD PMID:33453195 Pik3r2 Rat cadmium dichloride decreases expression ISO PIK3R2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of PIK3R2 mRNA CTD PMID:33129824 Pik3r2 Rat cannabidiol multiple interactions ISO PIK3R2 (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of PIK3R2 mRNA CTD PMID:32992648 Pik3r2 Rat carbamazepine affects expression ISO PIK3R2 (Homo sapiens) 6480464 Carbamazepine affects the expression of PIK3R2 mRNA CTD PMID:24752500 Pik3r2 Rat chloropicrin decreases expression ISO PIK3R2 (Homo sapiens) 6480464 chloropicrin results in decreased expression of PIK3R2 mRNA CTD PMID:26352163 Pik3r2 Rat cisplatin multiple interactions ISO PIK3R2 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of PIK3R2 mRNA CTD PMID:27392435 Pik3r2 Rat clofibrate decreases expression ISO Pik3r2 (Mus musculus) 6480464 Clofibrate results in decreased expression of PIK3R2 mRNA CTD PMID:23811191 Pik3r2 Rat cobalt dichloride decreases expression ISO PIK3R2 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PIK3R2 mRNA CTD PMID:22941251 Pik3r2 Rat cyclosporin A decreases expression ISO PIK3R2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PIK3R2 mRNA CTD PMID:25562108 Pik3r2 Rat diarsenic trioxide decreases expression ISO PIK3R2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of PIK3R2 mRNA CTD PMID:20458559 Pik3r2 Rat diazinon increases methylation ISO PIK3R2 (Homo sapiens) 6480464 Diazinon results in increased methylation of PIK3R2 gene CTD PMID:22964155 Pik3r2 Rat diclofenac affects expression ISO PIK3R2 (Homo sapiens) 6480464 Diclofenac affects the expression of PIK3R2 mRNA CTD PMID:24752500 Pik3r2 Rat dicrotophos increases expression ISO PIK3R2 (Homo sapiens) 6480464 dicrotophos results in increased expression of PIK3R2 mRNA CTD PMID:28302478 Pik3r2 Rat dioxygen multiple interactions ISO PIK3R2 (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of PIK3R2 mRNA and [Oxygen co-treated with Ozone] results in decreased expression of PIK3R2 mRNA CTD PMID:32992648 Pik3r2 Rat dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate multiple interactions ISO PIK3R2 (Homo sapiens) 6480464 [Antimony Potassium Tartrate results in increased abundance of antimonite] which results in decreased expression of PIK3R2 mRNA CTD PMID:32076005 Pik3r2 Rat diquat decreases expression ISO Pik3r2 (Mus musculus) 6480464 Diquat results in decreased expression of PIK3R2 protein CTD PMID:36851058 Pik3r2 Rat doxorubicin increases expression ISO PIK3R2 (Homo sapiens) 6480464 Doxorubicin results in increased expression of PIK3R2 mRNA CTD PMID:37062353 Pik3r2 Rat endosulfan decreases expression ISO PIK3R2 (Homo sapiens) 6480464 Endosulfan results in decreased expression of PIK3R2 mRNA CTD PMID:32044604 Pik3r2 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of PIK3R2 mRNA CTD PMID:31464424 Pik3r2 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of PIK3R2 mRNA CTD PMID:20655511 Pik3r2 Rat ethanol multiple interactions ISO Pik3r2 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of PIK3R2 mRNA CTD PMID:30319688 Pik3r2 Rat folic acid multiple interactions ISO Pik3r2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PIK3R2 mRNA CTD PMID:22206623 Pik3r2 Rat genistein decreases expression ISO PIK3R2 (Homo sapiens) 6480464 Genistein results in decreased expression of PIK3R2 mRNA CTD PMID:16705744 Pik3r2 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PIK3R2 mRNA CTD PMID:33387578 Pik3r2 Rat hydrogen peroxide decreases expression ISO PIK3R2 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of PIK3R2 mRNA CTD PMID:12419474 Pik3r2 Rat ivermectin decreases expression ISO PIK3R2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PIK3R2 protein CTD PMID:32959892 Pik3r2 Rat N-nitrosodiethylamine increases expression EXP 152177911 N-nitrosodiethylamine increases expression of PI3Kp85 protein in liver in rats RGD Pik3r2 Rat N-Vinyl-2-pyrrolidone multiple interactions EXP 6480464 [N-vinyl-2-pyrrolidinone binds to N-vinyl-2-pyrrolidinone] which results in increased expression of PIK3R2 mRNA CTD PMID:22037397 Pik3r2 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of PIK3R2 mRNA CTD PMID:22546817 Pik3r2 Rat Nor-9-carboxy-delta9-THC multiple interactions ISO PIK3R2 (Homo sapiens) 6480464 [Cannabinoids results in increased abundance of 11-nor-delta(9)-tetrahydrocannabinol-9-carboxylic acid] which affects the methylation of PIK3R2 gene CTD PMID:30521419 Pik3r2 Rat oxaliplatin increases expression ISO PIK3R2 (Homo sapiens) 6480464 oxaliplatin results in increased expression of PIK3R2 mRNA CTD PMID:17762391 Pik3r2 Rat ozone multiple interactions ISO PIK3R2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PIK3R2 mRNA more ... CTD PMID:32699268 and PMID:32992648 Pik3r2 Rat paracetamol increases expression ISO PIK3R2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of PIK3R2 mRNA CTD PMID:29067470 Pik3r2 Rat pentachlorophenol increases expression ISO Pik3r2 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of PIK3R2 mRNA CTD PMID:23892564 Pik3r2 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of PIK3R2 mRNA CTD PMID:22037397 Pik3r2 Rat potassium dichromate increases expression ISO PIK3R2 (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of PIK3R2 protein CTD PMID:23718831 Pik3r2 Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [Air Pollutants and Occupational results in increased phosphorylation of PIK3R2 protein] CTD PMID:37467934 Pik3r2 Rat resveratrol multiple interactions ISO PIK3R2 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of PIK3R2 mRNA CTD PMID:23557933 Pik3r2 Rat sodium arsenite affects expression ISO PIK3R2 (Homo sapiens) 6480464 sodium arsenite affects the expression of PIK3R2 mRNA CTD PMID:20816728 Pik3r2 Rat sodium arsenite increases expression ISO PIK3R2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PIK3R2 mRNA CTD PMID:12760830 Pik3r2 Rat sulfur dioxide affects expression EXP 6480464 Sulfur Dioxide affects the expression of PIK3R2 mRNA CTD PMID:32153200 Pik3r2 Rat T-2 toxin decreases expression EXP 6480464 T-2 Toxin results in decreased expression of PIK3R2 mRNA CTD PMID:26141394 Pik3r2 Rat temozolomide increases expression ISO PIK3R2 (Homo sapiens) 6480464 Temozolomide results in increased expression of PIK3R2 mRNA CTD PMID:31758290 Pik3r2 Rat tert-butyl hydroperoxide decreases expression ISO PIK3R2 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of PIK3R2 mRNA CTD PMID:12419474 Pik3r2 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PIK3R2 mRNA CTD PMID:34492290 Pik3r2 Rat titanium dioxide increases expression ISO Pik3r2 (Mus musculus) 6480464 titanium dioxide results in increased expression of PIK3R2 mRNA CTD PMID:29128614 and PMID:29264374 Pik3r2 Rat titanium dioxide increases methylation ISO Pik3r2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of PIK3R2 promoter alternative form CTD PMID:35295148 Pik3r2 Rat titanium dioxide decreases methylation ISO Pik3r2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PIK3R2 gene CTD PMID:35295148 Pik3r2 Rat valproic acid increases expression ISO PIK3R2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PIK3R2 mRNA CTD PMID:23179753 Pik3r2 Rat valproic acid increases methylation ISO PIK3R2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PIK3R2 gene CTD PMID:29154799 Pik3r2 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of PIK3R2 mRNA CTD PMID:19015723 Pik3r2 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PIK3R2 mRNA CTD PMID:23034163 Pik3r2 Rat vincristine decreases expression ISO PIK3R2 (Homo sapiens) 6480464 Vincristine results in decreased expression of PIK3R2 mRNA CTD PMID:23649840
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-demecolcine (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (ISO) 2,6-dinitrotoluene (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) alpha-pinene (ISO) ammonium chloride (EXP) antimonite (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) C60 fullerene (EXP) cadmium dichloride (EXP,ISO) cannabidiol (ISO) carbamazepine (ISO) chloropicrin (ISO) cisplatin (ISO) clofibrate (ISO) cobalt dichloride (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) diazinon (ISO) diclofenac (ISO) dicrotophos (ISO) dioxygen (ISO) dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO) diquat (ISO) doxorubicin (ISO) endosulfan (EXP,ISO) ethanol (EXP,ISO) folic acid (ISO) genistein (ISO) gentamycin (EXP) hydrogen peroxide (ISO) ivermectin (ISO) N-nitrosodiethylamine (EXP) N-Vinyl-2-pyrrolidone (EXP) nickel dichloride (EXP) Nor-9-carboxy-delta9-THC (ISO) oxaliplatin (ISO) ozone (ISO) paracetamol (ISO) pentachlorophenol (ISO) phenobarbital (EXP) potassium dichromate (ISO) quercetin (EXP) resveratrol (ISO) sodium arsenite (ISO) sulfur dioxide (EXP) T-2 toxin (EXP) temozolomide (ISO) tert-butyl hydroperoxide (ISO) thioacetamide (EXP) titanium dioxide (ISO) valproic acid (ISO) vinclozolin (EXP) vincristine (ISO)
Biological Process
cellular response to insulin stimulus (IEA,ISO,ISS) insulin receptor signaling pathway (IBA,IEA,ISO) intracellular glucose homeostasis (IEA,ISO,ISS) negative regulation of cell migration involved in sprouting angiogenesis (IMP) negative regulation of MAPK cascade (IEA,ISO) phosphatidylinositol 3-kinase/protein kinase B signal transduction (IEA,ISO,ISS) positive regulation of cell adhesion (IEA,ISO) positive regulation of protein import into nucleus (IEA,ISO,ISS) positive regulation of transcription by RNA polymerase II (IEA,ISO,ISS) protein transport (IEA) regulation of actin filament polymerization (IEA,ISO) regulation of autophagy (IEA,ISO,ISS) regulation of protein localization to plasma membrane (IEA,ISO) regulation of stress fiber assembly (IEA,ISO) response to endoplasmic reticulum stress (IEA,ISO,ISS) signal transduction (IEA)
1.
p85ß phosphoinositide 3-kinase subunit regulates tumor progression.
Cortés I, etal., Proc Natl Acad Sci U S A. 2012 Jul 10;109(28):11318-23. doi: 10.1073/pnas.1118138109. Epub 2012 Jun 25.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
The noncoding RNA, miR-126, suppresses the growth of neoplastic cells by targeting phosphatidylinositol 3-kinase signaling and is frequently lost in colon cancers.
Guo C, etal., Genes Chromosomes Cancer. 2008 Nov;47(11):939-46. doi: 10.1002/gcc.20596.
5.
Phosphoinositide 3-kinases as a common platform for multi-hormone signaling.
Hirsch E, etal., J Endocrinol. 2007 Aug;194(2):243-56.
6.
Co-administration of finasteride and the pure anti-oestrogen ICI 182,780 act synergistically in modulating the IGF system in rat prostate.
Huynh H, etal., J Endocrinol 2001 Oct;171(1):109-18.
7.
A novel 55-kDa regulatory subunit for phosphatidylinositol 3-kinase structurally similar to p55PIK Is generated by alternative splicing of the p85alpha gene.
Inukai K, etal., J Biol Chem 1996 Mar 8;271(10):5317-20.
8.
Upregulation of MicroRNA-126 Contributes to Endothelial Progenitor Cell Function in Deep Vein Thrombosis via Its Target PIK3R2.
Meng Q, etal., J Cell Biochem. 2015 Aug;116(8):1613-23. doi: 10.1002/jcb.25115.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
12.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
13.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
14.
GOA pipeline
RGD automated data pipeline
15.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
MicroRNA126 inhibits proliferation and metastasis by targeting pik3r2 in prostate cancer.
Song L, etal., Mol Med Rep. 2016 Feb;13(2):1204-10. doi: 10.3892/mmr.2015.4661. Epub 2015 Dec 9.
18.
Dominant negative inhibitors of signalling through the phosphoinositol 3-kinase pathway for gene therapy of pancreatic cancer.
Stoll V, etal., Gut. 2005 Jan;54(1):109-16. doi: 10.1136/gut.2004.046706.
19.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
20.
Garlic Oil Suppressed Nitrosodiethylamine-Induced Hepatocarcinoma in Rats by Inhibiting PI3K-AKT-NF-κB Pathway.
Zhang CL, etal., Int J Biol Sci. 2015 Apr 25;11(6):643-51. doi: 10.7150/ijbs.10785. eCollection 2015.
Pik3r2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 18,699,389 - 18,708,045 (+) NCBI GRCr8 mRatBN7.2 16 18,665,517 - 18,674,067 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 18,665,457 - 18,674,065 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 18,707,923 - 18,716,460 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 19,840,602 - 19,849,140 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 18,760,867 - 18,769,404 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 20,415,109 - 20,424,982 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 20,416,432 - 20,424,980 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 20,273,500 - 20,282,051 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 19,171,101 - 19,179,650 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 19,171,098 - 19,179,648 (+) NCBI Celera 16 18,857,756 - 18,866,282 (+) NCBI Celera Cytogenetic Map 16 p14 NCBI
PIK3R2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 18,153,163 - 18,170,532 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 18,153,163 - 18,170,540 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 18,263,973 - 18,281,342 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 18,125,016 - 18,142,343 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 18,125,015 - 18,142,343 NCBI Celera 19 18,165,735 - 18,183,085 (+) NCBI Celera Cytogenetic Map 19 p13.11 NCBI HuRef 19 17,827,466 - 17,844,856 (+) NCBI HuRef CHM1_1 19 18,263,528 - 18,280,901 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 18,287,263 - 18,304,664 (+) NCBI T2T-CHM13v2.0
Pik3r2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 71,220,820 - 71,229,356 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 71,220,820 - 71,229,357 (-) Ensembl GRCm39 Ensembl GRCm38 8 70,768,176 - 70,776,712 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 70,768,176 - 70,776,713 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 73,292,080 - 73,300,611 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 73,697,168 - 73,705,670 (-) NCBI MGSCv36 mm8 Celera 8 73,329,482 - 73,338,028 (-) NCBI Celera Cytogenetic Map 8 B3.3 NCBI cM Map 8 34.15 NCBI
Pik3r2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955524 3,234,111 - 3,241,173 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955524 3,234,111 - 3,241,445 (-) NCBI ChiLan1.0 ChiLan1.0
PIK3R2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 23,013,784 - 23,031,178 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 22,022,130 - 22,039,523 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 17,632,265 - 17,649,664 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 18,608,470 - 18,624,185 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 18,611,179 - 18,624,177 (+) Ensembl panpan1.1 panPan2
PIK3R2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 44,826,037 - 44,838,449 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 44,826,339 - 44,836,558 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 44,739,520 - 44,751,946 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 45,311,340 - 45,323,770 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 45,311,351 - 45,321,865 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 44,548,506 - 44,560,928 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 44,958,996 - 44,971,420 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 45,234,496 - 45,247,145 (-) NCBI UU_Cfam_GSD_1.0
Pik3r2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 203,461,387 - 203,472,734 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936596 3,010,488 - 3,021,920 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936596 3,010,526 - 3,021,848 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PIK3R2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 59,637,371 - 59,652,073 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 59,637,363 - 59,652,075 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 59,195,762 - 59,210,463 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PIK3R2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 16,620,673 - 16,637,511 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 16,621,606 - 16,636,937 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666074 2,738,902 - 2,757,694 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pik3r2
.
Predicted Target Of
Count of predictions: 304 Count of miRNA genes: 191 Interacting mature miRNAs: 221 Transcripts: ENSRNOT00000026210 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631561 Hcuc2 Hepatic copper content QTL 2 2.8 liver copper amount (VT:0003065) liver total copper weight (CMO:0001507) 16 1 39533949 Rat 1582235 Insul8 Insulin level QTL 8 3.3 0.0063 blood insulin amount (VT:0001560) calculated serum insulin level (CMO:0000359) 16 1 26727669 Rat 2307172 Activ4 Activity QTL 4 3.71 0.00023 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 1 33418960 Rat 1354584 Despr6 Despair related QTL 6 3.1 0.0067 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 39533930 Rat 2302380 Slep6 Serum leptin concentration QTL 6 3.36 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 1 32139025 Rat 737819 Hcas4 Hepatocarcinoma susceptibility QTL 4 4.43 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 16 4227609 46975965 Rat 631517 Scl9 Serum cholesterol level QTL 9 3.3 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 16 15726433 21034895 Rat 9590151 Scort8 Serum corticosterone level QTL 8 8.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 16 1 30836262 Rat 1354625 Despr7 Despair related QTL 7 3.16 0.016 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 44977551 Rat 61338 Bp23 Blood pressure QTL 23 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 4227609 49227609 Rat 61405 Niddm6 Non-insulin dependent diabetes mellitus QTL 6 3.66 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 16 4227609 48972724 Rat 631830 Alc7 Alcohol consumption QTL 7 2.9 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 1 26727669 Rat 7411664 Foco30 Food consumption QTL 30 11 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 1 44588133 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70183 BpQTLcluster13 Blood pressure QTL cluster 13 3.654 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 16 4227609 43025077 Rat 1600369 Hcas8 Hepatocarcinoma susceptibility QTL 8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 16 1 22477621 Rat 737826 Alc11 Alcohol consumption QTL 11 3.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 60252231 Rat 2303566 Bw90 Body weight QTL 90 2 body mass (VT:0001259) body weight (CMO:0000012) 16 1 39533930 Rat 2312663 Slep9 Serum leptin concentration QTL 9 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 832236 59492508 Rat 2306902 Bp339 Blood pressure QTL 339 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 3380150 43025077 Rat 1300133 Rf24 Renal function QTL 24 3.64 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 16 3380150 21361552 Rat 2312660 Bw95 Body weight QTL 95 0.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 16 832236 59492508 Rat 2312666 Insul16 Insulin level QTL 16 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 16 832236 59492508 Rat 634355 Rends4 Renal damage susceptibility QTL 4 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 16 1 26727669 Rat 70205 Gcr3 Gastric cancer resistance QTL 3 2.3 stomach morphology trait (VT:0000470) stomach tumor diameter (CMO:0001889) 16 17696791 82635055 Rat 2293343 Glom16 Glomerulus QTL 16 7.4 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 16 832236 46053497 Rat 6903319 Bw114 Body weight QTL 114 2.7 0.0037 body mass (VT:0001259) body weight (CMO:0000012) 16 1 43534949 Rat 2312669 Stl23 Serum triglyceride level QTL 23 0.01 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 16 832236 59492508 Rat
AI169383
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 18,664,576 - 18,664,704 (+) MAPPER mRatBN7.2 Rnor_6.0 16 20,415,492 - 20,415,619 NCBI Rnor6.0 Rnor_5.0 16 20,272,560 - 20,272,687 UniSTS Rnor5.0 RGSC_v3.4 16 19,170,161 - 19,170,288 UniSTS RGSC3.4 Celera 16 18,856,816 - 18,856,943 UniSTS RH 3.4 Map 16 192.0 UniSTS Cytogenetic Map 16 p14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000026210 ⟹ ENSRNOP00000026210
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 18,665,457 - 18,674,065 (+) Ensembl Rnor_6.0 Ensembl 16 20,416,432 - 20,424,980 (+) Ensembl
RefSeq Acc Id:
NM_022185 ⟹ NP_071521
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 18,699,497 - 18,708,045 (+) NCBI mRatBN7.2 16 18,665,517 - 18,674,065 (+) NCBI Rnor_6.0 16 20,416,432 - 20,424,980 (+) NCBI Rnor_5.0 16 20,273,500 - 20,282,051 (+) NCBI RGSC_v3.4 16 19,171,101 - 19,179,650 (+) RGD Celera 16 18,857,756 - 18,866,282 (+) RGD
Sequence:
GTGGCGGCGGTCGTGGTGGCGACGACGGCGGCCGGAGTGGGCTGGTATCCCCCTGCTGAGCATGGTAGCAGCCTGTGGTCTCAGTTATCCCATCTGGTGTCAGGCACACCTTGAAGAGCCAGCAAGCT
hide sequence
RefSeq Acc Id:
XM_039094436 ⟹ XP_038950364
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 18,699,389 - 18,708,045 (+) NCBI mRatBN7.2 16 18,667,125 - 18,674,067 (+) NCBI
RefSeq Acc Id:
XM_063275283 ⟹ XP_063131353
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 18,699,400 - 18,708,045 (+) NCBI
RefSeq Acc Id:
NP_071521 ⟸ NM_022185
- UniProtKB:
Q63788 (UniProtKB/Swiss-Prot), Q5FVS6 (UniProtKB/TrEMBL), A6KA00 (UniProtKB/TrEMBL), F7F9A3 (UniProtKB/TrEMBL)
- Sequence:
MAGAEGFQYRAVYPFRRERPEDLELLPGDLLVVSRVALQALGVADGGERCPHNVGWMPGFNERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPLDGPSESGHTLASLAEQFSPPEPAPPIL
hide sequence
Ensembl Acc Id:
ENSRNOP00000026210 ⟸ ENSRNOT00000026210
RefSeq Acc Id:
XP_038950364 ⟸ XM_039094436
- Peptide Label:
isoform X1
- UniProtKB:
Q63788 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063131353 ⟸ XM_063275283
- Peptide Label:
isoform X2
- UniProtKB:
Q63788 (UniProtKB/Swiss-Prot), A6KA00 (UniProtKB/TrEMBL), F7F9A3 (UniProtKB/TrEMBL), Q5FVS6 (UniProtKB/TrEMBL)
RGD ID: 13700016 Promoter ID: EPDNEW_R10538 Type: initiation region Name: Pik3r2_1 Description: phosphoinositide-3-kinase regulatory subunit 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 16 20,416,374 - 20,416,434 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-11-30
Pik3r2
phosphoinositide-3-kinase regulatory subunit 2
Pik3r2
phosphoinositide-3-kinase, regulatory subunit 2 (beta)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-09
Pik3r2
phosphoinositide-3-kinase, regulatory subunit 2 (beta)
Pik3r2
phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 2 (p85 beta)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-18
Pik3r2
phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 2 (p85 beta)
Pik3r2
phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2003-04-09
Pik3r2
phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 2
Pik3r2
phosphatidylinositol 3-kinase, regulartory subunit, polypeptide 2
Name updated
629478 APPROVED
2002-06-10
Pik3r2
phosphatidylinositol 3-kinase, regulartory subunit, polypeptide 2
Pik3r2
phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 2 (p85 beta)
Name updated
70584 APPROVED
