Symbol:
Thop1
Name:
thimet oligopeptidase 1
RGD ID:
68330
Description:
Enables peptidase activity and peptide binding activity. Involved in peptide catabolic process. Predicted to be located in cytoplasm. Predicted to be active in mitochondrial intermembrane space. Orthologous to human THOP1 (thimet oligopeptidase 1); PARTICIPATES IN renin-angiotensin cascade pathway; sleeping sickness pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
endo-oligopeptidase A; endopeptidase 24.15; EP24.15; metalloendopeptidase; MGC93105; PZ-peptidase; soluble metallo-endopeptidase; Thimet oligopeptidase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
THOP1 (thimet oligopeptidase 1)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Thop1 (thimet oligopeptidase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Thop1 (thimet oligopeptidase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
THOP1 (thimet oligopeptidase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
THOP1 (thimet oligopeptidase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Thop1 (thimet oligopeptidase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
THOP1 (thimet oligopeptidase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
THOP1 (thimet oligopeptidase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Thop1 (thimet oligopeptidase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
GRM5 (glutamate metabotropic receptor 5)
HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
THOP1 (thimet oligopeptidase 1)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Thop1 (thimet oligopeptidase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
thop1 (thimet oligopeptidase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PRD1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ZK550.3
Alliance
DIOPT (InParanoid|OMA|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):
thop1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 9,283,617 - 9,295,957 (-) NCBI GRCr8 mRatBN7.2 7 8,632,911 - 8,645,339 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 8,632,916 - 8,645,275 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 11,517,596 - 11,530,108 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 13,393,093 - 13,405,605 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 11,259,596 - 11,272,104 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 11,501,145 - 11,513,576 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 11,501,146 - 11,513,581 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 11,668,512 - 11,680,946 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 10,116,822 - 10,129,162 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 10,116,821 - 10,129,088 (-) NCBI Celera 7 6,820,402 - 6,832,744 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Disease Annotations - ClinVar
Only show annotations with direct experimental evidence (0 objects hidden)
Thop1 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:68461 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of THOP1 mRNA CTD PMID:36331819 Thop1 Rat 1,2-dimethylhydrazine increases expression ISO RGD:68461 6480464 1,2-Dimethylhydrazine results in increased expression of THOP1 mRNA CTD PMID:22206623 Thop1 Rat 17alpha-ethynylestradiol increases expression ISO RGD:68461 6480464 Ethinyl Estradiol results in increased expression of THOP1 mRNA CTD PMID:17555576|PMID:17942748 Thop1 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:68461 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of THOP1 mRNA CTD PMID:17942748 Thop1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of THOP1 mRNA CTD PMID:32145629 Thop1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:68461 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of THOP1 mRNA CTD PMID:17942748 Thop1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:68461 6480464 Tetrachlorodibenzodioxin affects the expression of THOP1 mRNA CTD PMID:21570461 Thop1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of THOP1 mRNA CTD PMID:22298810 Thop1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of THOP1 mRNA CTD PMID:21215274|PMID:33387578 Thop1 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of THOP1 mRNA CTD PMID:21346803 Thop1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO RGD:68461 6480464 2,2',4,4',5-brominated diphenyl ether results in increased expression of THOP1 protein CTD PMID:18550172 Thop1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of THOP1 mRNA CTD PMID:21346803 Thop1 Rat 2,5-hexanedione increases expression EXP 6480464 2,5-hexanedione results in increased expression of THOP1 protein CTD PMID:15928459 Thop1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of THOP1 mRNA CTD PMID:21346803 Thop1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3,4,5,3',4'-pentachlorobiphenyl results in increased expression of THOP1 mRNA CTD PMID:32119087 Thop1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO RGD:68461 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of THOP1 mRNA CTD PMID:20188158 Thop1 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of THOP1 protein CTD PMID:26072098 Thop1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:68460 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Thop1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:68461 6480464 bisphenol S results in increased expression of THOP1 mRNA CTD PMID:39298647 Thop1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Thop1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:68460 6480464 bisphenol S results in increased expression of THOP1 protein CTD PMID:34186270 Thop1 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2,6-dinitrotoluene affects the expression of THOP1 mRNA CTD PMID:21346803 Thop1 Rat aflatoxin B1 increases methylation ISO RGD:68460 6480464 Aflatoxin B1 results in increased methylation of THOP1 intron CTD PMID:30157460 Thop1 Rat all-trans-retinoic acid decreases expression ISO RGD:68460 6480464 Tretinoin results in decreased expression of THOP1 mRNA CTD PMID:33167477 Thop1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of THOP1 mRNA CTD PMID:16483693 Thop1 Rat antirheumatic drug increases expression ISO RGD:68460 6480464 Antirheumatic Agents results in increased expression of THOP1 mRNA CTD PMID:24449571 Thop1 Rat aristolochic acid A increases expression ISO RGD:68460 6480464 aristolochic acid I results in increased expression of THOP1 mRNA CTD PMID:33212167 Thop1 Rat arsenite(3-) decreases expression ISO RGD:68461 6480464 arsenite results in decreased expression of THOP1 protein CTD PMID:37955338 Thop1 Rat arsenous acid multiple interactions ISO RGD:68460 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to THOP1 protein] CTD PMID:26598702 Thop1 Rat azathioprine increases expression ISO RGD:68460 6480464 Azathioprine results in increased expression of THOP1 mRNA CTD PMID:22623647 Thop1 Rat benzo[a]pyrene increases expression ISO RGD:68461 6480464 Benzo(a)pyrene results in increased expression of THOP1 mRNA CTD PMID:22228805 Thop1 Rat Benzo[k]fluoranthene decreases expression ISO RGD:68461 6480464 benzo(k)fluoranthene results in decreased expression of THOP1 mRNA CTD PMID:26377693 Thop1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of THOP1 mRNA CTD PMID:25181051 Thop1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Thop1 Rat bisphenol A decreases expression ISO RGD:68460 6480464 bisphenol A results in decreased expression of THOP1 mRNA CTD PMID:33670352 Thop1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of THOP1 mRNA CTD PMID:32145629 Thop1 Rat Bisphenol B increases expression ISO RGD:68460 6480464 bisphenol B results in increased expression of THOP1 protein CTD PMID:34186270 Thop1 Rat bisphenol F multiple interactions ISO RGD:68460 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Thop1 Rat bisphenol F increases expression ISO RGD:68460 6480464 bisphenol F results in increased expression of THOP1 protein CTD PMID:34186270 Thop1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Thop1 Rat bleomycin A2 decreases expression ISO RGD:68461 6480464 Bleomycin results in decreased expression of THOP1 protein CTD PMID:29733421 Thop1 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of THOP1 protein CTD PMID:28903499 Thop1 Rat capsaicin increases expression EXP 6480464 Capsaicin results in increased expression of THOP1 mRNA CTD PMID:16278290 Thop1 Rat carbon nanotube increases expression ISO RGD:68461 6480464 Nanotubes, Carbon analog results in increased expression of THOP1 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Thop1 Rat CGP 52608 multiple interactions ISO RGD:68460 6480464 CGP 52608 promotes the reaction [RORA protein binds to THOP1 gene] CTD PMID:28238834 Thop1 Rat chromium(6+) affects expression ISO RGD:68461 6480464 chromium hexavalent ion affects the expression of THOP1 mRNA CTD PMID:28472532 Thop1 Rat chromium(6+) multiple interactions ISO RGD:68460 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression more ... CTD PMID:38479592 Thop1 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of THOP1 mRNA CTD PMID:17602206 Thop1 Rat cobalt dichloride decreases expression ISO RGD:68460 6480464 cobaltous chloride results in decreased expression of THOP1 mRNA CTD PMID:19320972 Thop1 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of THOP1 mRNA CTD PMID:20187946 Thop1 Rat copper atom multiple interactions ISO RGD:68460 6480464 [NSC 689534 binds to Copper] which results in decreased expression of THOP1 mRNA CTD PMID:20971185 Thop1 Rat copper(0) multiple interactions ISO RGD:68460 6480464 [NSC 689534 binds to Copper] which results in decreased expression of THOP1 mRNA CTD PMID:20971185 Thop1 Rat coumestrol increases expression ISO RGD:68460 6480464 Coumestrol results in increased expression of THOP1 mRNA CTD PMID:19167446 Thop1 Rat cyclosporin A increases expression ISO RGD:68460 6480464 Cyclosporine results in increased expression of THOP1 mRNA CTD PMID:25562108 Thop1 Rat dexamethasone multiple interactions ISO RGD:68460 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Thop1 Rat diarsenic trioxide multiple interactions ISO RGD:68460 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to THOP1 protein] CTD PMID:26598702 Thop1 Rat Dibutyl phosphate affects expression ISO RGD:68460 6480464 di-n-butylphosphoric acid affects the expression of THOP1 mRNA CTD PMID:37042841 Thop1 Rat dibutyl phthalate decreases expression ISO RGD:68461 6480464 Dibutyl Phthalate results in decreased expression of THOP1 mRNA CTD PMID:17361019|PMID:21266533 Thop1 Rat enzyme inhibitor multiple interactions ISO RGD:68460 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Thop1 Rat ethanol multiple interactions ISO RGD:68460 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 Thop1 Rat fenvalerate decreases expression EXP 6480464 fenvalerate results in decreased expression of THOP1 protein CTD PMID:33656234 Thop1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of THOP1 mRNA CTD PMID:24136188 Thop1 Rat folic acid decreases expression ISO RGD:68461 6480464 Folic Acid results in decreased expression of THOP1 mRNA CTD PMID:25629700 Thop1 Rat hydrogen cyanide decreases expression ISO RGD:68461 6480464 Hydrogen Cyanide results in decreased expression of THOP1 mRNA CTD PMID:33914522 Thop1 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of THOP1 mRNA CTD PMID:21396975 Thop1 Rat indometacin multiple interactions ISO RGD:68460 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Thop1 Rat ivermectin decreases expression ISO RGD:68460 6480464 Ivermectin results in decreased expression of THOP1 protein CTD PMID:32959892 Thop1 Rat lead(0) affects expression ISO RGD:68460 6480464 Lead affects the expression of THOP1 mRNA CTD PMID:28903495 Thop1 Rat lovastatin increases expression ISO RGD:68461 6480464 Lovastatin results in increased expression of THOP1 mRNA CTD PMID:20493250 Thop1 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine decreases expression ISO RGD:68460 6480464 N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine results in decreased expression of THOP1 mRNA CTD PMID:19013360 Thop1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of THOP1 mRNA CTD PMID:17602206 Thop1 Rat okadaic acid increases expression ISO RGD:68460 6480464 Okadaic Acid results in increased expression of THOP1 mRNA CTD PMID:38832940 Thop1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of THOP1 mRNA CTD PMID:25729387 Thop1 Rat ozone multiple interactions ISO RGD:68461 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 Thop1 Rat paracetamol affects expression ISO RGD:68461 6480464 Acetaminophen affects the expression of THOP1 mRNA CTD PMID:17562736 Thop1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of THOP1 mRNA CTD PMID:33387578 Thop1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of THOP1 mRNA CTD PMID:32680482 Thop1 Rat perfluorononanoic acid decreases expression ISO RGD:68460 6480464 perfluoro-n-nonanoic acid results in decreased expression of THOP1 mRNA CTD PMID:25812627 Thop1 Rat perfluorooctane-1-sulfonic acid decreases expression ISO RGD:68460 6480464 perfluorooctane sulfonic acid results in decreased expression of THOP1 mRNA CTD PMID:25812627 Thop1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:68461 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of THOP1 mRNA CTD PMID:36331819 Thop1 Rat perfluorooctanoic acid decreases expression ISO RGD:68460 6480464 perfluorooctanoic acid results in decreased expression of THOP1 mRNA CTD PMID:25812627|PMID:36326898 Thop1 Rat potassium cyanide increases expression ISO RGD:68461 6480464 Potassium Cyanide results in increased expression of THOP1 mRNA CTD PMID:33914522 Thop1 Rat sodium arsenite increases expression ISO RGD:68460 6480464 sodium arsenite results in increased expression of THOP1 mRNA CTD PMID:34032870 Thop1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of THOP1 mRNA CTD PMID:25993096 Thop1 Rat thapsigargin decreases expression ISO RGD:68460 6480464 Thapsigargin results in decreased expression of THOP1 mRNA CTD PMID:22378314 Thop1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of THOP1 mRNA CTD PMID:23411599|PMID:34492290 Thop1 Rat titanium dioxide decreases expression ISO RGD:68461 6480464 titanium dioxide results in decreased expression of THOP1 mRNA CTD PMID:29264374 Thop1 Rat titanium dioxide decreases methylation ISO RGD:68461 6480464 titanium dioxide results in decreased methylation of THOP1 gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Thop1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of THOP1 mRNA CTD PMID:25729387 Thop1 Rat trimellitic anhydride increases expression ISO RGD:68461 6480464 trimellitic anhydride results in increased expression of THOP1 mRNA CTD PMID:19042947 Thop1 Rat tunicamycin decreases expression ISO RGD:68460 6480464 Tunicamycin results in decreased expression of THOP1 mRNA CTD PMID:22378314 Thop1 Rat valproic acid affects expression ISO RGD:68461 6480464 Valproic Acid affects the expression of THOP1 mRNA CTD PMID:17292431 Thop1 Rat valproic acid increases methylation ISO RGD:68460 6480464 Valproic Acid results in increased methylation of THOP1 gene CTD PMID:29154799 Thop1 Rat warfarin increases expression ISO RGD:68461 6480464 Warfarin results in increased expression of THOP1 mRNA CTD PMID:20493250
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrotoluene (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2,5-hexanedione (EXP) 2,6-dinitrotoluene (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-amino-2,6-dinitrotoluene (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) arsenous acid (ISO) azathioprine (ISO) benzo[a]pyrene (ISO) Benzo[k]fluoranthene (ISO) bisphenol A (EXP,ISO)
References
References - curated
#
Reference Title
Reference Citation
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Expression of the thimet oligopeptidase gene is regulated by positively and negatively acting elements.
McCool S and Pierotti AR, DNA Cell Biol 2000 Dec;19(12):729-38.
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
Thimet oligopeptidase expression is differentially regulated in neuroendocrine and spermatid cell lines by transcription factor binding to SRY (sex-determining region Y), CAAT and CREB (cAMP-response-element-binding protein) promoter consensus sequences.
Morrison LS and Pierotti AR, Biochem J 2003 Nov 15;376(Pt 1):189-97.
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
Metalloendopeptidases EC 3.4.24.15/16 regulate bradykinin activity in the cerebral microvasculature.
Norman MU, etal., Am J Physiol Heart Circ Physiol 2003 Jun;284(6):H1942-8. Epub 2003 Feb 13.
8.
Molecular cloning and primary structure of rat testes metalloendopeptidase EC 3.4.24.15.
Pierotti A, etal., Biochemistry 1990 Nov 13;29(45):10323-9.
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
Mapping sequence differences between thimet oligopeptidase and neurolysin implicates key residues in substrate recognition.
Ray K, etal., Protein Sci 2002 Sep;11(9):2237-46.
11.
GOA pipeline
RGD automated data pipeline
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Novel natural peptide substrates for endopeptidase 24.15, neurolysin, and angiotensin-converting enzyme.
Rioli V, etal., J Biol Chem. 2003 Mar 7;278(10):8547-55. doi: 10.1074/jbc.M212030200. Epub 2002 Dec 24.
15.
Natural intracellular peptides can modulate the interactions of mouse brain proteins and thimet oligopeptidase with 14-3-3epsilon and calmodulin.
Russo LC, etal., Proteomics. 2012 Aug;12(17):2641-55. doi: 10.1002/pmic.201200032. Epub 2012 Jul 26.
16.
Rat brain contains high levels of mannose-6-phosphorylated glycoproteins including lysosomal enzymes and palmitoyl-protein thioesterase, an enzyme implicated in infantile neuronal lipofuscinosis.
Sleat DE, etal., J Biol Chem. 1996 Aug 9;271(32):19191-8.
17.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
18.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
Additional References at PubMed
Genomics
Comparative Map Data
Thop1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 9,283,617 - 9,295,957 (-) NCBI GRCr8 mRatBN7.2 7 8,632,911 - 8,645,339 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 8,632,916 - 8,645,275 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 11,517,596 - 11,530,108 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 13,393,093 - 13,405,605 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 11,259,596 - 11,272,104 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 11,501,145 - 11,513,576 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 11,501,146 - 11,513,581 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 11,668,512 - 11,680,946 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 10,116,822 - 10,129,162 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 10,116,821 - 10,129,088 (-) NCBI Celera 7 6,820,402 - 6,832,744 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
THOP1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 2,785,503 - 2,815,807 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 2,785,503 - 2,815,807 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 2,785,501 - 2,815,805 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 2,736,506 - 2,764,599 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 2,736,505 - 2,764,598 NCBI Celera 19 2,721,390 - 2,749,643 (+) NCBI Celera Cytogenetic Map 19 p13.3 NCBI HuRef 19 2,554,996 - 2,583,295 (+) NCBI HuRef CHM1_1 19 2,785,096 - 2,813,188 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 2,760,790 - 2,791,094 (+) NCBI T2T-CHM13v2.0
Thop1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 80,905,917 - 80,918,194 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 80,905,869 - 80,918,393 (+) Ensembl GRCm39 Ensembl GRCm38 10 81,070,083 - 81,082,360 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 81,070,035 - 81,082,559 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 80,532,828 - 80,545,105 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 80,473,279 - 80,485,687 (+) NCBI MGSCv36 mm8 Celera 10 82,090,182 - 82,102,459 (+) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 39.72 NCBI
Thop1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955495 5,054,986 - 5,071,279 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955495 5,055,389 - 5,070,710 (+) NCBI ChiLan1.0 ChiLan1.0
THOP1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 7,179,830 - 7,209,333 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 6,412,831 - 6,442,294 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 1,810,316 - 1,839,523 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 2,765,550 - 2,793,235 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 2,765,550 - 2,793,235 (+) Ensembl panpan1.1 panPan2
THOP1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 56,412,578 - 56,432,480 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 56,412,908 - 56,432,446 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 56,208,964 - 56,228,856 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 57,146,032 - 57,165,932 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 57,146,042 - 57,165,951 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 56,199,077 - 56,218,944 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 56,683,949 - 56,703,847 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 56,884,291 - 56,904,201 (-) NCBI UU_Cfam_GSD_1.0
Thop1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 216,196,995 - 216,216,192 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936588 1,618,541 - 1,637,821 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936588 1,618,585 - 1,637,788 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
THOP1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 75,853,429 - 75,877,494 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 75,857,788 - 75,877,430 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 76,370,019 - 76,389,661 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
THOP1 (Chlorocebus sabaeus - green monkey)
Thop1 (Heterocephalus glaber - naked mole-rat)
miRNA Target Status (No longer updated)
Predicted Target Of
Count of predictions: 53 Count of miRNA genes: 49 Interacting mature miRNAs: 51 Transcripts: ENSRNOT00000027045 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
QTLs in Region (GRCr8)
61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1300176 Hrtrt10 Heart rate QTL 10 3.19 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 664270 26029351 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 2298550 Neuinf6 Neuroinflammation QTL 6 3.3 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 7 1 27829089 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat
Markers in Region
D7Wox43
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 8,645,666 - 8,645,826 (+) MAPPER mRatBN7.2 Rnor_6.0 7 11,513,899 - 11,514,058 NCBI Rnor6.0 Rnor_5.0 7 11,681,263 - 11,681,422 UniSTS Rnor5.0 RGSC_v3.4 7 10,129,572 - 10,129,731 UniSTS RGSC3.4 Celera 7 6,833,154 - 6,833,313 UniSTS Cytogenetic Map 7 q11 UniSTS
UniSTS:236402
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 8,642,216 - 8,642,299 (+) MAPPER mRatBN7.2 Rnor_6.0 7 11,510,451 - 11,510,533 NCBI Rnor6.0 Rnor_5.0 7 11,677,815 - 11,677,897 UniSTS Rnor5.0 RGSC_v3.4 7 10,126,124 - 10,126,206 UniSTS RGSC3.4 Celera 7 6,829,706 - 6,829,788 UniSTS Cytogenetic Map 7 q11 UniSTS
Expression
RNA-SEQ Expression
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Sequence
Ensembl Acc Id:
ENSRNOT00000027045 ⟹ ENSRNOP00000027045
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 8,632,916 - 8,645,275 (-) Ensembl Rnor_6.0 Ensembl 7 11,501,146 - 11,513,581 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000082486 ⟹ ENSRNOP00000075551
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 8,632,916 - 8,645,275 (-) Ensembl Rnor_6.0 Ensembl 7 11,501,149 - 11,513,415 (-) Ensembl
RefSeq Acc Id:
NM_172075 ⟹ NP_742072
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,283,617 - 9,295,957 (-) NCBI mRatBN7.2 7 8,632,915 - 8,645,257 (-) NCBI Rnor_6.0 7 11,501,149 - 11,513,489 (-) NCBI Rnor_5.0 7 11,668,512 - 11,680,946 (-) NCBI RGSC_v3.4 7 10,116,822 - 10,129,162 (-) RGD Celera 7 6,820,402 - 6,832,744 (-) RGD
Sequence:
GGGCGGCAGGCGCCTCAGTCTGAGAGCCGCTGCGGAGGAACCGACTGAGGTGAAGCGAGCTCCC AAGGAGACCCGGACCGCACAGGCGTGAGGACCAGAGGAGGGCGTGCCCGTCCCGCGCGCAGCCT GCCGCCATGAAGCCCCCCGCAGCCTGTGCTGGGGACGTGGTGGATACAGTGTCACCATGCTCCA CCGTGAATCATCTGCGCTGGGACCTGAGCGCACAGCAGATCAGAGCTCTAACCACACAGCTCAT CGAGCAGACCAAGTGTGTGTACGACCGTGTGGGCGCCCAGGACTTCGAGGACGTGTCCTATGAG AGCACACTGAAGGCACTGGCTGACGTGGAGGTCACCTACACAGTGCAGAGGAACATTCTCGACT TCCCCCAGCACGTGTCTCCGAACAAGGACATCCGCGCAGCCAGCACAGAGGCTGACAAGAAGCT CTCAGAGTTTGATGTGGAGATGAGCATGAGGCAGGACGTGTACCAGAGGGTCGTGTGGCTGCAG GAGAAAATCCCGAAAGACTCACTGAAGCCTGAGGCAGCTCGCTACCTGGAGCGGCTCATCAAGC TGGGCCGGAGAAACGGGCTCCACTTACCTCAGGACACACAGGAGAAGATCAAGAACATCAAGAA GAGGCTGAGCCTGCTGTGCATCGACTTCAACAAGAACCTGAATGAGGACACCACCTTCCTGCCC TTCACGAGAGAGGAGCTGGGCGGGCTCCCCGAGGACTTCCTGAACTCCCTGGAGAAGACAGAGG ACGGCAAACTGAAGGTCACCCTCAAGTATCCACACTATTTCCCACTGCTGAAGAAGTGCCACGT GCCCGAGACACGACGCCTGTTGGAGGAGGCCTTCAACTGTCGCTGCAAGGAGGAGAACTGTGCC ATCCTGAAGGAGCTAGTGTCCCTGCGGGCGCAGAAGTCCAACCTGCTGGGATTCCGCACACACG CAGACTACGTCCTGGAGATGAACATGGCCAAGACCAGTCAGACAGTAGCCACCTTCCTAGATGA ACTGGCCCGGAAGCTGAAGCCGCTGGGTGAGCAGGAGCGTGCGGTGATCCTGGAGCTGAAGGAG GCAGAGTGCGCCAAGCGCGGGCTCCCATTCGATGGGCGCATCCACGCATGGGACATGCGGTACT ACATGAACCAGGTGGAGGAGACACGCTACCGCGTAGACCAGAACCTGCTGAAGGAGTACTTCCC CATGCAGGTGGTCACGCGTGGGCTGCTGGCCATCTACCAAGAGCTGCTGGGGCTGACCTTCACG CTGGAGGAAGGTGCCGCCGCCTGGCACGAAGACGTGCGGCTGTACTCTGTGCGTGACGCCGCCT CTGGAGAGGAGATTGGCAAGTTCTACCTCGACCTGTACCCCAGGGAAGGGAAGTATGGCCACGC GGCCTGCTTCGGCCTGCAGCCTGGCTGCCTACGGCAGGATGGCAGCCGACAGCTGGCCATCGCA GCCATGGTGGCCAATTTCACCAAGCCCACACCTGACGTGCCTTCCCTGCTGCAGCACGATGAGG TGGAGACCTACTTCCACGAGTTCGGGCACGTCATGCACCAGCTCTGCTCACAGGCAGAGTTTGC TATGTTCAGTGGGACCCACGTGGAGCGGGACTTTGTGGAGGCACCGTCACAGATGCTGGAGAAC TGGGTGTGGGAAAAGGAGCCACTGATGCGCATGTCCCAGCATTACCGCACAGGAGGCGAGGCCC CTGAGGACCTCCTGGAGAAGCTCATCAAGTCTCGCCAGGCCAATGCAGGTCTCTTCAACCTTCG GCAGATTGTCCTTGCCAAGGTAGATCAGGTCCTGCACACACAGACAGATGTAGACCCAGCTGAG GAATATGCCCGGCTCTGCCAGGAGATCCTTGGGGTGCCAGCCACACCAGGTACCAACATGCCAG CCACTTTTGGCCACCTCGCTGGTGGCTACGACGCTCAGTACTATGGCTACTTGTGGAGTGAGGT GTACTCCATGGACATGTTCCACACACGCTTCAAGCAGGAGGGTGTGCTTAGCCCCAAGGTTGGC ATGGATTACCGGACCAGCATCCTGAGGCCGGGGGGCTCTGAGGATGCCAGCACCATGCTGAAGC AGTTCCTGGGCCGTGACCCCAAGCAAGACGCCTTCCTCCTGAGCAAGGGTCTGCAGGTAGAGGG CTGCGAGCCACCTGCGTGCTGAGCGGTCCCCAGCTCGCCCTCCTGTGCCTTAGCCTGCCGGGCG GCAAGGTCAGCAGCCCTTGGGCGTACGGATGAGCCTGGGGCAGTTTCCATCCTCGTCCTCCCCC CAGCTCCAGGTCCCCGGCTTCAGGCTGCTGTGCTCTCCTTGCACTATCCCCTCCCCAAACTGAT GTTGGACATTAAATTTCACACAGGGGAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_742072 ⟸ NM_172075
- UniProtKB:
Q66HS4 (UniProtKB/Swiss-Prot), P24155 (UniProtKB/Swiss-Prot), A6K8C9 (UniProtKB/TrEMBL), A0A0G2KAW4 (UniProtKB/TrEMBL)
- Sequence:
MKPPAACAGDVVDTVSPCSTVNHLRWDLSAQQIRALTTQLIEQTKCVYDRVGAQDFEDVSYEST LKALADVEVTYTVQRNILDFPQHVSPNKDIRAASTEADKKLSEFDVEMSMRQDVYQRVVWLQEK IPKDSLKPEAARYLERLIKLGRRNGLHLPQDTQEKIKNIKKRLSLLCIDFNKNLNEDTTFLPFT REELGGLPEDFLNSLEKTEDGKLKVTLKYPHYFPLLKKCHVPETRRLLEEAFNCRCKEENCAIL KELVSLRAQKSNLLGFRTHADYVLEMNMAKTSQTVATFLDELARKLKPLGEQERAVILELKEAE CAKRGLPFDGRIHAWDMRYYMNQVEETRYRVDQNLLKEYFPMQVVTRGLLAIYQELLGLTFTLE EGAAAWHEDVRLYSVRDAASGEEIGKFYLDLYPREGKYGHAACFGLQPGCLRQDGSRQLAIAAM VANFTKPTPDVPSLLQHDEVETYFHEFGHVMHQLCSQAEFAMFSGTHVERDFVEAPSQMLENWV WEKEPLMRMSQHYRTGGEAPEDLLEKLIKSRQANAGLFNLRQIVLAKVDQVLHTQTDVDPAEEY ARLCQEILGVPATPGTNMPATFGHLAGGYDAQYYGYLWSEVYSMDMFHTRFKQEGVLSPKVGMD YRTSILRPGGSEDASTMLKQFLGRDPKQDAFLLSKGLQVEGCEPPAC
hide sequence
Ensembl Acc Id:
ENSRNOP00000075551 ⟸ ENSRNOT00000082486
Ensembl Acc Id:
ENSRNOP00000027045 ⟸ ENSRNOT00000027045
Promoters
RGD ID: 13694996
Promoter ID: EPDNEW_R5516
Type: multiple initiation site
Name: Thop1_1
Description: thimet oligopeptidase 1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 11,513,510 - 11,513,570 EPDNEW
Additional Information
Nomenclature History
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Thop1
thimet oligopeptidase 1
Name updated
70584
APPROVED
RGD Curation Notes
Note Type
Note
Reference
gene_expression
highest enzyme activity is detected in testis, also expressed in brain and pituitary
730190
gene_process
involved in the degradation of Bradykinin, a vasoactive peptide
1299146