Symbol:
Prkcd
Name:
protein kinase C, delta
RGD ID:
67383
Description:
Enables TIR domain binding activity; diacylglycerol-dependent, calcium-independent serine/threonine kinase activity; and protein serine/threonine kinase binding activity. Involved in several processes, including D-aspartate import across plasma membrane; positive regulation of D-glucose import; and positive regulation of MAP kinase activity. Is active in postsynaptic cytosol. Used to study brain ischemia and hypertension. Biomarker of hyperinsulinism; hypertension; muscular disease; obesity; and restrictive cardiomyopathy. Human ortholog(s) of this gene implicated in autoimmune lymphoproliferative syndrome type 3 and steatotic liver disease. Orthologous to human PRKCD (protein kinase C delta); PARTICIPATES IN the extracellular signal-regulated Raf/Mek/Erk signaling pathway; vascular endothelial growth factor signaling pathway; ceramide signaling pathway; INTERACTS WITH (+)-pilocarpine; (S)-amphetamine; 1-(5-isoquinolinesulfonyl)-2-methylpiperazine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
nPKC-delta; Pkcd; protein kinase C delta type
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRKCD (protein kinase C delta) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Prkcd (protein kinase C, delta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Prkcd (protein kinase C delta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRKCD (protein kinase C delta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRKCD (protein kinase C delta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prkcd (protein kinase C delta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRKCD (protein kinase C delta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PRKCD (protein kinase C delta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prkcd (protein kinase C delta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PRKCD (protein kinase C delta)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PRKCD (protein kinase C delta)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Prkcd (protein kinase C, delta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prkcda (protein kinase C, delta a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prkcdb (protein kinase C, delta b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PKC1
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
tpa-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
prkcd
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 5,775,681 - 5,806,122 (-) NCBI GRCr8 GRCr8 Ensembl 16 5,775,681 - 5,805,839 (-) Ensembl GRCr8 Ensembl mRatBN7.2 16 5,769,217 - 5,799,380 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 5,769,215 - 5,799,352 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 5,781,205 - 5,811,322 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 6,926,659 - 6,956,775 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 5,779,783 - 5,809,932 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 6,655,131 - 6,675,746 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 6,655,120 - 6,675,746 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 6,588,990 - 6,608,725 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 5,954,218 - 5,975,743 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 16 9,398,816 - 9,419,806 (+) NCBI Celera RGSC_v3.1 16 5,954,214 - 5,975,741 (-) NCBI Cytogenetic Map 16 p16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prkcd Rat (+)-pilocarpine increases expression EXP 6480464 Pilocarpine results in increased expression of PRKCD protein CTD PMID:15058486 Prkcd Rat (-)-epigallocatechin 3-gallate multiple interactions ISO PRKCD (Homo sapiens) 6480464 epigallocatechin gallate inhibits the reaction [Histamine results in increased phosphorylation of PRKCD protein]; epigallocatechin gallate more ... CTD PMID:23333628 Prkcd Rat (S)-amphetamine increases expression EXP 6480464 Dextroamphetamine results in increased expression of PRKCD mRNA; Dextroamphetamine results in increased expression of PRKCD more ... CTD PMID:19497417 Prkcd Rat (S)-nicotine decreases expression ISO Prkcd (Mus musculus) 6480464 Nicotine results in decreased expression of PRKCD mRNA CTD PMID:21955143 Prkcd Rat 1,2-dimethylhydrazine multiple interactions ISO Prkcd (Mus musculus) 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of PRKCD mRNA] CTD PMID:22206623 Prkcd Rat 1,2-dimethylhydrazine increases expression ISO Prkcd (Mus musculus) 6480464 1,2-Dimethylhydrazine results in increased expression of PRKCD mRNA CTD PMID:22206623 Prkcd Rat 1-(5-isoquinolinesulfonyl)-2-methylpiperazine multiple interactions EXP 6480464 1-(5-Isoquinolinesulfonyl)-2-Methylpiperazine inhibits the reaction [Heptachlor affects the localization of PRKCD protein]; 1-(5-Isoquinolinesulfonyl)-2-Methylpiperazine inhibits the reaction more ... CTD PMID:14678745 Prkcd Rat 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile multiple interactions ISO PRKCD (Homo sapiens) 6480464 Citalopram inhibits the reaction [convulxin results in increased phosphorylation of PRKCD protein] CTD PMID:30592962 Prkcd Rat 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile increases expression EXP 6480464 Citalopram results in increased expression of PRKCD mRNA CTD PMID:28467792 Prkcd Rat 17beta-estradiol decreases expression ISO PRKCD (Homo sapiens) 6480464 Estradiol results in decreased expression of PRKCD mRNA CTD PMID:15757668|PMID:32387340 Prkcd Rat 17beta-estradiol multiple interactions ISO PRKCD (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of PRKCD mRNA CTD PMID:30165855 Prkcd Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Prkcd (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with decitabine] results in increased expression of PRKCD mRNA CTD PMID:15251184 Prkcd Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Prkcd (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PRKCD mRNA CTD PMID:21570461|PMID:24680724 Prkcd Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO PRKCD (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of PRKCD mRNA CTD PMID:23152189 Prkcd Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PRKCD mRNA CTD PMID:20959002|PMID:21215274|PMID:34747641 Prkcd Rat 2,3,7,8-tetrachlorodibenzodioxine increases localization EXP 6480464 Tetrachlorodibenzodioxin results in increased localization of PRKCD protein CTD PMID:17222441 Prkcd Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Prkcd (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PRKCD mRNA CTD PMID:15251184|PMID:33956508 Prkcd Rat 2,6-dimethoxyphenol multiple interactions ISO PRKCD (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1,3-dimethyl ether] results in increased expression of and affects the more ... CTD PMID:38598786 Prkcd Rat 2-butoxyethanol decreases expression ISO Prkcd (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of PRKCD mRNA CTD PMID:19812364 Prkcd Rat 2-Hydroxy-6-(8,11,14-pentadecatrienyl)benzoic acid multiple interactions EXP 6480464 anacardic acid inhibits the reaction [Paraquat results in increased cleavage of and results in increased more ... CTD PMID:21777615 Prkcd Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3,4,5,3',4'-pentachlorobiphenyl results in increased expression of PRKCD mRNA CTD PMID:20959002 Prkcd Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions ISO PRKCD (Homo sapiens) 6480464 3,4,5,3',4'-pentachlorobiphenyl promotes the reaction [CAV1 mutant form results in decreased phosphorylation of PRKCD protein] CTD PMID:24709675 Prkcd Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO PRKCD (Homo sapiens) 6480464 bisindolylmaleimide I affects the reaction [Tetradecanoylphorbol Acetate affects the phosphorylation of PRKCD protein]; bisindolylmaleimide I more ... CTD PMID:15380616|PMID:16285992|PMID:28780155 Prkcd Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione decreases expression ISO PRKCD (Homo sapiens) 6480464 bisindolylmaleimide I results in decreased expression of PRKCD mRNA CTD PMID:28780155 Prkcd Rat 3-nitropropanoic acid multiple interactions ISO Prkcd (Mus musculus) 6480464 3-nitropropionic acid inhibits the reaction [ginsenoside Re inhibits the reaction [3-Pyridinecarboxylic acid, 1,4-dihydro-2,6-dimethyl-5-nitro-4-(2-(trifluoromethyl)phenyl)-, Methyl ester more ... CTD PMID:37308051 Prkcd Rat 4,4'-diaminodiphenylmethane decreases expression ISO Prkcd (Mus musculus) 6480464 4,4'-diaminodiphenylmethane results in decreased expression of PRKCD mRNA CTD PMID:18648102 Prkcd Rat 4,4'-sulfonyldiphenol increases expression ISO PRKCD (Homo sapiens) 6480464 bisphenol S results in increased expression of PRKCD protein CTD PMID:34186270 Prkcd Rat 4-hydroxy-TEMPO multiple interactions EXP 6480464 tempol inhibits the reaction [Streptozocin results in increased expression of and results in increased activity more ... CTD PMID:16478977 Prkcd Rat 5-(2-methylpiperazine-1-sulfonyl)isoquinoline multiple interactions EXP 6480464 1-(5-Isoquinolinesulfonyl)-2-Methylpiperazine inhibits the reaction [Heptachlor affects the localization of PRKCD protein]; 1-(5-Isoquinolinesulfonyl)-2-Methylpiperazine inhibits the reaction more ... CTD PMID:14678745 Prkcd Rat 5-aza-2'-deoxycytidine increases expression ISO Prkcd (Mus musculus) 6480464 Decitabine results in increased expression of PRKCD mRNA CTD PMID:15251184 Prkcd Rat 5-aza-2'-deoxycytidine affects expression ISO PRKCD (Homo sapiens) 6480464 Decitabine affects the expression of PRKCD mRNA CTD PMID:23300844 Prkcd Rat 5-aza-2'-deoxycytidine multiple interactions ISO Prkcd (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Decitabine] results in increased expression of PRKCD mRNA CTD PMID:15251184 Prkcd Rat 6-formylpterin affects localization ISO PRKCD (Homo sapiens) 6480464 2-amino-4-hydroxy-6-formylpteridine affects the localization of PRKCD protein CTD PMID:16019850 Prkcd Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of PRKCD mRNA CTD PMID:24780913 Prkcd Rat 8-OH-DPAT multiple interactions ISO Prkcd (Mus musculus) 6480464 8-Hydroxy-2-(di-n-propylamino)tetralin promotes the reaction [NCF1 protein binds to PRKCD protein]; 8-Hydroxy-2-(di-n-propylamino)tetralin promotes the reaction [PRKCD more ... CTD PMID:30366073 Prkcd Rat acetaldehyde multiple interactions ISO PRKCD (Homo sapiens) 6480464 Acetaldehyde results in increased phosphorylation of and results in increased activity of PRKCD protein; Imatinib more ... CTD PMID:17030193 Prkcd Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of PRKCD mRNA CTD PMID:31881176 Prkcd Rat acetylsalicylic acid increases cleavage ISO PRKCD (Homo sapiens) 6480464 Aspirin results in increased cleavage of PRKCD protein CTD PMID:11228543 Prkcd Rat acrolein affects localization EXP 6480464 Acrolein affects the localization of PRKCD protein CTD PMID:12755590 Prkcd Rat acrolein multiple interactions ISO PRKCD (Homo sapiens) 6480464 PRKCD protein promotes the reaction [Acrolein affects the localization of NFE2L2 protein] CTD PMID:18048804 Prkcd Rat acrylamide multiple interactions EXP 6480464 PRKCD protein affects the reaction [Acrylamide results in decreased phosphorylation of MTOR protein]; PRKCD protein more ... CTD PMID:33545342 Prkcd Rat actinomycin D multiple interactions ISO PRKCD (Homo sapiens) 6480464 PLD1 protein inhibits the reaction [Dactinomycin results in increased cleavage of PRKCD protein] CTD PMID:14640974 Prkcd Rat actinomycin D multiple interactions ISO Prkcd (Mus musculus) 6480464 PLD2 protein inhibits the reaction [Dactinomycin results in increased cleavage of PRKCD protein] CTD PMID:14640974 Prkcd Rat afimoxifene decreases response to substance ISO PRKCD (Homo sapiens) 6480464 PRKCD results in decreased susceptibility to afimoxifene CTD PMID:21233418 Prkcd Rat aflatoxin B1 increases expression ISO PRKCD (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of PRKCD mRNA; Aflatoxin B1 results in increased expression more ... CTD PMID:22100608|PMID:26026912 Prkcd Rat aldehydo-D-glucose multiple interactions EXP 6480464 diphenyleneiodonium inhibits the reaction [Glucose results in increased expression of PRKCD protein] CTD PMID:12821678 Prkcd Rat aldehydo-D-glucose increases expression ISO PRKCD (Homo sapiens) 6480464 Glucose results in increased expression of PRKCD protein CTD PMID:16285992 Prkcd Rat aldehydo-D-glucose multiple interactions ISO PRKCD (Homo sapiens) 6480464 5,21 - 12,17-dimetheneo-18H-dibenzo(i,o)pyrrolo(3,4-1)(1,8)diazacyclohexandecine-18,10(19H)dione,8((dimethylamino)methyl)-6,7,8,9,10,11-hexahydro,monomethanesulfonate inhibits the reaction [Glucose results in increased expression of PRKCD protein]; bisindolylmaleimide more ... CTD PMID:16285992 Prkcd Rat aldehydo-D-glucose increases expression EXP 6480464 Glucose results in increased expression of PRKCD protein CTD PMID:12821678 Prkcd Rat all-trans-retinoic acid multiple interactions ISO PRKCD (Homo sapiens) 6480464 [Tretinoin co-treated with CNTF protein] results in increased expression of PRKCD mRNA alternative form; PRKCD more ... CTD PMID:16178010|PMID:17017122|PMID:21393419 Prkcd Rat all-trans-retinoic acid decreases expression ISO PRKCD (Homo sapiens) 6480464 Tretinoin results in decreased expression of PRKCD mRNA CTD PMID:23724009 Prkcd Rat all-trans-retinoic acid increases expression ISO PRKCD (Homo sapiens) 6480464 Tretinoin results in increased expression of PRKCD mRNA; Tretinoin results in increased expression of PRKCD more ... CTD PMID:15498508|PMID:16322068|PMID:21393419|PMID:33167477 Prkcd Rat all-trans-retinoic acid affects expression ISO PRKCD (Homo sapiens) 6480464 Tretinoin affects the expression of PRKCD mRNA alternative form CTD PMID:17017122 Prkcd Rat allyl alcohol affects localization EXP 6480464 allyl alcohol affects the localization of PRKCD protein CTD PMID:12755590 Prkcd Rat allyl alcohol increases phosphorylation EXP 6480464 allyl alcohol results in increased phosphorylation of PRKCD protein CTD PMID:12755590 Prkcd Rat allyl alcohol multiple interactions EXP 6480464 fomepizole inhibits the reaction [allyl alcohol affects the localization of PRKCD protein] CTD PMID:12755590 Prkcd Rat alpha-Zearalanol increases expression ISO PRKCD (Homo sapiens) 6480464 Zeranol results in increased expression of PRKCD protein modified form CTD PMID:23538034 Prkcd Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PRKCD mRNA CTD PMID:16483693 Prkcd Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of PRKCD mRNA CTD PMID:16101753 Prkcd Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions ISO PRKCD (Homo sapiens) 6480464 pyrazolanthrone inhibits the reaction [MIF protein results in increased phosphorylation of PRKCD protein] CTD PMID:16872482 Prkcd Rat apocynin multiple interactions ISO Prkcd (Mus musculus) 6480464 acetovanillone inhibits the reaction [8-Hydroxy-2-(di-n-propylamino)tetralin promotes the reaction [NCF1 protein binds to PRKCD protein]]; acetovanillone more ... CTD PMID:30366073 Prkcd Rat apocynin multiple interactions EXP 6480464 acetovanillone analog inhibits the reaction [Chlorpyrifos results in increased cleavage of PRKCD protein] CTD PMID:29859868 Prkcd Rat aripiprazole multiple interactions ISO PRKCD (Homo sapiens) 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of PRKCD mRNA CTD PMID:31476115 Prkcd Rat arjunolic acid multiple interactions EXP 6480464 arjunolic acid inhibits the reaction [Streptozocin results in increased expression of PRKCD protein] CTD PMID:19682444 Prkcd Rat arsenite(3-) affects expression ISO Prkcd (Mus musculus) 6480464 arsenite affects the expression of PRKCD mRNA CTD PMID:33053406 Prkcd Rat arsenous acid multiple interactions ISO PRKCD (Homo sapiens) 6480464 [Arsenic Trioxide co-treated with Bortezomib] results in increased cleavage of and results in increased activity more ... CTD PMID:17495969|PMID:19662097 Prkcd Rat arsenous acid increases phosphorylation EXP 6480464 Arsenic Trioxide results in increased phosphorylation of PRKCD protein CTD PMID:29986281 Prkcd Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of PRKCD gene CTD PMID:35440735 Prkcd Rat Azoxymethane increases expression EXP 6480464 Azoxymethane results in increased expression of PRKCD mRNA CTD PMID:11983831 Prkcd Rat Bay-K-8644 multiple interactions ISO Prkcd (Mus musculus) 6480464 3-nitropropionic acid inhibits the reaction [ginsenoside Re inhibits the reaction [3-Pyridinecarboxylic acid, 1,4-dihydro-2,6-dimethyl-5-nitro-4-(2-(trifluoromethyl)phenyl)-, Methyl ester more ... CTD PMID:37308051 Prkcd Rat Bay-K-8644 increases expression ISO Prkcd (Mus musculus) 6480464 3-Pyridinecarboxylic acid, 1,4-dihydro-2,6-dimethyl-5-nitro-4-(2-(trifluoromethyl)phenyl)-, Methyl ester results in increased expression of PRKCD protein CTD PMID:37308051 Prkcd Rat benzo[a]pyrene multiple interactions ISO Prkcd (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to PRKCD promoter] CTD PMID:19654925 Prkcd Rat benzo[a]pyrene affects methylation ISO PRKCD (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PRKCD 5' UTR CTD PMID:27901495 Prkcd Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of PRKCD mRNA CTD PMID:21839799 Prkcd Rat bis(2-ethylhexyl) phthalate multiple interactions ISO PRKCD (Homo sapiens) 6480464 PRKCD protein affects the reaction [Diethylhexyl Phthalate inhibits the reaction [lipopolysaccharide, Escherichia coli O111 B4 more ... CTD PMID:28673093 Prkcd Rat bis(2-ethylhexyl) phthalate increases expression ISO Prkcd (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PRKCD mRNA CTD PMID:33754040 Prkcd Rat bisdemethoxycurcumin multiple interactions ISO Prkcd (Mus musculus) 6480464 PRKCD protein affects the reaction [bisdemethoxycurcumin results in increased expression of HMOX1 mRNA] CTD PMID:17535857 Prkcd Rat bisoprolol decreases expression EXP 6480464 Bisoprolol results in decreased expression of PRKCD protein CTD PMID:20668454 Prkcd Rat bisphenol A increases expression ISO Prkcd (Mus musculus) 6480464 bisphenol A results in increased expression of PRKCD protein CTD PMID:23545179 Prkcd Rat bisphenol A decreases expression ISO Prkcd (Mus musculus) 6480464 bisphenol A results in decreased expression of PRKCD mRNA CTD PMID:32365465 Prkcd Rat bisphenol A affects expression ISO Prkcd (Mus musculus) 6480464 bisphenol A affects the expression of PRKCD mRNA CTD PMID:32926169 Prkcd Rat bisphenol A decreases expression ISO PRKCD (Homo sapiens) 6480464 bisphenol A analog results in decreased expression of PRKCD mRNA; bisphenol A results in decreased more ... CTD PMID:32387340 Prkcd Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PRKCD mRNA CTD PMID:30816183 Prkcd Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PRKCD mRNA CTD PMID:25181051 Prkcd Rat bisphenol AF increases expression ISO PRKCD (Homo sapiens) 6480464 bisphenol AF results in increased expression of PRKCD protein CTD PMID:34186270 Prkcd Rat Bisphenol B decreases expression ISO PRKCD (Homo sapiens) 6480464 bisphenol B results in decreased expression of PRKCD mRNA CTD PMID:32387340 Prkcd Rat Bisphenol B increases expression ISO PRKCD (Homo sapiens) 6480464 bisphenol B results in increased expression of PRKCD protein CTD PMID:34186270 Prkcd Rat Bisphenol Z decreases expression ISO PRKCD (Homo sapiens) 6480464 bisphenol Z results in decreased expression of PRKCD mRNA CTD PMID:32387340 Prkcd Rat bortezomib multiple interactions ISO PRKCD (Homo sapiens) 6480464 [arsenic trioxide co-treated with Bortezomib] results in increased cleavage of and results in increased activity more ... CTD PMID:17495969|PMID:19662097 Prkcd Rat brimonidine tartrate affects localization EXP 6480464 Brimonidine Tartrate affects the localization of PRKCD protein CTD PMID:12388232 Prkcd Rat brimonidine tartrate multiple interactions EXP 6480464 Nitric Oxide deficiency inhibits the reaction [Brimonidine Tartrate affects the localization of PRKCD protein] CTD PMID:12388232 Prkcd Rat bromocriptine multiple interactions EXP 6480464 Bromocriptine promotes the reaction [Estrogens results in increased expression of and results in increased cleavage more ... CTD PMID:19595700 Prkcd Rat bromocriptine affects localization EXP 6480464 Bromocriptine affects the localization of PRKCD protein CTD PMID:19595700 Prkcd Rat butorphanol affects localization ISO PRKCD (Homo sapiens) 6480464 Butorphanol affects the localization of PRKCD protein CTD PMID:29669290 Prkcd Rat butylated hydroxyanisole multiple interactions ISO PRKCD (Homo sapiens) 6480464 Butylated Hydroxyanisole inhibits the reaction [Ursodeoxycholic Acid results in increased localization of PRKCD protein] CTD PMID:21362627 Prkcd Rat butyric acid increases expression EXP 6480464 Butyric Acid results in increased expression of PRKCD mRNA CTD PMID:12800193 Prkcd Rat cadmium atom multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Cadmium results in increased phosphorylation of PRKCD protein]; Cadmium results in more ... CTD PMID:27658547 Prkcd Rat cadmium dichloride multiple interactions ISO Prkcd (Mus musculus) 6480464 [HTT gene mutant form results in increased susceptibility to Cadmium Chloride] which results in increased more ... CTD PMID:30399392 Prkcd Rat caffeine decreases phosphorylation ISO PRKCD (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of PRKCD protein CTD PMID:35688186 Prkcd Rat Calcimycin multiple interactions ISO PRKCD (Homo sapiens) 6480464 [Tetradecanoylphorbol Acetate co-treated with Calcimycin] results in increased phosphorylation of PRKCD protein; Oils, Volatile inhibits more ... CTD PMID:23941771 Prkcd Rat calcium atom affects expression EXP 6480464 Calcium affects the expression of PRKCD mRNA CTD PMID:15913539 Prkcd Rat calcium(0) affects expression EXP 6480464 Calcium affects the expression of PRKCD mRNA CTD PMID:15913539 Prkcd Rat Calphostin C multiple interactions EXP 6480464 calphostin C inhibits the reaction [Heptachlor affects the localization of PRKCD protein]; calphostin C inhibits more ... CTD PMID:14678745 Prkcd Rat capsaicin increases expression ISO PRKCD (Homo sapiens) 6480464 Capsaicin results in increased expression of PRKCD protein CTD PMID:22171160 Prkcd Rat capsaicin multiple interactions ISO PRKCD (Homo sapiens) 6480464 [NFKB1 mutant form inhibits the reaction [Capsaicin results in increased expression of PRKCD protein]] which more ... CTD PMID:22171160 Prkcd Rat captan increases expression ISO Prkcd (Mus musculus) 6480464 Captan results in increased expression of PRKCD mRNA CTD PMID:31558096 Prkcd Rat carbon nanotube increases expression ISO Prkcd (Mus musculus) 6480464 Nanotubes, Carbon analog results in increased expression of PRKCD mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Prkcd Rat carvedilol decreases expression EXP 6480464 carvedilol results in decreased expression of PRKCD protein CTD PMID:20668454 Prkcd Rat chloroprene decreases expression EXP 6480464 Chloroprene results in decreased expression of PRKCD mRNA CTD PMID:23125180 Prkcd Rat chlorpyrifos multiple interactions EXP 6480464 acetovanillone analog inhibits the reaction [Chlorpyrifos results in increased cleavage of PRKCD protein]; STAT1 protein more ... CTD PMID:29859868 Prkcd Rat chlorpyrifos increases cleavage EXP 6480464 Chlorpyrifos results in increased cleavage of PRKCD protein CTD PMID:29859868 Prkcd Rat chromium(6+) affects expression ISO Prkcd (Mus musculus) 6480464 chromium hexavalent ion affects the expression of PRKCD mRNA CTD PMID:28472532 Prkcd Rat ciglitazone multiple interactions ISO PRKCD (Homo sapiens) 6480464 [ciglitazone binds to PPARG protein alternative form] which results in increased expression of PRKCD mRNA CTD PMID:16197558 Prkcd Rat cisplatin multiple interactions ISO Prkcd (Mus musculus) 6480464 4-amino-5-(4-methylphenyl)-7-(tert-butyl)pyrazolo(3,4-d)pyrimidine inhibits the reaction [Cisplatin promotes the reaction [SRC protein binds to PRKCD protein]]; 4-amino-5-(4-methylphenyl)-7-(tert-butyl)pyrazolo(3,4-d)pyrimidine more ... CTD PMID:21633170 Prkcd Rat cisplatin multiple interactions ISO PRKCD (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of PRKCD mRNA CTD PMID:27392435 Prkcd Rat cisplatin increases expression ISO PRKCD (Homo sapiens) 6480464 Cisplatin results in increased expression of PRKCD mRNA CTD PMID:27392435 Prkcd Rat cisplatin affects expression ISO PRKCD (Homo sapiens) 6480464 Cisplatin affects the expression of PRKCD mRNA CTD PMID:23300844 Prkcd Rat cisplatin increases cleavage EXP 6480464 Cisplatin results in increased cleavage of PRKCD protein CTD PMID:19578154 Prkcd Rat cisplatin increases response to substance ISO Prkcd (Mus musculus) 6480464 PRKCD results in increased susceptibility to Cisplatin CTD PMID:21633170 Prkcd Rat cisplatin increases localization ISO Prkcd (Mus musculus) 6480464 Cisplatin results in increased localization of PRKCD protein CTD PMID:21633170 Prkcd Rat cisplatin increases cleavage ISO Prkcd (Mus musculus) 6480464 Cisplatin results in increased cleavage of PRKCD protein CTD PMID:21633170 Prkcd Rat citalopram multiple interactions ISO PRKCD (Homo sapiens) 6480464 Citalopram inhibits the reaction [convulxin results in increased phosphorylation of PRKCD protein] CTD PMID:30592962 Prkcd Rat citalopram increases expression EXP 6480464 Citalopram results in increased expression of PRKCD mRNA CTD PMID:28467792 Prkcd Rat cobalt dichloride multiple interactions EXP 6480464 cobaltous chloride results in increased oxidation of and results in increased activity of PRKCD protein CTD PMID:18375950 Prkcd Rat cocaine multiple interactions ISO Prkcd (Mus musculus) 6480464 Cocaine results in increased expression of and results in increased cleavage of PRKCD protein; GPX1 more ... CTD PMID:30027653|PMID:30393195 Prkcd Rat cocaine increases cleavage ISO Prkcd (Mus musculus) 6480464 Cocaine results in increased cleavage of PRKCD protein CTD PMID:30027653 Prkcd Rat copper(II) sulfate increases expression ISO PRKCD (Homo sapiens) 6480464 Copper Sulfate results in increased expression of PRKCD mRNA CTD PMID:19549813 Prkcd Rat coumarin decreases phosphorylation ISO PRKCD (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of PRKCD protein CTD PMID:35688186 Prkcd Rat crocidolite asbestos affects localization ISO Prkcd (Mus musculus) 6480464 Asbestos, Crocidolite affects the localization of PRKCD protein CTD PMID:12057904|PMID:12626342 Prkcd Rat crocidolite asbestos increases activity ISO Prkcd (Mus musculus) 6480464 Asbestos, Crocidolite results in increased activity of PRKCD protein CTD PMID:12626342 Prkcd Rat crocidolite asbestos increases expression ISO Prkcd (Mus musculus) 6480464 Asbestos, Crocidolite results in increased expression of PRKCD protein CTD PMID:12057904|PMID:12626342 Prkcd Rat crotonaldehyde multiple interactions ISO PRKCD (Homo sapiens) 6480464 PRKCD protein promotes the reaction [2-butenal results in increased expression of HMOX1 protein] CTD PMID:21238556 Prkcd Rat curcumin multiple interactions ISO PRKCD (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Curcumin results in increased phosphorylation of PRKCD protein]; Acetylcysteine inhibits the more ... CTD PMID:17148446|PMID:17171638|PMID:18357586 Prkcd Rat curcumin multiple interactions EXP 6480464 Curcumin results in increased phosphorylation of and results in increased degradation of PRKCD protein CTD PMID:19161989 Prkcd Rat curcumin affects binding EXP 6480464 Curcumin binds to PRKCD protein CTD PMID:19161989 Prkcd Rat curcumin increases phosphorylation ISO PRKCD (Homo sapiens) 6480464 Curcumin results in increased phosphorylation of PRKCD protein CTD PMID:17171638 Prkcd Rat cycloheximide multiple interactions EXP 6480464 Cycloheximide inhibits the reaction [Buthionine Sulfoximine results in increased expression of PRKCD protein]; Cycloheximide inhibits more ... CTD PMID:11118818 Prkcd Rat cyclosporin A multiple interactions ISO Prkcd (Mus musculus) 6480464 Cyclosporine inhibits the reaction [3-Pyridinecarboxylic acid, 1,4-dihydro-2,6-dimethyl-5-nitro-4-(2-(trifluoromethyl)phenyl)-, Methyl ester results in increased cleavage of and more ... CTD PMID:37308051 Prkcd Rat D-glucose multiple interactions EXP 6480464 diphenyleneiodonium inhibits the reaction [Glucose results in increased expression of PRKCD protein] CTD PMID:12821678 Prkcd Rat D-glucose increases expression ISO PRKCD (Homo sapiens) 6480464 Glucose results in increased expression of PRKCD protein CTD PMID:16285992 Prkcd Rat D-glucose multiple interactions ISO PRKCD (Homo sapiens) 6480464 5,21 - 12,17-dimetheneo-18H-dibenzo(i,o)pyrrolo(3,4-1)(1,8)diazacyclohexandecine-18,10(19H)dione,8((dimethylamino)methyl)-6,7,8,9,10,11-hexahydro,monomethanesulfonate inhibits the reaction [Glucose results in increased expression of PRKCD protein]; bisindolylmaleimide more ... CTD PMID:16285992 Prkcd Rat D-glucose increases expression EXP 6480464 Glucose results in increased expression of PRKCD protein CTD PMID:12821678 Prkcd Rat D-mannitol multiple interactions ISO PRKCD (Homo sapiens) 6480464 Mannitol inhibits the reaction [Glucose results in increased expression of PRKCD protein] CTD PMID:16285992 Prkcd Rat daidzein decreases expression ISO PRKCD (Homo sapiens) 6480464 daidzein results in decreased expression of PRKCD mRNA CTD PMID:15757668 Prkcd Rat daunorubicin increases cleavage ISO PRKCD (Homo sapiens) 6480464 Daunorubicin results in increased cleavage of PRKCD protein CTD PMID:11082532 Prkcd Rat demethoxycurcumin multiple interactions ISO Prkcd (Mus musculus) 6480464 PRKCD protein affects the reaction [demethoxycurcumin results in increased expression of HMOX1 mRNA] CTD PMID:17535857 Prkcd Rat desferrioxamine B increases phosphorylation ISO PRKCD (Homo sapiens) 6480464 Deferoxamine results in increased phosphorylation of PRKCD protein CTD PMID:17097691 Prkcd Rat desferrioxamine B multiple interactions EXP 6480464 Deferoxamine results in increased cleavage of and affects the localization of PRKCD protein; PRKCD protein more ... CTD PMID:17563398 Prkcd Rat dextromethorphan affects response to substance ISO Prkcd (Mus musculus) 6480464 PRKCD protein affects the susceptibility to Dextromethorphan CTD PMID:34740715 Prkcd Rat dextromethorphan multiple interactions ISO Prkcd (Mus musculus) 6480464 [PRKCD protein affects the susceptibility to Dextromethorphan] which affects the activity of and affects the more ... CTD PMID:34740715 Prkcd Rat diarsenic trioxide multiple interactions ISO PRKCD (Homo sapiens) 6480464 [Arsenic Trioxide co-treated with Bortezomib] results in increased cleavage of and results in increased activity more ... CTD PMID:17495969|PMID:19662097 Prkcd Rat diarsenic trioxide increases phosphorylation EXP 6480464 Arsenic Trioxide results in increased phosphorylation of PRKCD protein CTD PMID:29986281 Prkcd Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of PRKCD mRNA CTD PMID:22546817 Prkcd Rat dibenziodolium multiple interactions ISO PRKCD (Homo sapiens) 6480464 diphenyleneiodonium inhibits the reaction [Pt(O,O'-acac)(gamma-acac)(DMS) affects the localization of PRKCD protein]; diphenyleneiodonium inhibits the reaction more ... CTD PMID:21362627|PMID:21420390 Prkcd Rat dibenziodolium multiple interactions EXP 6480464 diphenyleneiodonium inhibits the reaction [Glucose results in increased expression of PRKCD protein] CTD PMID:12821678 Prkcd Rat dibutyl phthalate increases expression ISO Prkcd (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of PRKCD mRNA CTD PMID:21266533 Prkcd Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of PRKCD mRNA CTD PMID:21266533 Prkcd Rat dieldrin multiple interactions ISO PRKCD (Homo sapiens) 6480464 BCL2 protein inhibits the reaction [Dieldrin results in increased activity of PRKCD protein] CTD PMID:15033812 Prkcd Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of PRKCD mRNA CTD PMID:22546817 Prkcd Rat dieldrin multiple interactions EXP 6480464 benzoylcarbonyl-aspartyl-glutamyl-valyl-aspartyl-fluoromethyl ketone inhibits the reaction [Dieldrin results in increased cleavage of and results in increased more ... CTD PMID:12831855|PMID:21801747 Prkcd Rat dieldrin increases activity EXP 6480464 Dieldrin results in increased activity of PRKCD protein CTD PMID:15033812 Prkcd Rat diethyl maleate multiple interactions EXP 6480464 Cycloheximide inhibits the reaction [diethyl maleate results in increased expression of PRKCD protein]; diethyl maleate more ... CTD PMID:11118818 Prkcd Rat dioxygen multiple interactions ISO PRKCD (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Oxygen deficiency results in increased activity of and results in increased more ... CTD PMID:11424089 Prkcd Rat disodium selenite decreases localization ISO Prkcd (Mus musculus) 6480464 Sodium Selenite results in decreased localization of PRKCD protein CTD PMID:14737004 Prkcd Rat divanadium pentaoxide multiple interactions EXP 6480464 PRKCD mutant form inhibits the reaction [vanadium pentoxide results in increased activity of CASP3 protein]; more ... CTD PMID:19646462 Prkcd Rat divanadium pentaoxide increases expression ISO Prkcd (Mus musculus) 6480464 vanadium pentoxide results in increased expression of PRKCD mRNA CTD PMID:26210822 Prkcd Rat dopamine multiple interactions ISO Prkcd (Mus musculus) 6480464 [rottlerin results in decreased activity of PRKCD protein] inhibits the reaction [Methamphetamine results in increased more ... CTD PMID:22512859 Prkcd Rat doxorubicin multiple interactions ISO PRKCD (Homo sapiens) 6480464 benzoylcarbonyl-valyl-aspartyl-valyl-alanyl-aspartyl-fluoromethyl ketone inhibits the reaction [Doxorubicin promotes the reaction [CASP2 protein results in increased cleavage more ... CTD PMID:15917298|PMID:19662097 Prkcd Rat doxorubicin multiple interactions EXP 6480464 Propofol inhibits the reaction [Doxorubicin results in increased cleavage of PRKCD protein] CTD PMID:22015447 Prkcd Rat doxorubicin increases cleavage EXP 6480464 Doxorubicin results in increased cleavage of PRKCD protein CTD PMID:22015447 Prkcd Rat doxorubicin increases response to substance ISO PRKCD (Homo sapiens) 6480464 PRKCD protein results in increased susceptibility to Doxorubicin CTD PMID:15917298 Prkcd Rat emodin decreases expression ISO PRKCD (Homo sapiens) 6480464 Emodin results in decreased expression of PRKCD mRNA CTD PMID:16045814 Prkcd Rat emodin affects expression EXP 6480464 Emodin affects the expression of PRKCD protein CTD PMID:19549930 Prkcd Rat endosulfan multiple interactions EXP 6480464 Endosulfan results in increased cleavage of and results in increased activity of PRKCD protein; PRKCD more ... CTD PMID:30796443 Prkcd Rat entinostat increases expression ISO PRKCD (Homo sapiens) 6480464 entinostat results in increased expression of PRKCD mRNA CTD PMID:27188386 Prkcd Rat escitalopram increases expression EXP 6480464 Escitalopram results in increased expression of PRKCD mRNA CTD PMID:28467792 Prkcd Rat ethanol increases phosphorylation ISO PRKCD (Homo sapiens) 6480464 Ethanol results in increased phosphorylation of PRKCD protein CTD PMID:18182400 Prkcd Rat ethanol affects expression ISO Prkcd (Mus musculus) 6480464 Ethanol affects the expression of PRKCD mRNA CTD PMID:30319688 Prkcd Rat ethanol increases expression ISO Prkcd (Mus musculus) 6480464 Ethanol results in increased expression of PRKCD mRNA CTD PMID:21955143 Prkcd Rat ethanol multiple interactions EXP 6480464 Ethanol inhibits the reaction [Streptozocin results in increased expression of PRKCD protein]; N-methyl-N-(6-methoxy-1-phenyl-1,2,3,4-tetrahydronaphthalen-2-ylmethyl)aminomethylcarboxylic acid inhibits more ... CTD PMID:12198386|PMID:20655511 Prkcd Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of PRKCD mRNA CTD PMID:20655511 Prkcd Rat ethanol multiple interactions ISO PRKCD (Homo sapiens) 6480464 sodium arsenite promotes the reaction [Ethanol results in increased phosphorylation of PRKCD protein] CTD PMID:18182400 Prkcd Rat etoposide multiple interactions ISO PRKCD (Homo sapiens) 6480464 Etoposide results in increased cleavage of and results in increased activity of PRKCD protein CTD PMID:19662097 Prkcd Rat fenamidone increases expression ISO Prkcd (Mus musculus) 6480464 fenamidone results in increased expression of PRKCD mRNA CTD PMID:27029645 Prkcd Rat folic acid decreases expression ISO Prkcd (Mus musculus) 6480464 Folic Acid results in decreased expression of PRKCD mRNA CTD PMID:25629700 Prkcd Rat folic acid multiple interactions ISO Prkcd (Mus musculus) 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of PRKCD mRNA] CTD PMID:22206623 Prkcd Rat folpet increases expression ISO Prkcd (Mus musculus) 6480464 folpet results in increased expression of PRKCD mRNA CTD PMID:31558096 Prkcd Rat fomepizole multiple interactions EXP 6480464 fomepizole inhibits the reaction [allyl alcohol affects the localization of PRKCD protein] CTD PMID:12755590 Prkcd Rat FR900359 affects phosphorylation ISO PRKCD (Homo sapiens) 6480464 FR900359 affects the phosphorylation of PRKCD protein CTD PMID:37730182 Prkcd Rat furfural multiple interactions ISO PRKCD (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of more ... CTD PMID:38598786 Prkcd Rat genistein decreases expression ISO PRKCD (Homo sapiens) 6480464 Genistein results in decreased expression of PRKCD mRNA CTD PMID:15757668 Prkcd Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PRKCD mRNA CTD PMID:33387578 Prkcd Rat ginsenoside Re multiple interactions ISO Prkcd (Mus musculus) 6480464 3-nitropropionic acid inhibits the reaction [ginsenoside Re inhibits the reaction [3-Pyridinecarboxylic acid, 1,4-dihydro-2,6-dimethyl-5-nitro-4-(2-(trifluoromethyl)phenyl)-, Methyl ester more ... CTD PMID:24430743|PMID:37308051 Prkcd Rat ginsenoside Re multiple interactions ISO PRKCD (Homo sapiens) 6480464 ginsenoside Re inhibits the reaction [Methamphetamine affects the localization of PRKCD protein]; ginsenoside Re inhibits more ... CTD PMID:25523949 Prkcd Rat ginsenoside Re increases response to substance ISO Prkcd (Mus musculus) 6480464 PRKCD results in increased susceptibility to ginsenoside Re CTD PMID:24430743 Prkcd Rat glucose multiple interactions EXP 6480464 diphenyleneiodonium inhibits the reaction [Glucose results in increased expression of PRKCD protein] CTD PMID:12821678 Prkcd Rat glucose increases expression ISO PRKCD (Homo sapiens) 6480464 Glucose results in increased expression of PRKCD protein CTD PMID:16285992 Prkcd Rat glucose multiple interactions ISO PRKCD (Homo sapiens) 6480464 5,21 - 12,17-dimetheneo-18H-dibenzo(i,o)pyrrolo(3,4-1)(1,8)diazacyclohexandecine-18,10(19H)dione,8((dimethylamino)methyl)-6,7,8,9,10,11-hexahydro,monomethanesulfonate inhibits the reaction [Glucose results in increased expression of PRKCD protein]; bisindolylmaleimide more ... CTD PMID:16285992 Prkcd Rat glucose increases expression EXP 6480464 Glucose results in increased expression of PRKCD protein CTD PMID:12821678 Prkcd Rat glutathione multiple interactions ISO PRKCD (Homo sapiens) 6480464 Glutathione inhibits the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased phosphorylation of PRKCD protein]; Glutathione inhibits more ... CTD PMID:15707588|PMID:17171638 Prkcd Rat glutathione affects abundance ISO Prkcd (Mus musculus) 6480464 PRKCD protein affects the abundance of Glutathione CTD PMID:15131007 Prkcd Rat heptachlor multiple interactions EXP 6480464 1-(5-Isoquinolinesulfonyl)-2-Methylpiperazine inhibits the reaction [Heptachlor affects the localization of PRKCD protein]; calphostin C inhibits the more ... CTD PMID:14678745 Prkcd Rat hexadecanoic acid decreases phosphorylation ISO PRKCD (Homo sapiens) 6480464 Palmitic Acid results in decreased phosphorylation of PRKCD protein CTD PMID:28073184 Prkcd Rat histamine multiple interactions ISO PRKCD (Homo sapiens) 6480464 epigallocatechin gallate inhibits the reaction [Histamine results in increased phosphorylation of PRKCD protein]; Histamine results more ... CTD PMID:23333628 Prkcd Rat hydrogen cyanide decreases expression ISO Prkcd (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of PRKCD mRNA CTD PMID:33914522 Prkcd Rat hydrogen peroxide increases activity ISO Prkcd (Mus musculus) 6480464 Hydrogen Peroxide results in increased activity of PRKCD protein CTD PMID:12626342 Prkcd Rat hydrogen peroxide multiple interactions ISO Prkcd (Mus musculus) 6480464 [Hydrogen Peroxide affects the activity of PRKCD protein] which results in increased activity of MAPK1 more ... CTD PMID:14975446 Prkcd Rat hydrogen peroxide multiple interactions EXP 6480464 Hydrogen Peroxide affects the localization of and results in increased activity of PRKCD protein CTD PMID:12821678 Prkcd Rat hydrogen peroxide affects localization ISO Prkcd (Mus musculus) 6480464 Hydrogen Peroxide affects the localization of PRKCD protein CTD PMID:12626342 Prkcd Rat hydrogen peroxide increases expression ISO Prkcd (Mus musculus) 6480464 Hydrogen Peroxide results in increased expression of PRKCD protein CTD PMID:12626342 Prkcd Rat irinotecan increases phosphorylation ISO PRKCD (Homo sapiens) 6480464 Irinotecan metabolite results in increased phosphorylation of PRKCD protein; Irinotecan results in increased phosphorylation of more ... CTD PMID:15723263 Prkcd Rat isoprenaline multiple interactions EXP 6480464 2-((2-piperidin-1-ylethyl)thio)quinazolin-4(3H)-one inhibits the reaction [Isoproterenol results in increased phosphorylation of PRKCD protein] CTD PMID:16716347 Prkcd Rat isoprenaline increases phosphorylation EXP 6480464 Isoproterenol results in increased phosphorylation of PRKCD protein CTD PMID:16716347 Prkcd Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of PRKCD mRNA; Isoproterenol results in increased expression of PRKCD more ... CTD PMID:12775975 Prkcd Rat isorhamnetin increases phosphorylation ISO PRKCD (Homo sapiens) 6480464 3-methylquercetin results in increased phosphorylation of PRKCD protein CTD PMID:24211276 Prkcd Rat ivermectin decreases expression ISO PRKCD (Homo sapiens) 6480464 Ivermectin results in decreased expression of PRKCD protein CTD PMID:32959892 Prkcd Rat kainic acid multiple interactions ISO Prkcd (Mus musculus) 6480464 [cyanoginosin LR co-treated with Kainic Acid] results in increased phosphorylation of PRKCD protein CTD PMID:34352349 Prkcd Rat lead(0) increases activity EXP 6480464 Lead results in increased activity of PRKCD protein CTD PMID:10693946 Prkcd Rat lead(0) multiple interactions EXP 6480464 PRKCD protein promotes the reaction [Lead results in increased localization of APP protein]; PRKCD protein more ... CTD PMID:20488202 Prkcd Rat lipopolysaccharide multiple interactions ISO Prkcd (Mus musculus) 6480464 Lipopolysaccharides affects the localization of and results in increased activity of PRKCD protein; PRKCD protein more ... CTD PMID:16330529 Prkcd Rat lovastatin multiple interactions EXP 6480464 benzoylcarbonyl-aspartyl-glutamyl-valyl-aspartyl-fluoromethyl ketone inhibits the reaction [Lovastatin results in increased cleavage of PRKCD protein]; Mevalonic Acid more ... CTD PMID:16367743 Prkcd Rat lovastatin increases cleavage EXP 6480464 Lovastatin results in increased cleavage of PRKCD protein CTD PMID:16367743 Prkcd Rat LY294002 multiple interactions ISO PRKCD (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Curcumin results in increased phosphorylation of PRKCD protein]; 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the more ... CTD PMID:11424089|PMID:17171638|PMID:20082316 Prkcd Rat LY294002 decreases phosphorylation ISO PRKCD (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one results in decreased phosphorylation of PRKCD protein CTD PMID:20082316 Prkcd Rat LY294002 affects localization ISO PRKCD (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one affects the localization of PRKCD protein CTD PMID:20082316 Prkcd Rat magnesium atom affects localization ISO Prkcd (Mus musculus) 6480464 Magnesium affects the localization of PRKCD protein CTD PMID:8106444 Prkcd Rat manganese atom increases phosphorylation EXP 6480464 Manganese results in increased phosphorylation of PRKCD protein CTD PMID:21812036 Prkcd Rat manganese atom multiple interactions EXP 6480464 Manganese promotes the reaction [PRKCD protein binds to SLC1A5 protein]; Manganese promotes the reaction [PRKCD more ... CTD PMID:21812036|PMID:25416158 Prkcd Rat manganese atom multiple interactions ISO PRKCD (Homo sapiens) 6480464 SNCA protein inhibits the reaction [Manganese results in increased cleavage of and results in increased more ... CTD PMID:25416158 Prkcd Rat manganese(0) increases phosphorylation EXP 6480464 Manganese results in increased phosphorylation of PRKCD protein CTD PMID:21812036 Prkcd Rat manganese(0) multiple interactions EXP 6480464 Manganese promotes the reaction [PRKCD protein binds to SLC1A5 protein]; Manganese promotes the reaction [PRKCD more ... CTD PMID:21812036|PMID:25416158 Prkcd Rat manganese(0) multiple interactions ISO PRKCD (Homo sapiens) 6480464 SNCA protein inhibits the reaction [Manganese results in increased cleavage of and results in increased more ... CTD PMID:25416158 Prkcd Rat manganese(II) chloride multiple interactions EXP 6480464 manganese chloride results in increased cleavage of and results in increased activity of PRKCD protein; more ... CTD PMID:21310168|PMID:25416158 Prkcd Rat manganese(II) chloride multiple interactions ISO PRKCD (Homo sapiens) 6480464 SNCA protein inhibits the reaction [manganese chloride results in increased cleavage of and results in more ... CTD PMID:25416158 Prkcd Rat manganese(II) chloride increases activity EXP 6480464 manganese chloride results in increased activity of PRKCD protein CTD PMID:21310168 Prkcd Rat methamphetamine affects localization ISO Prkcd (Mus musculus) 6480464 Methamphetamine affects the localization of PRKCD protein CTD PMID:24430743 Prkcd Rat methamphetamine multiple interactions ISO PRKCD (Homo sapiens) 6480464 ginsenoside Re inhibits the reaction [Methamphetamine affects the localization of PRKCD protein]; ginsenoside Re inhibits more ... CTD PMID:25523949 Prkcd Rat methamphetamine affects localization ISO PRKCD (Homo sapiens) 6480464 Methamphetamine affects the localization of PRKCD protein CTD PMID:25523949 Prkcd Rat methamphetamine affects response to substance ISO Prkcd (Mus musculus) 6480464 PRKCD protein affects the susceptibility to Methamphetamine CTD PMID:22512859 Prkcd Rat methamphetamine increases expression ISO Prkcd (Mus musculus) 6480464 Methamphetamine results in increased expression of PRKCD protein CTD PMID:22512859 Prkcd Rat methamphetamine increases response to substance ISO Prkcd (Mus musculus) 6480464 PRKCD results in increased susceptibility to Methamphetamine CTD PMID:24430743 Prkcd Rat methamphetamine multiple interactions ISO Prkcd (Mus musculus) 6480464 [rottlerin results in decreased activity of PRKCD protein] inhibits the reaction [Methamphetamine results in decreased more ... CTD PMID:22512859|PMID:24430743|PMID:31422080 Prkcd Rat methotrexate affects response to substance ISO PRKCD (Homo sapiens) 6480464 PRKCD mRNA affects the susceptibility to Methotrexate CTD PMID:22753658 Prkcd Rat methyl beta-cyclodextrin multiple interactions ISO PRKCD (Homo sapiens) 6480464 methyl-beta-cyclodextrin inhibits the reaction [Ursodeoxycholic Acid results in increased localization of PRKCD protein] CTD PMID:21362627 Prkcd Rat mevalonic acid multiple interactions EXP 6480464 Mevalonic Acid inhibits the reaction [Lovastatin results in increased cleavage of PRKCD protein] CTD PMID:16367743 Prkcd Rat microcystin-LR multiple interactions ISO Prkcd (Mus musculus) 6480464 [cyanoginosin LR co-treated with Kainic Acid] results in increased phosphorylation of PRKCD protein CTD PMID:34352349 Prkcd Rat mitomycin C multiple interactions ISO PRKCD (Homo sapiens) 6480464 Mitomycin promotes the reaction [CASP3 protein results in increased cleavage of PRKCD protein] CTD PMID:10960761 Prkcd Rat morphine decreases expression ISO Prkcd (Mus musculus) 6480464 Morphine results in decreased expression of PRKCD mRNA CTD PMID:21955143 Prkcd Rat Morroniside multiple interactions EXP 6480464 morroniside results in increased expression of and results in increased phosphorylation of PRKCD protein CTD PMID:31991140 Prkcd Rat motexafin gadolinium decreases expression ISO PRKCD (Homo sapiens) 6480464 motexafin gadolinium results in decreased expression of PRKCD mRNA CTD PMID:16357179 Prkcd Rat myo-inositol hexakisphosphate multiple interactions ISO PRKCD (Homo sapiens) 6480464 Phytic Acid results in increased expression of and results in increased activity of and affects more ... CTD PMID:15868430 Prkcd Rat N-[2-[4-(2-methoxyphenyl)-1-piperazinyl]ethyl]-N-(2-pyridinyl)cyclohexanecarboxamide multiple interactions ISO Prkcd (Mus musculus) 6480464 N-(2-(4-(2-methoxyphenyl)-1-piperazinyl)ethyl)-N-(2-pyridinyl)cyclohexanecarboxamide inhibits the reaction [8-Hydroxy-2-(di-n-propylamino)tetralin promotes the reaction [NCF1 protein binds to PRKCD protein]]; N-(2-(4-(2-methoxyphenyl)-1-piperazinyl)ethyl)-N-(2-pyridinyl)cyclohexanecarboxamide more ... CTD PMID:30366073 Prkcd Rat N-acetyl-L-cysteine multiple interactions ISO PRKCD (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Curcumin results in increased phosphorylation of PRKCD protein]; Acetylcysteine inhibits the more ... CTD PMID:17171638|PMID:21362627 Prkcd Rat N-acetyl-L-cysteine multiple interactions ISO Prkcd (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [3-Pyridinecarboxylic acid, 1,4-dihydro-2,6-dimethyl-5-nitro-4-(2-(trifluoromethyl)phenyl)-, Methyl ester results in increased cleavage of and more ... CTD PMID:37308051 Prkcd Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Cadmium results in increased phosphorylation of PRKCD protein] CTD PMID:27658547 Prkcd Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO PRKCD (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde promotes the reaction [NSC606985 results in increased activity of and results in increased more ... CTD PMID:15707588|PMID:19662097|PMID:19747914 Prkcd Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases phosphorylation ISO PRKCD (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased phosphorylation of PRKCD protein CTD PMID:15707588 Prkcd Rat N-formyl-L-methionyl-L-leucyl-L-phenylalanine multiple interactions EXP 6480464 2-benzyl-3-(4-hydroxymethylphenyl)indazole inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine affects the localization of and results in increased phosphorylation more ... CTD PMID:19445920 Prkcd Rat N-methyl-4-phenylpyridinium increases expression ISO Prkcd (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PRKCD mRNA CTD PMID:22776087 Prkcd Rat N-methyl-4-phenylpyridinium increases expression ISO PRKCD (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PRKCD mRNA CTD PMID:24810058 Prkcd Rat N-methyl-4-phenylpyridinium decreases expression ISO PRKCD (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of PRKCD mRNA CTD PMID:25234470 Prkcd Rat N-methyl-4-phenylpyridinium increases cleavage EXP 6480464 1-Methyl-4-phenylpyridinium results in increased cleavage of PRKCD protein CTD PMID:15033169 Prkcd Rat N-methyl-4-phenylpyridinium affects response to substance EXP 6480464 PRKCD mRNA affects the susceptibility to 1-Methyl-4-phenylpyridinium CTD PMID:15033169 Prkcd Rat N-methyl-4-phenylpyridinium multiple interactions EXP 6480464 benzoylcarbonyl-aspartyl-glutamyl-valyl-aspartyl-fluoromethyl ketone inhibits the reaction [1-Methyl-4-phenylpyridinium results in increased cleavage of PRKCD protein]; benzyloxycarbonyl-leucyl-glutamyl-histidyl-aspartic acid more ... CTD PMID:15033169 Prkcd Rat naringin multiple interactions EXP 6480464 rottlerin inhibits the reaction [naringin results in increased phosphorylation of PRKCD protein] CTD PMID:25773745 Prkcd Rat naringin increases phosphorylation EXP 6480464 naringin results in increased phosphorylation of PRKCD protein CTD PMID:25773745 Prkcd Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of PRKCD mRNA CTD PMID:22546817 Prkcd Rat niclosamide increases expression ISO PRKCD (Homo sapiens) 6480464 Niclosamide results in increased expression of PRKCD mRNA CTD PMID:36318118 Prkcd Rat nicotine decreases expression ISO Prkcd (Mus musculus) 6480464 Nicotine results in decreased expression of PRKCD mRNA CTD PMID:21955143 Prkcd Rat nitrates multiple interactions ISO Prkcd (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PRKCD more ... CTD PMID:35964746 Prkcd Rat nitric oxide multiple interactions EXP 6480464 Nitric Oxide deficiency inhibits the reaction [Brimonidine Tartrate affects the localization of PRKCD protein] CTD PMID:12388232 Prkcd Rat oroxylin A multiple interactions ISO PRKCD (Homo sapiens) 6480464 5,7-dihydroxy-6-methoxy-2-phenylchromen-4-one inhibits the reaction [Tetradecanoylphorbol Acetate affects the localization of PRKCD protein] CTD PMID:22245252 Prkcd Rat oxidopamine multiple interactions EXP 6480464 benzoylcarbonyl-aspartyl-glutamyl-valyl-aspartyl-fluoromethyl ketone inhibits the reaction [Oxidopamine results in increased cleavage of and results in increased more ... CTD PMID:21846476 Prkcd Rat oxidopamine increases response to substance EXP 6480464 PRKCD protein results in increased susceptibility to Oxidopamine CTD PMID:21846476 Prkcd Rat oxidopamine increases response to substance ISO Prkcd (Mus musculus) 6480464 PRKCD protein results in increased susceptibility to Oxidopamine CTD PMID:21846476 Prkcd Rat oxidopamine multiple interactions ISO Prkcd (Mus musculus) 6480464 Oxidopamine results in increased cleavage of and results in increased activity of PRKCD protein CTD PMID:21846476 Prkcd Rat ozone increases expression ISO PRKCD (Homo sapiens) 6480464 Ozone results in increased expression of PRKCD mRNA CTD PMID:31476115 Prkcd Rat ozone multiple interactions ISO PRKCD (Homo sapiens) 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of PRKCD mRNA CTD PMID:31476115 Prkcd Rat paclitaxel affects localization ISO PRKCD (Homo sapiens) 6480464 Paclitaxel affects the localization of PRKCD protein CTD PMID:9852137 Prkcd Rat paracetamol affects expression ISO Prkcd (Mus musculus) 6480464 Acetaminophen affects the expression of PRKCD mRNA CTD PMID:17562736 Prkcd Rat paraquat multiple interactions EXP 6480464 anacardic acid inhibits the reaction [Paraquat results in increased cleavage of and results in increased more ... CTD PMID:21777615|PMID:23827392 Prkcd Rat paraquat multiple interactions ISO Prkcd (Mus musculus) 6480464 [APOD protein affects the susceptibility to Paraquat] which affects the expression of PRKCD mRNA CTD PMID:21463325 Prkcd Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of PRKCD mRNA CTD PMID:18198484 Prkcd Rat paraquat decreases expression ISO Prkcd (Mus musculus) 6480464 Paraquat results in decreased expression of PRKCD mRNA CTD PMID:21371552 Prkcd Rat phencyclidine increases expression ISO Prkcd (Mus musculus) 6480464 Phencyclidine results in increased expression of PRKCD mRNA CTD PMID:12105081 Prkcd Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of PRKCD protein CTD PMID:12720544 Prkcd Rat phenylephrine affects localization EXP 6480464 Phenylephrine affects the localization of PRKCD protein CTD PMID:12720544 Prkcd Rat phorbol 12,13-dibutanoate affects binding ISO Prkcd (Mus musculus) 6480464 Phorbol 12,13-Dibutyrate binds to PRKCD protein CTD PMID:8106444 Prkcd Rat phorbol 12,13-dibutanoate increases expression ISO Prkcd (Mus musculus) 6480464 Phorbol 12,13-Dibutyrate results in increased expression of PRKCD protein CTD PMID:12626342 Prkcd Rat phorbol 12,13-dibutanoate affects localization ISO Prkcd (Mus musculus) 6480464 Phorbol 12,13-Dibutyrate affects the localization of PRKCD protein CTD PMID:12057904|PMID:12626342 Prkcd Rat phorbol 13-acetate 12-myristate multiple interactions ISO Prkcd (Mus musculus) 6480464 PRKCD protein promotes the reaction [[Tetradecanoylphorbol Acetate results in increased expression of and results in more ... CTD PMID:15538571|PMID:21047949 Prkcd Rat phorbol 13-acetate 12-myristate affects localization ISO PRKCD (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate affects the localization of PRKCD protein CTD PMID:15976015|PMID:18628248|PMID:20599481|PMID:21705328|PMID:22245252|PMID:29669290|PMID:30133131|PMID:9852137 Prkcd Rat phorbol 13-acetate 12-myristate increases activity ISO PRKCD (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased activity of PRKCD protein CTD PMID:23288142 Prkcd Rat phorbol 13-acetate 12-myristate increases phosphorylation ISO PRKCD (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased phosphorylation of PRKCD protein CTD PMID:15707588|PMID:20599481|PMID:21354279 Prkcd Rat phorbol 13-acetate 12-myristate decreases expression ISO PRKCD (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in decreased expression of PRKCD protein CTD PMID:15949478|PMID:18313772 Prkcd Rat phorbol 13-acetate 12-myristate affects localization EXP 6480464 Tetradecanoylphorbol Acetate affects the localization of PRKCD protein CTD PMID:12755590|PMID:14678745 Prkcd Rat phorbol 13-acetate 12-myristate multiple interactions EXP 6480464 1-(5-Isoquinolinesulfonyl)-2-Methylpiperazine inhibits the reaction [Tetradecanoylphorbol Acetate affects the localization of PRKCD protein]; calphostin C inhibits more ... CTD PMID:14678745|PMID:16361709 Prkcd Rat phorbol 13-acetate 12-myristate increases localization ISO Prkcd (Mus musculus) 6480464 Tetradecanoylphorbol Acetate results in increased localization of PRKCD protein CTD PMID:10656618 Prkcd Rat phorbol 13-acetate 12-myristate increases activity ISO Prkcd (Mus musculus) 6480464 Tetradecanoylphorbol Acetate results in increased activity of PRKCD protein CTD PMID:10567579 Prkcd Rat phorbol 13-acetate 12-myristate affects phosphorylation ISO PRKCD (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate affects the phosphorylation of PRKCD protein CTD PMID:15380616 Prkcd Rat phorbol 13-acetate 12-myristate multiple interactions ISO PRKCD (Homo sapiens) 6480464 2-(1-(3-dimethylaminopropyl)-5-methoxyindol-3-yl)-3-(1H-indol-3-yl)maleimide affects the reaction [Tetradecanoylphorbol Acetate affects the phosphorylation of PRKCD protein]; 3-caffeoyl-4-dihydrocaffeoylquinic acid inhibits more ... CTD PMID:11424089|PMID:15380616|PMID:18628248|PMID:20599481|PMID:22245252|PMID:22643241|PMID:23288142|PMID:23333628|PMID:23941771 Prkcd Rat picrotoxin decreases expression EXP 6480464 Picrotoxin results in decreased expression of PRKCD mRNA CTD PMID:15170462 Prkcd Rat potassium cyanide increases expression ISO Prkcd (Mus musculus) 6480464 Potassium Cyanide results in increased expression of PRKCD mRNA CTD PMID:33914522 Prkcd Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of PRKCD mRNA CTD PMID:17170212 Prkcd Rat progesterone multiple interactions ISO Prkcd (Mus musculus) 6480464 PRKCD protein promotes the reaction [[Tetradecanoylphorbol Acetate results in increased expression of and results in more ... CTD PMID:21047949 Prkcd Rat propofol multiple interactions EXP 6480464 Propofol inhibits the reaction [Doxorubicin results in increased cleavage of PRKCD protein] CTD PMID:22015447 Prkcd Rat propranolol decreases expression EXP 6480464 Propranolol results in decreased expression of PRKCD protein CTD PMID:20668454 Prkcd Rat puerarin multiple interactions ISO Prkcd (Mus musculus) 6480464 PRKCD mutant form inhibits the reaction [puerarin results in increased expression of HMOX1 protein] CTD PMID:20060010 Prkcd Rat puerarin increases phosphorylation ISO Prkcd (Mus musculus) 6480464 puerarin results in increased phosphorylation of PRKCD protein CTD PMID:20060010 Prkcd Rat quercetin multiple interactions ISO PRKCD (Homo sapiens) 6480464 Quercetin inhibits the reaction [Histamine results in increased phosphorylation of and affects the localization of more ... CTD PMID:11424089|PMID:18628248|PMID:19297429|PMID:23333628 Prkcd Rat quercetin increases cleavage ISO Prkcd (Mus musculus) 6480464 Quercetin results in increased cleavage of PRKCD protein CTD PMID:26076811 Prkcd Rat quercetin affects localization ISO Prkcd (Mus musculus) 6480464 Quercetin affects the localization of PRKCD protein CTD PMID:15538571|PMID:24275163 Prkcd Rat quercetin multiple interactions ISO Prkcd (Mus musculus) 6480464 Tetradecanoylphorbol Acetate promotes the reaction [Quercetin affects the localization of PRKCD protein] CTD PMID:15538571 Prkcd Rat quercetin increases expression ISO Prkcd (Mus musculus) 6480464 Quercetin results in increased expression of PRKCD mRNA CTD PMID:26076811 Prkcd Rat reactive oxygen species multiple interactions ISO PRKCD (Homo sapiens) 6480464 [Pt(O,O'-acac)(gamma-acac)(DMS) results in increased abundance of Reactive Oxygen Species] which results in increased activity of more ... CTD PMID:21420390 Prkcd Rat reactive oxygen species multiple interactions EXP 6480464 PRKCD protein affects the reaction [Reactive Oxygen Species affects the phosphorylation of SHC1 protein] CTD PMID:19168439 Prkcd Rat reactive oxygen species multiple interactions ISO Prkcd (Mus musculus) 6480464 PRKCD protein affects the reaction [sphingosine phosphorylcholine results in increased abundance of Reactive Oxygen Species] CTD PMID:15722202 Prkcd Rat resveratrol multiple interactions ISO PRKCD (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of PRKCD mRNA CTD PMID:23557933 Prkcd Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of PRKCD mRNA CTD PMID:27979718 Prkcd Rat rottlerin multiple interactions ISO PRKCD (Homo sapiens) 6480464 [rottlerin results in decreased activity of PRKCD protein] inhibits the reaction [Tetradecanoylphorbol Acetate promotes the more ... CTD PMID:16260419|PMID:17171638|PMID:19662097|PMID:22643241 Prkcd Rat rottlerin decreases response to substance ISO PRKCD (Homo sapiens) 6480464 PRKCD protein results in decreased susceptibility to rottlerin CTD PMID:22902833 Prkcd Rat rottlerin decreases activity EXP 6480464 rottlerin results in decreased activity of PRKCD protein CTD PMID:12720544|PMID:20488202 Prkcd Rat rottlerin decreases phosphorylation ISO Prkcd (Mus musculus) 6480464 rottlerin results in decreased phosphorylation of PRKCD protein CTD PMID:19393235 Prkcd Rat rottlerin multiple interactions EXP 6480464 [rottlerin results in decreased activity of PRKCD protein] which results in decreased susceptibility to 2-methylcyclopentadienyl more ... CTD PMID:11880503|PMID:15681813|PMID:20488202|PMID:20830294|PMID:21310168|PMID:25773745|PMID:27658547 Prkcd Rat rottlerin decreases activity ISO Prkcd (Mus musculus) 6480464 rottlerin results in decreased activity of PRKCD protein CTD PMID:21633170 Prkcd Rat rottlerin multiple interactions ISO Prkcd (Mus musculus) 6480464 [rottlerin results in decreased activity of PRKCD protein] inhibits the reaction [Methamphetamine results in decreased more ... CTD PMID:15574884|PMID:22512859|PMID:25895139|PMID:30366073|PMID:32437895|PMID:34740715 Prkcd Rat rottlerin decreases activity ISO PRKCD (Homo sapiens) 6480464 rottlerin results in decreased activity of PRKCD protein CTD PMID:15949478|PMID:15955695|PMID:18357586 Prkcd Rat S-butyl-DL-homocysteine (S,R)-sulfoximine multiple interactions ISO PRKCD (Homo sapiens) 6480464 Buthionine Sulfoximine promotes the reaction [Curcumin results in increased phosphorylation of PRKCD protein] CTD PMID:17171638 Prkcd Rat S-butyl-DL-homocysteine (S,R)-sulfoximine multiple interactions EXP 6480464 Buthionine Sulfoximine results in increased expression of and results in increased activity of PRKCD protein; more ... CTD PMID:11118818 Prkcd Rat serpentine asbestos decreases response to substance ISO Prkcd (Mus musculus) 6480464 PRKCD gene mutant form results in decreased susceptibility to Asbestos, Serpentine CTD PMID:19116364 Prkcd Rat serpentine asbestos multiple interactions ISO Prkcd (Mus musculus) 6480464 Asbestos, Serpentine promotes the reaction [PRKCD protein binds to PRKD1 protein]; PRKCD protein affects the more ... CTD PMID:19116364 Prkcd Rat silicon dioxide decreases expression ISO PRKCD (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of PRKCD mRNA CTD PMID:25895662 Prkcd Rat sirolimus affects localization ISO PRKCD (Homo sapiens) 6480464 Sirolimus affects the localization of PRKCD protein CTD PMID:20082316 Prkcd Rat sirolimus multiple interactions ISO PRKCD (Homo sapiens) 6480464 sodium arsenite promotes the reaction [Sirolimus results in decreased phosphorylation of PRKCD protein] CTD PMID:20082316 Prkcd Rat sirolimus decreases phosphorylation ISO PRKCD (Homo sapiens) 6480464 Sirolimus results in decreased phosphorylation of PRKCD protein CTD PMID:20082316 Prkcd Rat sodium arsenate increases activity ISO Prkcd (Mus musculus) 6480464 sodium arsenate results in increased activity of PRKCD protein CTD PMID:11796722 Prkcd Rat sodium arsenite affects expression ISO PRKCD (Homo sapiens) 6480464 sodium arsenite affects the expression of PRKCD protein CTD PMID:20082316 Prkcd Rat sodium arsenite multiple interactions EXP 6480464 rottlerin inhibits the reaction [sodium arsenite results in increased phosphorylation of PRKCD protein]; sodium arsenite more ... CTD PMID:20830294 Prkcd Rat sodium arsenite increases expression ISO PRKCD (Homo sapiens) 6480464 sodium arsenite results in increased expression of PRKCD mRNA CTD PMID:12016162|PMID:12377979|PMID:38568856 Prkcd Rat sodium arsenite decreases phosphorylation ISO PRKCD (Homo sapiens) 6480464 sodium arsenite results in decreased phosphorylation of PRKCD protein CTD PMID:20082316 Prkcd Rat sodium arsenite multiple interactions ISO PRKCD (Homo sapiens) 6480464 RTKI cpd inhibits the reaction [sodium arsenite affects the expression of PRKCD protein]; RTKI cpd more ... CTD PMID:18182400|PMID:20082316 Prkcd Rat sodium chloride multiple interactions ISO PRKCD (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of more ... CTD PMID:38598786 Prkcd Rat sodium dichromate increases expression ISO Prkcd (Mus musculus) 6480464 sodium bichromate results in increased expression of PRKCD mRNA CTD PMID:31558096 Prkcd Rat staurosporine multiple interactions ISO PRKCD (Homo sapiens) 6480464 Staurosporine inhibits the reaction [Curcumin results in increased phosphorylation of PRKCD protein] CTD PMID:17171638 Prkcd Rat staurosporine multiple interactions EXP 6480464 Staurosporine inhibits the reaction [Heptachlor affects the localization of PRKCD protein]; Staurosporine inhibits the reaction more ... CTD PMID:14678745 Prkcd Rat streptozocin multiple interactions EXP 6480464 arjunolic acid inhibits the reaction [Streptozocin results in increased expression of PRKCD protein]; Ethanol inhibits more ... CTD PMID:12198386|PMID:16478977|PMID:19682444 Prkcd Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of PRKCD protein CTD PMID:12198386|PMID:19682444 Prkcd Rat tamibarotene increases expression ISO PRKCD (Homo sapiens) 6480464 tamibarotene results in increased expression of PRKCD mRNA CTD PMID:15498508 Prkcd Rat tamoxifen decreases phosphorylation ISO Prkcd (Mus musculus) 6480464 Tamoxifen results in decreased phosphorylation of PRKCD protein CTD PMID:19393235 Prkcd Rat taurine multiple interactions EXP 6480464 Taurine inhibits the reaction [sodium arsenite results in increased expression of and results in increased more ... CTD PMID:20830294 Prkcd Rat testosterone increases expression ISO Prkcd (Mus musculus) 6480464 Testosterone results in increased expression of PRKCD mRNA CTD PMID:20403060 Prkcd Rat testosterone decreases expression ISO PRKCD (Homo sapiens) 6480464 Testosterone results in decreased expression of PRKCD mRNA CTD PMID:33359661 Prkcd Rat tetraphene multiple interactions ISO PRKCD (Homo sapiens) 6480464 [rottlerin results in decreased activity of PRKCD protein] inhibits the reaction [Tetradecanoylphorbol Acetate promotes the more ... CTD PMID:22643241 Prkcd Rat thalidomide decreases expression ISO PRKCD (Homo sapiens) 6480464 Thalidomide results in decreased expression of PRKCD mRNA CTD PMID:32756504 Prkcd Rat thapsigargin decreases localization ISO Prkcd (Mus musculus) 6480464 Thapsigargin results in decreased localization of PRKCD protein CTD PMID:15574884 Prkcd Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PRKCD mRNA CTD PMID:34492290 Prkcd Rat thiram increases activity ISO PRKCD (Homo sapiens) 6480464 Thiram results in increased activity of PRKCD protein CTD PMID:15998240 Prkcd Rat titanium dioxide increases expression ISO Prkcd (Mus musculus) 6480464 titanium dioxide results in increased expression of PRKCD mRNA CTD PMID:29264374 Prkcd Rat titanium dioxide decreases methylation ISO Prkcd (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PRKCD gene CTD PMID:35295148 Prkcd Rat toluene increases expression EXP 6480464 Toluene results in increased expression of PRKCD mRNA CTD PMID:22967744 Prkcd Rat tributylstannane multiple interactions ISO Prkcd (Mus musculus) 6480464 PRKCD gene mutant form inhibits the reaction [tributyltin results in decreased expression of BAD protein more ... CTD PMID:25895139 Prkcd Rat tributylstannane decreases response to substance ISO Prkcd (Mus musculus) 6480464 PRKCD gene mutant form results in decreased susceptibility to tributyltin CTD PMID:25895139 Prkcd Rat trichloroethene decreases expression ISO Prkcd (Mus musculus) 6480464 Trichloroethylene results in decreased expression of PRKCD mRNA CTD PMID:19448997 Prkcd Rat trimethyltin multiple interactions ISO Prkcd (Mus musculus) 6480464 rottlerin inhibits the reaction [trimethyltin results in increased expression of and results in increased cleavage more ... CTD PMID:25895139 Prkcd Rat triphenyl phosphate affects expression ISO PRKCD (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PRKCD mRNA CTD PMID:37042841 Prkcd Rat triptonide decreases expression ISO Prkcd (Mus musculus) 6480464 triptonide results in decreased expression of PRKCD mRNA CTD PMID:33045310 Prkcd Rat tungsten decreases expression ISO Prkcd (Mus musculus) 6480464 Tungsten results in decreased expression of PRKCD mRNA CTD PMID:30912803 Prkcd Rat tyrphostin AG 1478 multiple interactions ISO PRKCD (Homo sapiens) 6480464 RTKI cpd inhibits the reaction [sodium arsenite affects the expression of PRKCD protein]; RTKI cpd more ... CTD PMID:20082316 Prkcd Rat U-73122 multiple interactions ISO PRKCD (Homo sapiens) 6480464 1-(6-((3-methoxyestra-1,3,5(10)-trien-17-yl)amino)hexyl)-1H-pyrrole-2,5-dione inhibits the reaction [3,4-Dichloro-N-methyl-N-(2-(1-pyrrolidinyl)-cyclohexyl)-benzeneacetamide, (trans)-Isomer affects the localization of PRKCD protein] CTD PMID:29669290 Prkcd Rat U50488 multiple interactions ISO PRKCD (Homo sapiens) 6480464 1-(6-((3-methoxyestra-1,3,5(10)-trien-17-yl)amino)hexyl)-1H-pyrrole-2,5-dione inhibits the reaction [3,4-Dichloro-N-methyl-N-(2-(1-pyrrolidinyl)-cyclohexyl)-benzeneacetamide, (trans)-Isomer affects the localization of PRKCD protein] CTD PMID:29669290 Prkcd Rat U50488 affects localization ISO PRKCD (Homo sapiens) 6480464 3,4-Dichloro-N-methyl-N-(2-(1-pyrrolidinyl)-cyclohexyl)-benzeneacetamide, (trans)-Isomer affects the localization of PRKCD protein CTD PMID:29669290 Prkcd Rat urethane increases expression ISO PRKCD (Homo sapiens) 6480464 Urethane results in increased expression of PRKCD mRNA CTD PMID:28818685 Prkcd Rat ursodeoxycholic acid multiple interactions ISO PRKCD (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Ursodeoxycholic Acid results in increased localization of PRKCD protein]; Butylated Hydroxyanisole more ... CTD PMID:21362627 Prkcd Rat ursodeoxycholic acid increases localization ISO PRKCD (Homo sapiens) 6480464 Ursodeoxycholic Acid results in increased localization of PRKCD protein CTD PMID:21362627 Prkcd Rat ursodeoxycholic acid increases response to substance ISO PRKCD (Homo sapiens) 6480464 PRKCD results in increased susceptibility to Ursodeoxycholic Acid CTD PMID:21362627 Prkcd Rat valproic acid affects expression ISO Prkcd (Mus musculus) 6480464 Valproic Acid affects the expression of PRKCD mRNA CTD PMID:17292431 Prkcd Rat valproic acid affects expression ISO PRKCD (Homo sapiens) 6480464 Valproic Acid affects the expression of PRKCD mRNA CTD PMID:25979313 Prkcd Rat valproic acid increases expression ISO Prkcd (Mus musculus) 6480464 Valproic Acid results in increased expression of PRKCD mRNA CTD PMID:21427059 Prkcd Rat vanadium atom increases expression ISO PRKCD (Homo sapiens) 6480464 Vanadium results in increased expression of PRKCD mRNA CTD PMID:19000753 Prkcd Rat vanadium(0) increases expression ISO PRKCD (Homo sapiens) 6480464 Vanadium results in increased expression of PRKCD mRNA CTD PMID:19000753 Prkcd Rat vincaleukoblastine affects localization ISO PRKCD (Homo sapiens) 6480464 Vinblastine affects the localization of PRKCD protein CTD PMID:9852137 Prkcd Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PRKCD mRNA CTD PMID:23034163 Prkcd Rat vincristine affects localization ISO PRKCD (Homo sapiens) 6480464 Vincristine affects the localization of PRKCD protein CTD PMID:9852137 Prkcd Rat wortmannin multiple interactions ISO PRKCD (Homo sapiens) 6480464 wortmannin inhibits the reaction [Curcumin results in increased phosphorylation of PRKCD protein]; wortmannin inhibits the more ... CTD PMID:11424089|PMID:17171638 Prkcd Rat Yessotoxin affects expression ISO PRKCD (Homo sapiens) 6480464 yessotoxin affects the expression of PRKCD protein CTD PMID:26025416 Prkcd Rat Yessotoxin multiple interactions ISO PRKCD (Homo sapiens) 6480464 PDE4A protein affects the reaction [yessotoxin affects the expression of PRKCD protein] CTD PMID:26025416 Prkcd Rat zinc acetate decreases expression ISO PRKCD (Homo sapiens) 6480464 Zinc Acetate results in decreased expression of PRKCD mRNA CTD PMID:16357179
Cellular Component
Only show annotations with direct experimental evidence (0 objects hidden)
Prkcd Rat cell-cell junction located_in ISO Prkcd (Mus musculus) 1624291 PMID:10882525 RGD PMID:10882525 Prkcd Rat cell-cell junction located_in IEA UniProtKB:P28867|ensembl:ENSMUSP00000107829 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat cytoplasm located_in ISO PRKCD (Homo sapiens) 1624291 PMID:15632189, PMID:16611985, PMID:18285462 RGD PMID:15632189|PMID:16611985|PMID:18285462 Prkcd Rat cytoplasm located_in IEA UniProtKB:Q05655|ensembl:ENSP00000331602 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat cytoplasm located_in IEA UniProtKB:P28867|ensembl:ENSMUSP00000107829 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat cytoplasm located_in IEA UniProtKB-KW:KW-0963 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Prkcd Rat cytoplasm located_in IEA UniProtKB-SubCell:SL-0086 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Prkcd Rat cytoplasm located_in ISO Prkcd (Mus musculus) 1624291 PMID:10882525 RGD PMID:10882525 Prkcd Rat cytosol located_in IEA UniProtKB:Q05655|ensembl:ENSP00000331602 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat cytosol located_in TAS 1600115 Reactome:R-RNO-8932373 Reactome Reactome:R-RNO-8932373 Prkcd Rat cytosol located_in ISO PRKCD (Homo sapiens) 1624291 PMID:10770950, PMID:15774464, PMID:17303575 RGD PMID:10770950|PMID:15774464|PMID:17303575 Prkcd Rat cytosol located_in ISO RGD:69026|UniProtKB:Q05655-1 1624291 RGD GO_REF:0000052 Prkcd Rat endolysosome located_in IEA UniProtKB:Q05655|ensembl:ENSP00000331602 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat endolysosome located_in ISO PRKCD (Homo sapiens) 1624291 PMID:17303575 RGD PMID:17303575 Prkcd Rat endolysosome located_in ISS UniProtKB:Q05655 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Prkcd Rat endomembrane system located_in IEA UniProtKB-SubCell:SL-0147 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Prkcd Rat endoplasmic reticulum located_in IEA UniProtKB:Q05655|ensembl:ENSP00000331602 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat endoplasmic reticulum located_in ISO PRKCD (Homo sapiens) 1624291 PMID:15774464, PMID:18556656 RGD PMID:15774464|PMID:18556656 Prkcd Rat endoplasmic reticulum located_in ISS UniProtKB:Q05655 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Prkcd Rat membrane located_in IEA UniProtKB-KW:KW-0472 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Prkcd Rat membrane located_in IEA UniProtKB:P28867|ensembl:ENSMUSP00000107829 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat membrane located_in ISO Prkcd (Mus musculus) 1624291 PMID:18323529 RGD PMID:18323529 Prkcd Rat mitochondrion located_in IEA UniProtKB-SubCell:SL-0173 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Prkcd Rat mitochondrion located_in IEA UniProtKB-KW:KW-0496 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Prkcd Rat nuclear matrix located_in ISO Prkcd (Mus musculus) 1624291 PMID:10882525 RGD PMID:10882525 Prkcd Rat nuclear matrix located_in IEA UniProtKB:P28867|ensembl:ENSMUSP00000107829 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat nucleus located_in IEA UniProtKB-KW:KW-0539 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Prkcd Rat nucleus located_in IEA UniProtKB:P28867|ensembl:ENSMUSP00000107829 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat nucleus located_in ISO Prkcd (Mus musculus) 1624291 PMID:10882525 RGD PMID:10882525 Prkcd Rat nucleus located_in ISO PRKCD (Homo sapiens) 1624291 PMID:15632189, PMID:15774464, PMID:16611985, PMID:18285462 RGD PMID:15632189|PMID:15774464|PMID:16611985|PMID:18285462 Prkcd Rat nucleus located_in IEA UniProtKB-SubCell:SL-0191 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Prkcd Rat nucleus located_in IEA UniProtKB:Q05655|ensembl:ENSP00000331602 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat perinuclear region of cytoplasm located_in IEA UniProtKB-SubCell:SL-0198 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Prkcd Rat plasma membrane located_in ISO PRKCD (Homo sapiens) 1624291 PMID:10770950, PMID:15632189, PMID:17303575 RGD PMID:10770950|PMID:15632189|PMID:17303575 Prkcd Rat plasma membrane located_in IEA UniProtKB-SubCell:SL-0039 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Prkcd Rat plasma membrane located_in IEA UniProtKB-KW:KW-1003 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Prkcd Rat plasma membrane located_in IEA UniProtKB:Q05655|ensembl:ENSP00000331602 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat postsynaptic cytosol is_active_in IDA 13702395 PMID:8263228 SynGO
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Prkcd Rat ATP binding enables IEA UniProtKB-KW:KW-0067 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Prkcd Rat ATP binding enables IEA InterPro:IPR000719|InterPro:IPR000961|InterPro:IPR017441 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Prkcd Rat ATP binding enables IEA InterPro:IPR000719|InterPro:IPR000961|InterPro:IPR017441|InterPro:IPR017892 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Prkcd Rat ATP binding enables IEA UniRule:UR001503341 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Prkcd Rat diacylglycerol-dependent serine/threonine kinase activity enables EXP 729231 PMID:12198130 Reactome Prkcd Rat diacylglycerol-dependent serine/threonine kinase activity enables IEA InterPro:IPR014376 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Prkcd Rat diacylglycerol-dependent serine/threonine kinase activity enables IEA InterPro:IPR014376|InterPro:IPR027436 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Prkcd Rat diacylglycerol-dependent serine/threonine kinase activity enables IEA EC:2.7.11.13 1600115 GO_REF:0000003 UniProt GO_REF:0000003 Prkcd Rat diacylglycerol-dependent serine/threonine kinase activity enables ISO PRKCD (Homo sapiens) 1624291 PMID:12391145, PMID:18285462 RGD PMID:12391145|PMID:18285462 Prkcd Rat diacylglycerol-dependent, calcium-independent serine/threonine kinase activity IDA 1642551 RGD Prkcd Rat diacylglycerol-dependent, calcium-independent serine/threonine kinase activity enables IEA UniProtKB:P28867|ensembl:ENSMUSP00000107829 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat diacylglycerol-dependent, calcium-independent serine/threonine kinase activity enables ISO Prkcd (Mus musculus) 1624291 PMID:22885697 RGD PMID:22885697 Prkcd Rat diacylglycerol-dependent, calcium-independent serine/threonine kinase activity enables ISS UniProtKB:P28867 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Prkcd Rat enzyme activator activity enables ISO PRKCD (Homo sapiens) 1624291 PMID:16611985 RGD PMID:16611985 Prkcd Rat enzyme activator activity enables IEA UniProtKB:Q05655|ensembl:ENSP00000331602 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat enzyme binding enables ISO PRKCD (Homo sapiens) 1624291 UniProtKB:Q02880|UniProtKB:Q9HAW8 PMID:16611985, PMID:18556656 RGD PMID:16611985|PMID:18556656 Prkcd Rat enzyme binding enables IEA UniProtKB:Q05655|ensembl:ENSP00000331602 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat insulin receptor substrate binding enables ISO Prkcd (Mus musculus) 1624291 UniProtKB:P35570 PMID:18285345 RGD PMID:18285345 Prkcd Rat insulin receptor substrate binding enables IEA UniProtKB:P28867|ensembl:ENSMUSP00000107829 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat kinase activity enables IEA UniProtKB-KW:KW-0418 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Prkcd Rat metal ion binding enables IEA UniProtKB-KW:KW-0479 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Prkcd Rat nucleotide binding enables IEA UniRule:UR001503341 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Prkcd Rat nucleotide binding enables IEA UniProtKB-KW:KW-0547 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Prkcd Rat protein binding IPI Th (Rattus norvegicus) 8694085 RGD Prkcd Rat protein binding enables ISO Prkcd (Mus musculus) 1624291 UniProtKB:P23242 PMID:20338032 RGD PMID:20338032 Prkcd Rat protein binding enables ISO PRKCD (Homo sapiens) 1624291 UniProtKB:C0HM02|UniProtKB:C6GKH1|UniProtKB:P04637|UniProtKB:P05067|UniProtKB:P06241|UniProtKB:P11388|UniProtKB:P12931|UniProtKB:P17677|UniProtKB:P19878|UniProtKB:P23396|UniProtKB:P24001-2|UniProtKB:P50552|UniProtKB:Q99638|UniProtKB:Q9BXL7|UniProtKB:Q9H3D4|UniProtKB:Q9H4D1|UniProtKB:Q9NR28|UniProtKB:Q9NRY6|UniProtKB:Q9UBQ0-2 PMID:10383400, PMID:10948194, PMID:12628935, PMID:12649167, PMID:12721299, PMID:15591124, PMID:16377624, PMID:16611985, PMID:16940418, PMID:19059439, PMID:22465666, PMID:22528498, PMID:23814099, more ... RGD PMID:10383400|PMID:10948194|PMID:12628935|PMID:12649167|PMID:12721299|PMID:15591124|PMID:16377624|PMID:16611985|PMID:16940418|PMID:19059439|PMID:22465666|PMID:22528498|PMID:23814099|PMID:24396867|PMID:24996056|PMID:25241761|PMID:26112605|PMID:32814053|PMID:34593629|PMID:9139733 Prkcd Rat protein binding IPI Rbck1 (Rattus norvegicus) 1299423 RGD Prkcd Rat protein binding IPI Srsf2 (Rattus norvegicus) 11038816 RGD Prkcd Rat protein binding IPI RGD:620795|RGD:3285 2292213 RGD Prkcd Rat protein kinase activity enables ISO PRKCD (Homo sapiens) 1624291 PMID:24008408, PMID:34593629 RGD PMID:24008408|PMID:34593629 Prkcd Rat protein kinase activity enables IEA InterPro:IPR000719|InterPro:IPR008271 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Prkcd Rat protein kinase activity enables IEA UniProtKB:Q05655|ensembl:ENSP00000331602 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat protein kinase binding IPI Src (Rattus norvegicus) 2325149 RGD Prkcd Rat protein kinase binding enables ISO PRKCD (Homo sapiens) 1624291 UniProtKB:P00519|UniProtKB:Q9BZL6 PMID:10713049, PMID:28428613 RGD PMID:10713049|PMID:28428613 Prkcd Rat protein kinase binding enables IEA UniProtKB:Q05655|ensembl:ENSP00000331602 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat protein serine kinase activity enables ISS UniProtKB:Q05655 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Prkcd Rat protein serine kinase activity enables IEA RHEA:17989 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Prkcd Rat protein serine kinase activity enables ISO PRKCD (Homo sapiens) 1624291 PMID:17303575 RGD PMID:17303575 Prkcd Rat protein serine kinase activity enables IEA UniProtKB:Q05655|ensembl:ENSP00000331602 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat protein serine/threonine kinase activity enables ISO PRKCD (Homo sapiens) 1624291 PMID:10770950, PMID:18285462, PMID:19059439 RGD PMID:10770950|PMID:18285462|PMID:19059439 Prkcd Rat protein serine/threonine kinase activity enables IEA InterPro:IPR000961 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Prkcd Rat protein serine/threonine kinase activity enables IEA UniProtKB-KW:KW-0723 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Prkcd Rat protein serine/threonine kinase activity enables ISO Prkcd (Mus musculus) 1624291 PMID:22265677 RGD PMID:22265677 Prkcd Rat protein serine/threonine kinase activity enables IEA UniProtKB:P28867|ensembl:ENSMUSP00000107829 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat protein serine/threonine kinase activity enables IBA CGD:CAL0000179865|CGD:CAL0000198853|FB:FBgn0003744|FB:FBgn0010379|FB:FBgn0011739|FB:FBgn0261854|FB:FBgn0287828|MGI:1333883|MGI:1338068|MGI:1345147|MGI:1354386|MGI:97595|MGI:97596|MGI:97597|MGI:97599|MGI:97601|PANTHER:PTN000683254|PomBase:SPAC17G8.14c|PomBase:SPAC22E12.14c|PomBase:SPAC24B11.11c|PomBase:SPAC821.12|PomBase:SPAPB18E9.02c|PomBase:SPCC576.15c|RGD:2081|RGD:3395|RGD:3397|RGD:620146|RGD:620307|RGD:621888|RGD:62390|RGD:67383|SGD:S000000201|SGD:S000001609|SGD:S000001861|SGD:S000002898|SGD:S000005105|SGD:S000005460|SGD:S000006315|TAIR:locus:2090925|TAIR:locus:2184357|UniProtKB:O15530|UniProtKB:P04409|UniProtKB:P05129|UniProtKB:P05771|UniProtKB:P31749|UniProtKB:P41743|UniProtKB:Q02156|UniProtKB:Q05655|UniProtKB:Q09013|UniProtKB:Q15208|UniProtKB:Q16512|UniProtKB:Q5A3P6|UniProtKB:Q96GX5|UniProtKB:Q9NRM7|UniProtKB:Q9Y243|UniProtKB:Q9Y2H1|WB:WBGene00000102|WB:WBGene00000103|WB:WBGene00003965|WB:WBGene00004032|WB:WBGene00004789|WB:WBGene00006599|WB:WBGene00021022 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Prkcd Rat protein serine/threonine kinase activity enables IEA UniProtKB:Q05655|ensembl:ENSP00000331602 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat protein serine/threonine kinase activity enables IEA InterPro:IPR000961|InterPro:IPR017892 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Prkcd Rat protein serine/threonine kinase activity enables IEA ARBA:ARBA00027016 1600115 GO_REF:0000117 UniProt GO_REF:0000117 Prkcd Rat protein serine/threonine kinase binding IPI Akt1 (Rattus norvegicus) 408364951 RGD Prkcd Rat protein tyrosine kinase activator activity enables IEA UniProtKB:Q05655|ensembl:ENSP00000331602 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkcd Rat protein tyrosine kinase activator activity enables ISO PRKCD (Homo sapiens) 1624291 PMID:10713049 RGD PMID:10713049 Prkcd Rat protein tyrosine kinase activity enables IEA RHEA:10596 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Prkcd Rat TIR domain binding enables IPI UniProtKB:P58753 8554532 PMID:17161867 BHF-UCL Prkcd Rat transferase activity enables IEA UniProtKB-KW:KW-0808 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Prkcd Rat zinc ion binding enables IEA UniProtKB-KW:KW-0863 1600115 GO_REF:0000043 UniProt GO_REF:0000043
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-pilocarpine (EXP) (-)-epigallocatechin 3-gallate (ISO) (S)-amphetamine (EXP) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 1-(5-isoquinolinesulfonyl)-2-methylpiperazine (EXP) 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (EXP,ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2-butoxyethanol (ISO) 2-Hydroxy-6-(8,11,14-pentadecatrienyl)benzoic acid (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP,ISO) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO) 3-nitropropanoic acid (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxy-TEMPO (EXP) 5-(2-methylpiperazine-1-sulfonyl)isoquinoline (EXP) 5-aza-2'-deoxycytidine (ISO) 6-formylpterin (ISO) 6-propyl-2-thiouracil (EXP) 8-OH-DPAT (ISO) acetaldehyde (ISO) acetamide (EXP) acetylsalicylic acid (ISO) acrolein (EXP,ISO) acrylamide (EXP) actinomycin D (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (EXP,ISO) all-trans-retinoic acid (ISO) allyl alcohol (EXP) alpha-Zearalanol (ISO) ammonium chloride (EXP) amphetamine (EXP) anthra[1,9-cd]pyrazol-6(2H)-one (ISO) apocynin (EXP,ISO) aripiprazole (ISO) arjunolic acid (EXP) arsenite(3-) (ISO) arsenous acid (EXP,ISO) atrazine (EXP) Azoxymethane (EXP) Bay-K-8644 (ISO) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (ISO) bisdemethoxycurcumin (ISO) bisoprolol (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) Bisphenol Z (ISO) bortezomib (ISO) brimonidine tartrate (EXP) bromocriptine (EXP) butorphanol (ISO) butylated hydroxyanisole (ISO) butyric acid (EXP) cadmium atom (EXP) cadmium dichloride (ISO) caffeine (ISO) Calcimycin (ISO) calcium atom (EXP) calcium(0) (EXP) Calphostin C (EXP) capsaicin (ISO) captan (ISO) carbon nanotube (ISO) carvedilol (EXP) chloroprene (EXP) chlorpyrifos (EXP) chromium(6+) (ISO) ciglitazone (ISO) cisplatin (EXP,ISO) citalopram (EXP,ISO) cobalt dichloride (EXP) cocaine (ISO) copper(II) sulfate (ISO) coumarin (ISO) crocidolite asbestos (ISO) crotonaldehyde (ISO) curcumin (EXP,ISO) cycloheximide (EXP) cyclosporin A (ISO) D-glucose (EXP,ISO) D-mannitol (ISO) daidzein (ISO) daunorubicin (ISO) demethoxycurcumin (ISO) desferrioxamine B (EXP,ISO) dextromethorphan (ISO) diarsenic trioxide (EXP,ISO) diazinon (EXP) dibenziodolium (EXP,ISO) dibutyl phthalate (EXP,ISO) dieldrin (EXP,ISO) diethyl maleate (EXP) dioxygen (ISO) disodium selenite (ISO) divanadium pentaoxide (EXP,ISO) dopamine (ISO) doxorubicin (EXP,ISO) emodin (EXP,ISO) endosulfan (EXP) entinostat (ISO) escitalopram (EXP) ethanol (EXP,ISO) etoposide (ISO) fenamidone (ISO) folic acid (ISO) folpet (ISO) fomepizole (EXP) FR900359 (ISO) furfural (ISO) genistein (ISO) gentamycin (EXP) ginsenoside Re (ISO) glucose (EXP,ISO) glutathione (ISO) heptachlor (EXP) hexadecanoic acid (ISO) histamine (ISO) hydrogen cyanide (ISO) hydrogen peroxide (EXP,ISO) irinotecan (ISO) isoprenaline (EXP) isorhamnetin (ISO) ivermectin (ISO) kainic acid (ISO) lead(0) (EXP) lipopolysaccharide (ISO) lovastatin (EXP) LY294002 (ISO) magnesium atom (ISO) manganese atom (EXP,ISO) manganese(0) (EXP,ISO) manganese(II) chloride (EXP,ISO) methamphetamine (ISO) methotrexate (ISO) methyl beta-cyclodextrin (ISO) mevalonic acid (EXP) microcystin-LR (ISO) mitomycin C (ISO) morphine (ISO) Morroniside (EXP) motexafin gadolinium (ISO) myo-inositol hexakisphosphate (ISO) N-[2-[4-(2-methoxyphenyl)-1-piperazinyl]ethyl]-N-(2-pyridinyl)cyclohexanecarboxamide (ISO) N-acetyl-L-cysteine (EXP,ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-formyl-L-methionyl-L-leucyl-L-phenylalanine (EXP) N-methyl-4-phenylpyridinium (EXP,ISO) naringin (EXP) nickel dichloride (EXP) niclosamide (ISO) nicotine (ISO) nitrates (ISO) nitric oxide (EXP) oroxylin A (ISO) oxidopamine (EXP,ISO) ozone (ISO) paclitaxel (ISO) paracetamol (ISO) paraquat (EXP,ISO) phencyclidine (ISO) phenylephrine (EXP) phorbol 12,13-dibutanoate (ISO) phorbol 13-acetate 12-myristate (EXP,ISO) picrotoxin (EXP) potassium cyanide (ISO) progesterone (EXP,ISO) propofol (EXP) propranolol (EXP) puerarin (ISO) quercetin (ISO) reactive oxygen species (EXP,ISO) resveratrol (ISO) rotenone (EXP) rottlerin (EXP,ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP,ISO) serpentine asbestos (ISO) silicon dioxide (ISO) sirolimus (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) sodium dichromate (ISO) staurosporine (EXP,ISO) streptozocin (EXP) tamibarotene (ISO) tamoxifen (ISO) taurine (EXP) testosterone (ISO) tetraphene (ISO) thalidomide (ISO) thapsigargin (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) toluene (EXP) tributylstannane (ISO) trichloroethene (ISO) trimethyltin (ISO) triphenyl phosphate (ISO) triptonide (ISO) tungsten (ISO) tyrphostin AG 1478 (ISO) U-73122 (ISO) U50488 (ISO) urethane (ISO) ursodeoxycholic acid (ISO) valproic acid (ISO) vanadium atom (ISO) vanadium(0) (ISO) vincaleukoblastine (ISO) vinclozolin (EXP) vincristine (ISO) wortmannin (ISO) Yessotoxin (ISO) zinc acetate (ISO)
Biological Process
apoptotic process (IEA,IMP,ISO,ISS) B cell proliferation (IEA,ISO) cell chemotaxis (IEA,ISO) cellular response to angiotensin (IEA,ISO,ISS) cellular response to glucose starvation (IEP) cellular response to hydrogen peroxide (IEA,ISO) cellular response to hydroperoxide (IEA,ISO) cellular response to insulin stimulus (IEP) cellular response to oxidative stress (IDA) cellular response to UV (IEA,ISO,ISS) cellular senescence (IEA,ISO) collagen metabolic process (IMP) D-aspartate import across plasma membrane (IMP) defense response to bacterium (IEA,ISO,ISS) DNA damage response (IEA,ISO) immunoglobulin mediated immune response (IEA,ISO) intracellular signal transduction (IBA,IDA,IEA) negative regulation of actin filament polymerization (IEA,ISO,ISS) negative regulation of filopodium assembly (IEA,ISO,ISS) negative regulation of glial cell apoptotic process (IEA,ISO,ISS) negative regulation of inflammatory response (IEA,ISO) negative regulation of insulin receptor signaling pathway (IEA,ISO) negative regulation of MAPK cascade (IEA,ISO) negative regulation of platelet aggregation (IEA,ISO,ISS) neutrophil activation (IEA,ISO) peptidyl-serine phosphorylation (ISO,ISS) peptidyl-threonine phosphorylation (ISO) phospholipase C/protein kinase C signal transduction (IEA,ISO) positive regulation of apoptotic process (IMP) positive regulation of apoptotic signaling pathway (IEA,ISO) positive regulation of ceramide biosynthetic process (IEA,ISO) positive regulation of D-glucose import (IMP) positive regulation of endodeoxyribonuclease activity (ISO) positive regulation of glucosylceramide catabolic process (IEA,ISO) positive regulation of MAP kinase activity (IMP) positive regulation of MAPK cascade (IMP) positive regulation of phospholipid scramblase activity (ISO) positive regulation of protein import into nucleus (IEA,ISO) positive regulation of sphingomyelin catabolic process (IEA,ISO) positive regulation of superoxide anion generation (IEA,ISO,ISS) post-translational protein modification (IEA,ISO) protein autophosphorylation (IDA) protein kinase C signaling (IEA) protein phosphorylation (IDA,ISO) regulation of actin cytoskeleton organization (IEA,ISO) regulation of ceramide biosynthetic process (IEA,ISO,ISS) regulation of phosphorylation (IDA) response to amino acid (IEP) response to ethanol (IEP) response to glucose (IEA,IEP) response to hydrogen peroxide (IEP) response to hypoxia (IEP) response to mechanical stimulus (IEP) response to oxidative stress (IMP) response to phorbol 13-acetate 12-myristate (IEP) response to xenobiotic stimulus (IEP) termination of signal transduction (IEA,ISO)
Cellular Component
cell-cell junction (IEA,ISO) cytoplasm (IEA,ISO) cytosol (IEA,ISO,TAS) endolysosome (IEA,ISO,ISS) endomembrane system (IEA) endoplasmic reticulum (IEA,ISO,ISS) membrane (IEA,ISO) mitochondrion (IEA) nuclear matrix (IEA,ISO) nucleus (IEA,ISO) perinuclear region of cytoplasm (IEA) plasma membrane (IEA,ISO) postsynaptic cytosol (IDA)
Molecular Function
ATP binding (IEA) diacylglycerol-dependent serine/threonine kinase activity (EXP,IEA,ISO) diacylglycerol-dependent, calcium-independent serine/threonine kinase activity (IDA,IEA,ISO,ISS) enzyme activator activity (IEA,ISO) enzyme binding (IEA,ISO) insulin receptor substrate binding (IEA,ISO) kinase activity (IEA) metal ion binding (IEA) nucleotide binding (IEA) protein binding (IPI,ISO) protein kinase activity (IEA,ISO) protein kinase binding (IEA,IPI,ISO) protein serine kinase activity (IEA,ISO,ISS) protein serine/threonine kinase activity (IBA,IEA,ISO) protein serine/threonine kinase binding (IPI) protein tyrosine kinase activator activity (IEA,ISO) protein tyrosine kinase activity (IEA) TIR domain binding (IPI) transferase activity (IEA) zinc ion binding (IEA)
1.
Protein kinase C translocation and PKC-dependent protein phosphorylation during myocardial ischemia.
Albert CJ and Ford DA, Am J Physiol. 1999 Feb;276(2 Pt 2):H642-50.
2.
Selective cyclooxygenase-2 inhibitors stimulate glucose transport in L6 myotubes in a protein kinase Cdelta-dependent manner.
Alpert E, etal., Biochem Pharmacol. 2007 Feb 1;73(3):368-77. Epub 2006 Oct 13.
3.
Microarray analysis of oxidative stress regulated genes in mesencephalic dopaminergic neuronal cells: relevance to oxidative damage in Parkinson's disease.
Anantharam V, etal., Neurochem Int. 2007 May;50(6):834-47. Epub 2007 Feb 23.
4.
Protein kinase D1 (PKD1) activation mediates a compensatory protective response during early stages of oxidative stress-induced neuronal degeneration.
Asaithambi A, etal., Mol Neurodegener. 2011 Jun 22;6:43. doi: 10.1186/1750-1326-6-43.
5.
Chronic activation of protein kinase C in soleus muscles and other tissues of insulin-resistant type II diabetic Goto-Kakizaki (GK), obese/aged, and obese/Zucker rats. A mechanism for inhibiting glycogen synthesis.
Avignon A, etal., Diabetes. 1996 Oct;45(10):1396-404.
6.
Effects of long-term elevated glucose on collagen formation by mesangial cells.
Baccora MH, etal., Kidney Int. 2007 Aug 29;.
7.
Regulation of protein kinase C isozymes in volume overload cardiac hypertrophy.
Braun MU, etal., Mol Cell Biochem. 2004 Jul;262(1-2):135-43.
8.
DeltaPKC mediates microcerebrovascular dysfunction in acute ischemia and in chronic hypertensive stress in vivo.
Bright R, etal., Brain Res. 2007 May 4;1144:146-55. Epub 2007 Feb 2.
9.
Protein kinase C-mediated modulation of glutamate transporter activity in rat retina.
Bull ND, etal., Curr Eye Res. 2007 Feb;32(2):123-31.
10.
Altered PKC expression and phosphorylation in response to the nature, direction, and magnitude of mechanical stretch.
Bullard TA, etal., Can J Physiol Pharmacol. 2007 Feb;85(2):243-50.
11.
A systems biology approach to the pathogenesis of obesity-related nonalcoholic fatty liver disease using reverse phase protein microarrays for multiplexed cell signaling analysis.
Calvert VS, etal., Hepatology. 2007 Jul;46(1):166-72.
12.
Mechanism of enhanced calcium sensitivity and alpha 2-AR vasoreactivity in chronic NOS inhibition hypertension.
Carter RW and Kanagy NL, Am J Physiol Heart Circ Physiol. 2003 Jan;284(1):H309-16. Epub 2002 Sep 19.
13.
Effect of hypoxia and aging on PKC delta-mediated SC-35 phosphorylation in rat myocardial tissue.
Cataldi A, etal., Anat Rec (Hoboken). 2009 Aug;292(8):1135-42. doi: 10.1002/ar.20936.
14.
Protein kinase Cdelta-dependent and -independent signaling in genotoxic response to treatment of desferroxamine, a hypoxia-mimetic agent.
Clavijo C, etal., Am J Physiol Cell Physiol. 2007 Jun;292(6):C2150-60.
15.
Skin immunosenescence: decreased receptor for activated C kinase-1 expression correlates with defective tumour necrosis factor-alpha production in epidermal cells.
Corsini E, etal., Br J Dermatol. 2009 Jan;160(1):16-25. Epub 2008 Oct 11.
16.
Nuclear import of PKCdelta is required for apoptosis: identification of a novel nuclear import sequence.
DeVries TA, etal., EMBO J 2002 Nov 15;21(22):6050-60.
17.
Protein kinase C delta activation and translocation to the nucleus are required for fatty acid-induced apoptosis of insulin-secreting cells.
Eitel K, etal., Diabetes. 2003 Apr;52(4):991-7.
18.
Altered cardiac endothelin receptors and protein kinase C in deoxycorticosterone-salt hypertensive rats.
Fareh J, etal., J Mol Cell Cardiol. 2000 Apr;32(4):665-76.
19.
Requirement of Ca(2+) and PKCdelta for Janus kinase 2 activation by angiotensin II: involvement of PYK2.
Frank GD, etal., Mol Endocrinol 2002 Feb;16(2):367-77.
20.
N-Acetylcysteine and alpha-cyano-4-hydroxycinnamic acid alter protein kinase C (PKC)-delta and PKC-zeta and diminish dysmorphogenesis in rat embryos cultured with high glucose in vitro.
Gareskog M and Wentzel P, J Endocrinol. 2007 Jan;192(1):207-14.
21.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
22.
Changes in protein kinase C in early cardiomyopathy and in gracilis muscle in the BB/Wor diabetic rat.
Giles TD, etal., Am J Physiol. 1998 Jan;274(1 Pt 2):H295-307.
23.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
24.
The hexosamine pathway regulates the plasminogen activator inhibitor-1 gene promoter and Sp1 transcriptional activation through protein kinase C-beta I and -delta.
Goldberg HJ, etal., J Biol Chem 2002 Sep 13;277(37):33833-41.
25.
Activation of protein kinase c-delta and c-epsilon by oxidative stress in early diabetic rat kidney.
Ha H, etal., Am J Kidney Dis. 2001 Oct;38(4 Suppl 1):S204-7.
26.
Activation of the nuclear transcription factor SP-1 by insulin rapidly increases the expression of protein kinase C delta in skeletal muscle.
Horovitz-Fried M, etal., Cell Signal. 2007 Mar;19(3):556-62. Epub 2006 Aug 23.
27.
BK-induced COX-2 expression via PKC-delta-dependent activation of p42/p44 MAPK and NF-kappaB in astrocytes.
Hsieh HL, etal., Cell Signal. 2007 Feb;19(2):330-40. Epub 2006 Jul 25.
28.
Phosphorylation of Nrf2 at Ser-40 by protein kinase C regulates antioxidant response element-mediated transcription.
Huang HC, etal., J Biol Chem 2002 Nov 8;277(45):42769-74.
29.
Estrogen deficiency decreases ischemic tolerance in the aged rat heart: Roles of PKCdelta, PKCepsilon, Akt, and GSK3beta.
Hunter JC, etal., Am J Physiol Regul Integr Comp Physiol. 2007 Feb;292(2):R800-9. Epub 2006 Sep 28.
30.
Protein kinase C isozymes in hypertension and hypertrophy: insight from SHHF rat hearts.
Johnsen DD, etal., Mol Cell Biochem. 2005 Feb;270(1-2):63-9.
31.
Protective role of intracellular zinc in myocardial ischemia/reperfusion is associated with preservation of protein kinase C isoforms.
Karagulova G, etal., J Pharmacol Exp Ther. 2007 May;321(2):517-25. Epub 2007 Feb 22.
32.
Role of oxidative stress in PKC-delta upregulation and cardioprotection induced by chronic intermittent hypoxia.
Kolar F, etal., Am J Physiol Heart Circ Physiol. 2007 Jan;292(1):H224-30. Epub 2006 Aug 25.
33.
Activation of RAC-protein kinase by heat shock and hyperosmolarity stress through a pathway independent of phosphatidylinositol 3-kinase.
Konishi H, etal., Proc Natl Acad Sci U S A. 1996 Jul 23;93(15):7639-43. doi: 10.1073/pnas.93.15.7639.
34.
Protein kinase Cdelta binds TIRAP/Mal to participate in TLR signaling.
Kubo-Murai M, etal., Mol Immunol. 2007 Mar;44(9):2257-64. Epub 2006 Dec 11.
35.
Activation and translocation of PKCdelta is necessary for VEGF-induced ERK activation through KDR in HEK293T cells.
Kuriyama M, etal., Biochem Biophys Res Commun. 2004 Dec 17;325(3):843-51.
36.
Free fatty acid-induced hepatic insulin resistance: a potential role for protein kinase C-delta.
Lam TK, etal., Am J Physiol Endocrinol Metab 2002 Oct;283(4):E682-91.
37.
Selective changes in protein kinase C isoforms and phosphorylation of endogenous substrate proteins in rat cerebral cortex during pre- and postnatal ethanol exposure.
Mahadev K and Vemuri MC, Arch Biochem Biophys. 1998 Aug 15;356(2):249-57.
38.
Light and electron microscopic immunocytochemical localization of PKC delta immunoreactivity in the rat central nervous system.
Merchenthaler I, etal., J Comp Neurol. 1993 Oct 15;336(3):378-99. doi: 10.1002/cne.903360306.
39.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
40.
Role of protein kinase C in the signal pathways that link Na+/K+-ATPase to ERK1/2.
Mohammadi K, etal., J Biol Chem 2001 Nov 9;276(45):42050-6.
41.
Obesity is associated with impaired ventricular protein kinase C-MAP kinase signaling and altered ANP mRNA expression in the heart of adult Zucker rats.
Morabito D, etal., J Investig Med. 2001 Jul;49(4):310-8.
42.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
43.
Protein kinase C: poised to signal.
Newton AC Am J Physiol Endocrinol Metab. 2010 Mar;298(3):E395-402. Epub 2009 Nov 24.
44.
Expression and characterization of protein kinase C-delta.
Olivier AR and Parker PJ, Eur J Biochem. 1991 Sep 15;200(3):805-10.
45.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
46.
The structure, expression, and properties of additional members of the protein kinase C family.
Ono Y, etal., J Biol Chem 1988 May 15;263(14):6927-32.
47.
Vitamin C prevents zidovudine-induced NAD(P)H oxidase activation and hypertension in the rat.
Papparella I, etal., Cardiovasc Res. 2007 Jan 15;73(2):432-8. Epub 2006 Oct 20.
48.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
49.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
50.
An integrated rat genetic map: analysis of linkage conservation with the mouse and human maps.
Remmers EF, etal., Transplant Proc 1999 May;31(3):1549-54.
51.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
52.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
53.
Src tyrosine kinase regulates insulin-induced activation of protein kinase C (PKC) delta in skeletal muscle.
Rosenzweig T, etal., Cell Signal. 2004 Nov;16(11):1299-308.
54.
Ligand-independent trans-activation of the platelet-derived growth factor receptor by reactive oxygen species requires protein kinase C-delta and c-Src.
Saito S, etal., J Biol Chem. 2002 Nov 22;277(47):44695-700. Epub 2002 Sep 10.
55.
Protein kinase C-delta modulates apoptosis induced by hyperglycemia in adult ventricular myocytes.
Shizukuda Y, etal., Am J Physiol Heart Circ Physiol 2002 May;282(5):H1625-34.
56.
Dual mechanism of autoregulation of protein kinase C in myocardial ischemia.
Simonis G, etal., Mol Cell Biochem. 2007 Jan;295(1-2):121-8. Epub 2006 Aug 22.
57.
Effect of hyperglycemia on signal transduction in skeletal muscle from diabetic Goto-Kakizaki rats.
Steiler TL, etal., Endocrinology. 2003 Dec;144(12):5259-67. Epub 2003 Aug 21.
58.
Requirements of protein kinase cdelta for catalytic function. Role of glutamic acid 500 and autophosphorylation on serine 643.
Stempka L, etal., J Biol Chem. 1999 Mar 26;274(13):8886-92.
59.
PKC-delta-dependent activation of oxidative stress in adipocytes of obese and insulin-resistant mice: role for NADPH oxidase.
Talior I, etal., Am J Physiol Endocrinol Metab. 2005 Feb;288(2):E405-11. Epub 2004 Oct 26.
60.
Effects of burn injury on myocardial signaling and cytokine secretion: Possible role of PKC.
Tan J, etal., Am J Physiol Regul Integr Comp Physiol. 2007 Feb;292(2):R887-96. Epub 2006 Sep 21.
61.
Thrombin rapidly induces protein kinase D phosphorylation, and protein kinase C delta mediates the activation.
Tan M, etal., J Biol Chem 2003 Jan 31;278(5):2824-8.
62.
Cholecystokinin-stimulated tyrosine phosphorylation of PKC-delta in pancreatic acinar cells is regulated bidirectionally by PKC activation.
Tapia JA, etal., Biochim Biophys Acta 2002 Dec 16;1593(1):99-113.
63.
Molecular cloning and characterization of a novel protein kinase C-interacting protein with structural motifs related to RBCC family proteins.
Tokunaga C, etal., Biochem Biophys Res Commun 1998 Mar 17;244(2):353-9.
64.
Fatty acid and phorbol ester-mediated interference of mitogenic signaling via novel protein kinase C isoforms in pancreatic beta-cells (INS-1).
Wrede CE, etal., J Mol Endocrinol. 2003 Jun;30(3):271-86.
65.
Difference in gene expression of macrophage between normal spleen and portal hypertensive spleen identified by cDNA microarray.
Yan F and Wang XM, World J Gastroenterol. 2007 Jun 28;13(24):3369-73.
66.
Protein kinase C delta negatively regulates tyrosine hydroxylase activity and dopamine synthesis by enhancing protein phosphatase-2A activity in dopaminergic neurons.
Zhang D, etal., J Neurosci. 2007 May 16;27(20):5349-62.
67.
Ethanol induces apoptosis in hepatocytes by a pathway involving novel protein kinase C isoforms.
Zhang Y, etal., Cell Signal. 2007 Nov;19(11):2339-50. Epub 2007 Jul 27.
Prkcd Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 5,775,681 - 5,806,122 (-) NCBI GRCr8 GRCr8 Ensembl 16 5,775,681 - 5,805,839 (-) Ensembl GRCr8 Ensembl mRatBN7.2 16 5,769,217 - 5,799,380 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 5,769,215 - 5,799,352 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 5,781,205 - 5,811,322 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 6,926,659 - 6,956,775 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 5,779,783 - 5,809,932 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 6,655,131 - 6,675,746 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 6,655,120 - 6,675,746 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 6,588,990 - 6,608,725 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 5,954,218 - 5,975,743 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 16 9,398,816 - 9,419,806 (+) NCBI Celera RGSC_v3.1 16 5,954,214 - 5,975,741 (-) NCBI Cytogenetic Map 16 p16 NCBI
PRKCD Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 53,161,209 - 53,192,717 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 53,156,009 - 53,192,717 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 53,195,225 - 53,226,733 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 53,170,263 - 53,201,773 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 53,170,262 - 53,201,771 NCBI Celera 3 53,162,239 - 53,193,756 (+) NCBI Celera Cytogenetic Map 3 p21.1 NCBI HuRef 3 53,210,511 - 53,276,026 (+) NCBI HuRef CHM1_1 3 53,146,796 - 53,178,291 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 53,194,119 - 53,225,596 (+) NCBI T2T-CHM13v2.0
Prkcd Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 30,317,310 - 30,348,637 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 30,317,311 - 30,348,167 (-) Ensembl GRCm39 Ensembl GRCm38 14 30,595,353 - 30,626,414 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 30,595,354 - 30,626,210 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 31,408,555 - 31,423,498 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 29,424,378 - 29,447,560 (-) NCBI MGSCv36 mm8 Celera 14 26,853,019 - 26,867,962 (-) NCBI Celera Cytogenetic Map 14 B NCBI cM Map 14 18.82 NCBI
Prkcd Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955430 3,124,738 - 3,153,274 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955430 3,125,066 - 3,151,857 (+) NCBI ChiLan1.0 ChiLan1.0
PRKCD Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 53,157,598 - 53,189,084 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 53,162,376 - 53,193,855 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 53,104,137 - 53,135,588 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 54,330,328 - 54,357,910 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 54,330,328 - 54,357,910 (+) Ensembl panpan1.1 panPan2
PRKCD Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 36,723,491 - 36,751,982 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 36,723,809 - 36,752,191 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 36,660,459 - 36,673,894 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 37,001,697 - 37,030,998 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 37,001,704 - 37,031,073 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 36,438,983 - 36,452,419 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 36,800,686 - 36,814,133 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 37,015,742 - 37,029,186 (-) NCBI UU_Cfam_GSD_1.0
Prkcd Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 170,754,028 - 170,788,044 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936473 3,892,366 - 3,923,515 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936473 3,892,625 - 3,923,467 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRKCD Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 35,290,610 - 35,323,356 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 35,290,835 - 35,323,245 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 38,361,707 - 38,390,508 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRKCD Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 14,561,401 - 14,592,877 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 14,565,282 - 14,592,873 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 152,302,998 - 152,334,406 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prkcd
.
Predicted Target Of
Count of predictions: 459 Count of miRNA genes: 255 Interacting mature miRNAs: 306 Transcripts: ENSRNOT00000025858, ENSRNOT00000067639 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631561 Hcuc2 Hepatic copper content QTL 2 2.8 liver copper amount (VT:0003065) liver total copper weight (CMO:0001507) 16 1 39533949 Rat 1582235 Insul8 Insulin level QTL 8 3.3 0.0063 blood insulin amount (VT:0001560) calculated serum insulin level (CMO:0000359) 16 1 26727669 Rat 2307172 Activ4 Activity QTL 4 3.71 0.00023 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 1 33418960 Rat 1354584 Despr6 Despair related QTL 6 3.1 0.0067 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 39533930 Rat 1357403 Slep4 Serum leptin concentration QTL 4 3.91 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 1 9639137 Rat 2302380 Slep6 Serum leptin concentration QTL 6 3.36 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 1 32139025 Rat 737819 Hcas4 Hepatocarcinoma susceptibility QTL 4 4.43 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 16 4227609 46975965 Rat 9590151 Scort8 Serum corticosterone level QTL 8 8.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 16 1 30836262 Rat 1354625 Despr7 Despair related QTL 7 3.16 0.016 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 44977551 Rat 61338 Bp23 Blood pressure QTL 23 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 4227609 49227609 Rat 61405 Niddm6 Non-insulin dependent diabetes mellitus QTL 6 3.66 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 16 4227609 48972724 Rat 631830 Alc7 Alcohol consumption QTL 7 2.9 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 1 26727669 Rat 7411664 Foco30 Food consumption QTL 30 11 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 1 44588133 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70183 BpQTLcluster13 Blood pressure QTL cluster 13 3.654 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 16 4227609 43025077 Rat 1600369 Hcas8 Hepatocarcinoma susceptibility QTL 8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 16 1 22477621 Rat 737826 Alc11 Alcohol consumption QTL 11 3.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 60252231 Rat 737825 Alc13 Alcohol consumption QTL 13 4.5 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 16039848 Rat 2303566 Bw90 Body weight QTL 90 2 body mass (VT:0001259) body weight (CMO:0000012) 16 1 39533930 Rat 2312663 Slep9 Serum leptin concentration QTL 9 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 832236 59492508 Rat 2306902 Bp339 Blood pressure QTL 339 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 3380150 43025077 Rat 1300133 Rf24 Renal function QTL 24 3.64 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 16 3380150 21361552 Rat 2312660 Bw95 Body weight QTL 95 0.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 16 832236 59492508 Rat 2312666 Insul16 Insulin level QTL 16 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 16 832236 59492508 Rat 634355 Rends4 Renal damage susceptibility QTL 4 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 16 1 26727669 Rat 61372 Bp40 Blood pressure QTL 40 2.2 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 16 4227730 17696785 Rat 2293343 Glom16 Glomerulus QTL 16 7.4 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 16 832236 46053497 Rat 2301406 Kidm39 Kidney mass QTL 39 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 16 2851709 15884239 Rat 6903319 Bw114 Body weight QTL 114 2.7 0.0037 body mass (VT:0001259) body weight (CMO:0000012) 16 1 43534949 Rat 2312669 Stl23 Serum triglyceride level QTL 23 0.01 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 16 832236 59492508 Rat
D16Mgh7
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 5,769,407 - 5,769,550 (+) MAPPER mRatBN7.2 Rnor_6.0 16 6,655,313 - 6,655,455 NCBI Rnor6.0 Rnor_5.0 16 6,589,172 - 6,589,314 UniSTS Rnor5.0 RGSC_v3.4 16 5,954,398 - 5,954,541 RGD RGSC3.4 RGSC_v3.4 16 5,954,399 - 5,954,541 UniSTS RGSC3.4 Celera 16 9,419,482 - 9,419,624 UniSTS RGSC_v3.1 16 5,954,396 - 5,954,539 RGD Cytogenetic Map 16 p16 UniSTS
D16Arb4
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 5,769,278 - 5,769,666 (+) MAPPER mRatBN7.2 Rnor_6.0 16 6,655,184 - 6,655,571 NCBI Rnor6.0 Rnor_5.0 16 6,589,043 - 6,589,430 UniSTS Rnor5.0 RGSC_v3.4 16 5,954,270 - 5,954,657 UniSTS RGSC3.4 Celera 16 9,419,366 - 9,419,753 UniSTS RGSC_v3.1 16 5,954,266 - 5,954,655 RGD SHRSP x BN Map 16 1.1599 UniSTS SHRSP x BN Map 16 1.1599 RGD FHH x ACI Map 16 5.3399 RGD Cytogenetic Map 16 p16 UniSTS
AI044238
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 5,769,531 - 5,769,780 (+) MAPPER mRatBN7.2 Rnor_6.0 16 6,655,437 - 6,655,685 NCBI Rnor6.0 Rnor_5.0 16 6,589,296 - 6,589,544 UniSTS Rnor5.0 RGSC_v3.4 16 5,954,523 - 5,954,771 UniSTS RGSC3.4 Celera 16 9,419,252 - 9,419,500 UniSTS RH 3.4 Map 16 31.5 UniSTS Cytogenetic Map 16 p16 UniSTS
UniSTS:224276
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 5,769,421 - 5,769,611 (+) MAPPER mRatBN7.2 Rnor_6.0 16 6,655,327 - 6,655,516 NCBI Rnor6.0 Rnor_5.0 16 6,589,186 - 6,589,375 UniSTS Rnor5.0 RGSC_v3.4 16 5,954,413 - 5,954,602 UniSTS RGSC3.4 Celera 16 9,419,421 - 9,419,610 UniSTS Cytogenetic Map 16 p16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000025858 ⟹ ENSRNOP00000025858
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 Ensembl 16 5,775,681 - 5,805,839 (-) Ensembl mRatBN7.2 Ensembl 16 5,769,215 - 5,799,352 (-) Ensembl Rnor_6.0 Ensembl 16 6,655,120 - 6,675,746 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000067639 ⟹ ENSRNOP00000061108
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 Ensembl 16 5,779,084 - 5,805,839 (-) Ensembl mRatBN7.2 Ensembl 16 5,772,620 - 5,799,352 (-) Ensembl Rnor_6.0 Ensembl 16 6,655,662 - 6,669,045 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112103 ⟹ ENSRNOP00000083061
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 5,769,215 - 5,789,049 (-) Ensembl
RefSeq Acc Id:
NM_133307 ⟹ NP_579841
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 5,775,681 - 5,805,839 (-) NCBI mRatBN7.2 16 5,769,217 - 5,799,380 (-) NCBI Rnor_6.0 16 6,655,131 - 6,675,746 (-) NCBI Rnor_5.0 16 6,588,990 - 6,608,725 (-) NCBI RGSC_v3.4 16 5,954,218 - 5,975,743 (-) RGD Celera 16 9,398,816 - 9,419,806 (+) NCBI
Sequence:
GAATTCCGGGGCGGCGGCCGCGGGGATCCCGCGAGCGGCCCCTGAACATCTACCCTTCTTGCCGGGACCCGGGAGGTCCCCACTGGCCTCCGGGCCCGTCCTGATCAGACTCGTGTCGACCTCCCCGT
hide sequence
RefSeq Acc Id:
XM_063275048 ⟹ XP_063131118
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 5,775,686 - 5,806,122 (-) NCBI
RefSeq Acc Id:
XM_063275049 ⟹ XP_063131119
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 5,775,686 - 5,805,853 (-) NCBI
RefSeq Acc Id:
XM_063275050 ⟹ XP_063131120
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 5,775,686 - 5,805,853 (-) NCBI
RefSeq Acc Id:
XM_063275051 ⟹ XP_063131121
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 5,775,686 - 5,790,451 (-) NCBI
RefSeq Acc Id:
NP_579841 ⟸ NM_133307
- UniProtKB:
Q9JL03 (UniProtKB/Swiss-Prot), Q9JK29 (UniProtKB/Swiss-Prot), Q6DG48 (UniProtKB/Swiss-Prot), P09215 (UniProtKB/Swiss-Prot), A0A140UHX0 (UniProtKB/TrEMBL), A6KG32 (UniProtKB/TrEMBL)
- Sequence:
MAPFLRISFNSYELGSLQAEDDASQPFCAVKMKEALTTDRGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQIVLMRAAEDPMSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMCVQYFLEDGDCK
hide sequence
Ensembl Acc Id:
ENSRNOP00000061108 ⟸ ENSRNOT00000067639
Ensembl Acc Id:
ENSRNOP00000025858 ⟸ ENSRNOT00000025858
Ensembl Acc Id:
ENSRNOP00000083061 ⟸ ENSRNOT00000112103
RefSeq Acc Id:
XP_063131118 ⟸ XM_063275048
- Peptide Label:
isoform X1
- UniProtKB:
Q9JL03 (UniProtKB/Swiss-Prot), Q9JK29 (UniProtKB/Swiss-Prot), Q6DG48 (UniProtKB/Swiss-Prot), P09215 (UniProtKB/Swiss-Prot), A0A140UHX0 (UniProtKB/TrEMBL), A6KG32 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131120 ⟸ XM_063275050
- Peptide Label:
isoform X1
- UniProtKB:
Q9JL03 (UniProtKB/Swiss-Prot), Q9JK29 (UniProtKB/Swiss-Prot), Q6DG48 (UniProtKB/Swiss-Prot), P09215 (UniProtKB/Swiss-Prot), A0A140UHX0 (UniProtKB/TrEMBL), A6KG32 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131119 ⟸ XM_063275049
- Peptide Label:
isoform X1
- UniProtKB:
Q9JL03 (UniProtKB/Swiss-Prot), Q9JK29 (UniProtKB/Swiss-Prot), Q6DG48 (UniProtKB/Swiss-Prot), P09215 (UniProtKB/Swiss-Prot), A0A140UHX0 (UniProtKB/TrEMBL), A6KG32 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131121 ⟸ XM_063275051
- Peptide Label:
isoform X1
- UniProtKB:
Q9JL03 (UniProtKB/Swiss-Prot), Q9JK29 (UniProtKB/Swiss-Prot), Q6DG48 (UniProtKB/Swiss-Prot), P09215 (UniProtKB/Swiss-Prot), A0A140UHX0 (UniProtKB/TrEMBL), A6KG32 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Prkcd
protein kinase C, delta
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_cellular_localization
translocates from cytosol into the nucleus upon treatment with etoposide; Intralipid + heparin (IH) induces translocation from the cytosolic to membrane fraction
729633
gene_cellular_localization
translocates from cytosol into the nucleus upon treatment with etoposide; Intralipid + heparin (IH) induces translocation from the cytosolic to membrane fraction
729667
gene_expression
expressed in pancreatic acini
631304
gene_function
binds phorbol esters
61695
gene_function
binds phorbol esters
628336
gene_pathway
activation by the digitalis drug ouabain is linked to Na+/K+-ATPase through Src/EGFR, and is required for the activation of ERK1/2
631304
gene_process
involved in proheparin-binding EGF-like growth factor (HBEGF) ectodomain shedding upon TPA stimulation
61695
gene_process
involved in proheparin-binding EGF-like growth factor (HBEGF) ectodomain shedding upon TPA stimulation
628336
gene_regulation
maximal activation requires phosphatidylserine and diacylglycerol
61695
gene_regulation
maximal activation requires phosphatidylserine and diacylglycerol
628336
gene_regulation
tyrosine phosphorylation results in increased instability leading to degradation
631304
gene_regulation
administration of the digitalis drug ouabain with intact cardiac myocytes causes rapid translocation/activation from the soluble to the particulate pools of enzymes
631304
gene_regulation
protein is tyrosine phosphorylated by activated Cholecystokinin A receptor (Cckar) in pancreatic acinar cells
631304
