Symbol:
Actb (Ensembl: Actbl2)
Name:
actin, beta (Ensembl:actin, beta-like 2)
RGD ID:
628837
Description:
Enables protein kinase binding activity. Involved in several processes, including cellular response to electrical stimulus; regulation of norepinephrine uptake; and response to immobilization stress. Located in actin cytoskeleton; axon; and membrane raft. Part of protein-containing complex. Used to study metabolic dysfunction-associated steatotic liver disease. Biomarker of temporal lobe epilepsy. Human ortholog(s) of this gene implicated in Baraitser-Winter syndrome 1 and thrombocytopenia. Orthologous to human ACTB (actin beta); PARTICIPATES IN auditory mechanotransduction pathway; INO80 family mediated chromatin remodeling pathway; mitochondria transport pathway; INTERACTS WITH (+)-catechin; (+)-epicatechin-3-O-gallate; (3,4-dihydroxyphenyl)acetic acid.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
actin, cytoplasmic 1; Actx; beta-actin; cytoplasmic beta-actin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ACTB (actin beta) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Mus musculus (house mouse):
Actb (actin, beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Actb (actin beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ACTB (actin beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ACTB (actin beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Actb (actin beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ACTB (actin beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ACTB (actin beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Actb (actin beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ACTG1 (actin gamma 1) HGNC
OrthoDB, Panther
Homo sapiens (human):
ACTBL2 (actin beta like 2) HGNC
OrthoDB
Homo sapiens (human):
RASA4 (RAS p21 protein activator 4) HGNC
OMA
Homo sapiens (human):
RASA4B (RAS p21 protein activator 4B) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
ACTB (actin beta)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Actb (actin, beta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
actb1 (actin, beta 1)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
actb2 (actin, beta 2)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ACT1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
act-4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Act42A
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
Act57B
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
Act5C
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Act79B
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
Act87E
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
Act88F
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
act-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
act-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
act-3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
actb
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 16,776,664 - 16,779,634 (+) NCBI GRCr8 mRatBN7.2 12 11,663,112 - 11,666,697 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 11,663,109 - 11,672,877 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 12,473,135 - 12,476,105 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 13,096,401 - 13,099,371 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 12,127,796 - 12,130,766 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 13,715,843 - 13,718,813 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 13,715,843 - 13,718,841 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 15,745,856 - 15,749,440 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 12,047,070 - 12,050,040 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 12,076,997 - 12,079,967 (+) NCBI Celera 12 13,452,443 - 13,455,413 (+) NCBI Celera Cytogenetic Map 12 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Actb Rat (+)-catechin multiple interactions EXP 6480464 Catechin inhibits the reaction [3 and 4-Dihydroxyphenylacetic Acid analog binds to ACTB protein] CTD PMID:19743802 Actb Rat (+)-epicatechin-3-O-gallate multiple interactions EXP 6480464 epicatechin gallate inhibits the reaction [3 and 4-Dihydroxyphenylacetic Acid analog binds to ACTB protein] CTD PMID:19743802 Actb Rat (+)-pilocarpine multiple interactions ISO Actb (Mus musculus) 6480464 Pilocarpine promotes the reaction [EIF2S1 protein modified form results in decreased expression of ACTB protein] CTD PMID:16492139 Actb Rat (-)-epigallocatechin 3-gallate decreases expression ISO ACTB (Homo sapiens) 6480464 epigallocatechin gallate results in decreased expression of ACTB protein CTD PMID:31195006 Actb Rat (3,4-dihydroxyphenyl)acetic acid affects binding EXP 6480464 3 and 4-Dihydroxyphenylacetic Acid analog binds to ACTB protein CTD PMID:19743802 Actb Rat (3,4-dihydroxyphenyl)acetic acid multiple interactions EXP 6480464 Catechin inhibits the reaction [3 more ... CTD PMID:19743802 Actb Rat (S)-amphetamine decreases expression ISO Actb (Mus musculus) 6480464 Dextroamphetamine results in decreased expression of ACTB mRNA CTD PMID:12558987 Actb Rat (S)-nicotine increases expression ISO Actb (Mus musculus) 6480464 Nicotine results in increased expression of ACTB mRNA CTD PMID:17997037 Actb Rat 1,2-dichloroethane increases expression ISO Actb (Mus musculus) 6480464 ethylene dichloride results in increased expression of ACTB mRNA CTD PMID:28960355 Actb Rat 1,2-dimethylhydrazine increases expression ISO Actb (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ACTB mRNA CTD PMID:22206623 Actb Rat 1-chloro-2,4-dinitrobenzene increases metabolic processing ISO ACTB (Homo sapiens) 6480464 Dinitrochlorobenzene results in increased metabolism of ACTB protein CTD PMID:29267982 Actb Rat 1-chloro-2,4-dinitrobenzene affects binding ISO ACTB (Homo sapiens) 6480464 Dinitrochlorobenzene binds to ACTB protein CTD PMID:32991956 Actb Rat 17beta-estradiol increases expression ISO Actb (Mus musculus) 6480464 Estradiol results in increased expression of ACTB mRNA CTD PMID:30077407 and PMID:39298647 Actb Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of ACTB protein CTD PMID:32145629 Actb Rat 17beta-estradiol multiple interactions ISO Actb (Mus musculus) 6480464 [Polyphenols co-treated with Estradiol] results in increased expression of ACTB mRNA CTD PMID:30077407 Actb Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions ISO ACTB (Homo sapiens) 6480464 Metribolone promotes the reaction [NDRG1 protein binds to ACTB protein] CTD PMID:17220478 Actb Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO ACTB (Homo sapiens) 6480464 Metribolone results in increased expression of ACTB protein CTD PMID:17152098 Actb Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Actb (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Actb Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Actb (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Actb Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Actb (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [[Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of ACTB mRNA] CTD PMID:16054899 Actb Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO ACTB (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of ACTB protein CTD PMID:37788135 Actb Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ACTB mRNA CTD PMID:34747641 Actb Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Actb (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ACTB mRNA CTD PMID:15034205 Actb Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Actb (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ACTB mRNA CTD PMID:21570461 Actb Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ACTB mRNA CTD PMID:16054898 more ... Actb Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Actb (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ACTB mRNA and Tetrachlorodibenzodioxin results in decreased expression of ACTB protein CTD PMID:15591033 more ... Actb Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Actb Rat 2,3-dimethoxynaphthalene-1,4-dione increases expression ISO ACTB (Homo sapiens) 6480464 2 more ... CTD PMID:37788135 Actb Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO Actb (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of ACTB mRNA CTD PMID:17982090 Actb Rat 2,4,6-trinitrobenzenesulfonic acid decreases expression EXP 6480464 Trinitrobenzenesulfonic Acid results in decreased expression of ACTB mRNA CTD PMID:12163651 Actb Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO Actb (Mus musculus) 6480464 2 more ... CTD PMID:18550172 Actb Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO Actb (Mus musculus) 6480464 2 more ... CTD PMID:18550172 Actb Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of ACTB mRNA CTD PMID:21346803 Actb Rat 2-amino-2-deoxy-D-galactopyranose increases expression EXP 6480464 Galactosamine results in increased expression of ACTB mRNA CTD PMID:22563491 Actb Rat 2-methylcholine affects expression ISO ACTB (Homo sapiens) 6480464 beta-methylcholine affects the expression of ACTB mRNA CTD PMID:21179406 Actb Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine decreases expression EXP 6480464 Puromycin Aminonucleoside results in decreased expression of ACTB protein CTD PMID:19264907 Actb Rat 3,4-methylenedioxymethamphetamine increases expression ISO Actb (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of ACTB mRNA CTD PMID:20188158 Actb Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin analog results in decreased expression of ACTB protein and alpha-Chlorohydrin results in decreased expression of ACTB protein CTD PMID:26597043 Actb Rat 3-chloropropane-1,2-diol affects expression EXP 6480464 alpha-Chlorohydrin affects the expression of ACTB protein and alpha-Chlorohydrin analog affects the expression of ACTB protein CTD PMID:26072098 Actb Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Actb (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of ACTB mRNA and Tetrachlorodibenzodioxin promotes the reaction [[Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of ACTB mRNA] CTD PMID:16054899 Actb Rat 3-phenylprop-2-enal increases metabolic processing ISO ACTB (Homo sapiens) 6480464 cinnamaldehyde results in increased metabolism of ACTB protein CTD PMID:29267982 Actb Rat 4,4'-sulfonyldiphenol increases expression ISO Actb (Mus musculus) 6480464 bisphenol S results in increased expression of ACTB mRNA CTD PMID:39298647 Actb Rat 4,4'-sulfonyldiphenol increases expression ISO ACTB (Homo sapiens) 6480464 bisphenol S results in increased expression of ACTB protein CTD PMID:34186270 Actb Rat 4-hydroperoxycyclophosphamide decreases expression ISO Actb (Mus musculus) 6480464 perfosfamide results in decreased expression of ACTB mRNA CTD PMID:19429390 Actb Rat 4-hydroxynon-2-enal affects binding ISO ACTB (Homo sapiens) 6480464 ACTB protein binds to 4-hydroxy-2-nonenal CTD PMID:20043646 Actb Rat 4-vinylcyclohexene dioxide affects expression ISO Actb (Mus musculus) 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of ACTB mRNA CTD PMID:20829426 Actb Rat 5-fluorouracil decreases expression ISO Actb (Mus musculus) 6480464 Fluorouracil results in decreased expression of ACTB protein CTD PMID:21296659 Actb Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of ACTB mRNA CTD PMID:30047161 Actb Rat 7,12-dimethyltetraphene affects expression ISO Actb (Mus musculus) 6480464 9 more ... CTD PMID:21785161 Actb Rat abamectin decreases expression ISO Actb (Mus musculus) 6480464 abamectin results in decreased expression of ACTB protein CTD PMID:19879343 Actb Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ACTB mRNA CTD PMID:31881176 Actb Rat acetic acid affects expression ISO Actb (Mus musculus) 6480464 Acetic Acid affects the expression of ACTB protein CTD PMID:21296659 Actb Rat acetylsalicylic acid multiple interactions ISO ACTB (Homo sapiens) 6480464 Aspirin inhibits the reaction [thrombin receptor-activating peptide SFLLRNPNDKY analog results in increased secretion of ACTB protein] CTD PMID:17303692 Actb Rat acrolein multiple interactions ISO ACTB (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of and results in increased oxidation of ACTB mRNA more ... CTD PMID:32699268 and PMID:32845096 Actb Rat acrylamide decreases expression ISO ACTB (Homo sapiens) 6480464 Acrylamide results in decreased expression of ACTB mRNA CTD PMID:32763439 Actb Rat aflatoxin B1 decreases expression ISO Actb (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of ACTB mRNA CTD PMID:19770486 Actb Rat aflatoxin B1 increases expression ISO ACTB (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of ACTB mRNA CTD PMID:27153756 Actb Rat aldehydo-D-glucose decreases expression ISO ACTB (Homo sapiens) 6480464 Glucose deficiency results in decreased expression of ACTB protein CTD PMID:22314686 Actb Rat all-trans-retinoic acid affects expression ISO Actb (Mus musculus) 6480464 Tretinoin affects the expression of ACTB protein CTD PMID:15789344 Actb Rat all-trans-retinoic acid increases expression ISO ACTB (Homo sapiens) 6480464 Tretinoin results in increased expression of ACTB mRNA CTD PMID:33167477 Actb Rat all-trans-retinol decreases expression EXP 6480464 Vitamin A deficiency results in decreased expression of ACTB mRNA CTD PMID:12163651 Actb Rat alloxan decreases expression ISO Actb (Mus musculus) 6480464 Alloxan results in decreased expression of ACTB mRNA CTD PMID:12137914 Actb Rat Allylamine increases expression EXP 6480464 Allylamine results in increased expression of ACTB mRNA CTD PMID:15910882 Actb Rat alpha-pinene multiple interactions ISO ACTB (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of and results in increased oxidation of ACTB mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of and results in increased oxidation of ACTB mRNA CTD PMID:32699268 Actb Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of ACTB mRNA CTD PMID:30047161 Actb Rat ammonium chloride decreases expression EXP 6480464 Ammonium Chloride results in decreased expression of ACTB mRNA and Ammonium Chloride results in decreased expression of ACTB protein CTD PMID:16483693 Actb Rat aristolochic acid A decreases expression ISO ACTB (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of ACTB mRNA CTD PMID:33212167 Actb Rat Aroclor 1254 increases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of ACTB mRNA CTD PMID:18178546 Actb Rat Aroclor 1254 decreases expression ISO Actb (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of ACTB mRNA CTD PMID:23650126 Actb Rat arsane decreases expression EXP 6480464 Arsenic results in decreased expression of ACTB mRNA CTD PMID:18315880 Actb Rat arsenic atom decreases expression EXP 6480464 Arsenic results in decreased expression of ACTB mRNA CTD PMID:18315880 Actb Rat arsenite(3-) multiple interactions ISO ACTB (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to ACTB protein] CTD PMID:32406909 Actb Rat arsenous acid increases expression ISO ACTB (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ACTB mRNA CTD PMID:11940349 and PMID:20452446 Actb Rat arsenous acid decreases expression ISO ACTB (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of ACTB mRNA and Arsenic Trioxide results in decreased expression of ACTB protein CTD PMID:20452446 and PMID:20458559 Actb Rat bathocuproine disulfonic acid multiple interactions ISO ACTB (Homo sapiens) 6480464 [bathocuproine sulfonate co-treated with pyrrolidine dithiocarbamic acid] inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of ACTB mRNA] CTD PMID:15477007 Actb Rat beauvericin decreases expression ISO ACTB (Homo sapiens) 6480464 beauvericin results in decreased expression of ACTB mRNA CTD PMID:29203277 Actb Rat benzene affects expression EXP 6480464 Benzene affects the expression of ACTB mRNA CTD PMID:15878777 Actb Rat benzo[a]pyrene increases expression ISO Actb (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ACTB mRNA CTD PMID:22228805 Actb Rat benzo[a]pyrene affects methylation ISO ACTB (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ACTB promoter CTD PMID:27901495 Actb Rat benzo[a]pyrene multiple interactions ISO ACTB (Homo sapiens) 6480464 [Soot co-treated with Benzo(a)pyrene] results in increased expression of ACTB protein modified form CTD PMID:24464499 Actb Rat benzo[a]pyrene increases expression ISO ACTB (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of ACTB protein CTD PMID:18495319 Actb Rat benzo[a]pyrene decreases expression ISO Actb (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ACTB mRNA CTD PMID:15034205 Actb Rat benzo[a]pyrene decreases expression ISO ACTB (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ACTB mRNA CTD PMID:20064835 more ... Actb Rat beta-lapachone decreases expression ISO ACTB (Homo sapiens) 6480464 beta-lapachone results in decreased expression of ACTB mRNA CTD PMID:38218311 Actb Rat beta-lapachone increases expression ISO ACTB (Homo sapiens) 6480464 beta-lapachone results in increased expression of ACTB mRNA CTD PMID:38218311 Actb Rat bis(2-chloroethyl) sulfide decreases expression ISO ACTB (Homo sapiens) 6480464 Mustard Gas results in decreased expression of ACTB mRNA CTD PMID:33491125 Actb Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of ACTB protein CTD PMID:16400681 Actb Rat bis(2-ethylhexyl) phthalate affects expression ISO Actb (Mus musculus) 6480464 Diethylhexyl Phthalate affects the expression of ACTB mRNA CTD PMID:37059381 Actb Rat bis(2-ethylhexyl) phthalate increases expression ISO Actb (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of ACTB mRNA and Diethylhexyl Phthalate results in increased expression of ACTB protein CTD PMID:28934723 and PMID:33754040 Actb Rat bisphenol A decreases expression ISO ACTB (Homo sapiens) 6480464 bisphenol A results in decreased expression of ACTB mRNA and bisphenol A results in decreased expression of ACTB protein CTD PMID:25047013 more ... Actb Rat bisphenol A multiple interactions ISO ACTB (Homo sapiens) 6480464 [ginger extract results in increased abundance of Oils and Volatile] inhibits the reaction [bisphenol A results in decreased expression of ACTB protein] CTD PMID:33376534 Actb Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ACTB protein CTD PMID:32145629 Actb Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ACTB mRNA CTD PMID:30903817 Actb Rat bisphenol A affects expression ISO ACTB (Homo sapiens) 6480464 bisphenol A affects the expression of ACTB mRNA and bisphenol A affects the expression of ACTB protein CTD PMID:30903817 and PMID:34186270 Actb Rat bisphenol A increases methylation ISO Actb (Mus musculus) 6480464 bisphenol A results in increased methylation of ACTB promoter CTD PMID:27312807 Actb Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ACTB gene CTD PMID:28505145 Actb Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ACTB mRNA CTD PMID:25181051 Actb Rat bisphenol A decreases expression ISO Actb (Mus musculus) 6480464 bisphenol A results in decreased expression of ACTB protein CTD PMID:25772901 Actb Rat bisphenol AF increases expression ISO ACTB (Homo sapiens) 6480464 bisphenol AF results in increased expression of ACTB protein CTD PMID:34186270 Actb Rat Bisphenol B increases expression ISO ACTB (Homo sapiens) 6480464 bisphenol B results in increased expression of ACTB protein CTD PMID:34186270 Actb Rat bisphenol F increases expression ISO ACTB (Homo sapiens) 6480464 bisphenol F results in increased expression of ACTB protein CTD PMID:34186270 Actb Rat Brodifacoum decreases expression EXP 6480464 bromfenacoum results in decreased expression of ACTB protein CTD PMID:28903499 Actb Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of ACTB mRNA CTD PMID:16036859 Actb Rat bromochloroacetic acid increases expression ISO Actb (Mus musculus) 6480464 bromochloroacetic acid results in increased expression of ACTB protein CTD PMID:21296659 Actb Rat bufalin increases expression ISO ACTB (Homo sapiens) 6480464 bufalin results in increased expression of ACTB protein CTD PMID:23091618 Actb Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of ACTB mRNA CTD PMID:24136188 Actb Rat butan-1-ol multiple interactions ISO ACTB (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of ACTB mRNA CTD PMID:29432896 Actb Rat butanal increases expression ISO ACTB (Homo sapiens) 6480464 butyraldehyde results in increased expression of ACTB mRNA CTD PMID:26079696 Actb Rat cadmium dichloride decreases expression ISO ACTB (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of ACTB protein CTD PMID:20452446 Actb Rat cadmium dichloride increases expression ISO ACTB (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ACTB mRNA CTD PMID:20452446 more ... Actb Rat cadmium dichloride affects expression ISO ACTB (Homo sapiens) 6480464 Cadmium Chloride affects the expression of ACTB mRNA CTD PMID:23828170 Actb Rat caffeine decreases expression ISO ACTB (Homo sapiens) 6480464 Caffeine results in decreased expression of ACTB protein CTD PMID:31195006 Actb Rat caffeine affects phosphorylation ISO ACTB (Homo sapiens) 6480464 Caffeine affects the phosphorylation of ACTB protein CTD PMID:35688186 Actb Rat calcidiol decreases expression EXP 6480464 Calcifediol deficiency results in decreased expression of ACTB mRNA CTD PMID:17293106 Actb Rat calcitriol multiple interactions EXP 6480464 [Calcium co-treated with Calcitriol] affects the expression of ACTB mRNA CTD PMID:15913539 Actb Rat calcium atom multiple interactions EXP 6480464 [Calcium co-treated with Calcitriol] affects the expression of ACTB mRNA CTD PMID:15913539 Actb Rat calcium(0) multiple interactions EXP 6480464 [Calcium co-treated with Calcitriol] affects the expression of ACTB mRNA CTD PMID:15913539 Actb Rat carbon disulfide increases expression EXP 6480464 Carbon Disulfide results in increased expression of ACTB mRNA and Carbon Disulfide results in increased expression of ACTB protein CTD PMID:16474999 and PMID:17498345 Actb Rat carbon nanotube affects expression ISO Actb (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of ACTB protein CTD PMID:21135415 Actb Rat carbon nanotube decreases expression ISO ACTB (Homo sapiens) 6480464 Nanotubes and Carbon results in decreased expression of ACTB mRNA CTD PMID:28673683 Actb Rat ceftriaxone increases expression EXP 6480464 Ceftriaxone results in increased expression of ACTB mRNA CTD PMID:29745864 Actb Rat chloromethylisothiazolinone increases metabolic processing ISO ACTB (Homo sapiens) 6480464 5-chloro-2-methyl-4-isothiazolin-3-one results in increased metabolism of ACTB protein CTD PMID:29267982 Actb Rat chloropicrin decreases expression ISO ACTB (Homo sapiens) 6480464 chloropicrin results in decreased expression of ACTB mRNA CTD PMID:26352163 Actb Rat cisplatin decreases expression ISO ACTB (Homo sapiens) 6480464 Cisplatin results in decreased expression of ACTB mRNA CTD PMID:27594783 Actb Rat cisplatin multiple interactions ISO ACTB (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of ACTB mRNA CTD PMID:27392435 Actb Rat clobetasol increases expression ISO Actb (Mus musculus) 6480464 Clobetasol results in increased expression of ACTB mRNA CTD PMID:27462272 Actb Rat clofibrate decreases expression ISO Actb (Mus musculus) 6480464 Clofibrate results in decreased expression of ACTB mRNA CTD PMID:17585979 Actb Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of ACTB protein CTD PMID:16470657 Actb Rat clozapine decreases expression ISO ACTB (Homo sapiens) 6480464 Clozapine results in decreased expression of ACTB protein CTD PMID:34122009 Actb Rat copper atom multiple interactions ISO ACTB (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of ACTB mRNA CTD PMID:30911355 Actb Rat copper(0) multiple interactions ISO ACTB (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of ACTB mRNA CTD PMID:30911355 Actb Rat copper(II) chloride increases expression ISO Actb (Mus musculus) 6480464 cupric chloride results in increased expression of ACTB protein CTD PMID:29617964 Actb Rat copper(II) sulfate decreases expression ISO ACTB (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ACTB protein CTD PMID:20452446 Actb Rat copper(II) sulfate increases expression ISO ACTB (Homo sapiens) 6480464 Copper Sulfate results in increased expression of ACTB mRNA CTD PMID:19549813 and PMID:20452446 Actb Rat coumarin decreases phosphorylation ISO ACTB (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of ACTB protein CTD PMID:35688186 Actb Rat crocidolite asbestos increases expression ISO ACTB (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of ACTB protein CTD PMID:29553831 Actb Rat cyclophosphamide decreases expression ISO ACTB (Homo sapiens) 6480464 Cyclophosphamide results in decreased expression of ACTB mRNA CTD PMID:12167460 Actb Rat cyclophosphamide affects expression EXP 6480464 Cyclophosphamide affects the expression of ACTB mRNA CTD PMID:10859244 Actb Rat cyclosporin A decreases expression ISO ACTB (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ACTB mRNA CTD PMID:21632981 Actb Rat cyclosporin A increases secretion ISO Actb (Mus musculus) 6480464 Cyclosporine results in increased secretion of ACTB protein CTD PMID:21354196 Actb Rat cylindrospermopsin decreases expression ISO ACTB (Homo sapiens) 6480464 cylindrospermopsin results in decreased expression of ACTB protein CTD PMID:27494769 Actb Rat cylindrospermopsin increases expression ISO ACTB (Homo sapiens) 6480464 cylindrospermopsin results in increased expression of ACTB protein mutant form CTD PMID:27494769 Actb Rat cylindrospermopsin increases mutagenesis ISO ACTB (Homo sapiens) 6480464 cylindrospermopsin results in increased mutagenesis of ACTB protein CTD PMID:27494769 Actb Rat D-glucose decreases expression ISO ACTB (Homo sapiens) 6480464 Glucose deficiency results in decreased expression of ACTB protein CTD PMID:22314686 Actb Rat DDE increases expression ISO ACTB (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of ACTB mRNA CTD PMID:38568856 Actb Rat DDT decreases expression ISO ACTB (Homo sapiens) 6480464 DDT results in decreased expression of ACTB protein CTD PMID:26186133 Actb Rat dexamethasone multiple interactions ISO Actb (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of ACTB mRNA and Tetrachlorodibenzodioxin promotes the reaction [[Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of ACTB mRNA] CTD PMID:16054899 Actb Rat diarsenic trioxide increases expression ISO ACTB (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ACTB mRNA CTD PMID:11940349 and PMID:20452446 Actb Rat diarsenic trioxide decreases expression ISO ACTB (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of ACTB mRNA and Arsenic Trioxide results in decreased expression of ACTB protein CTD PMID:20452446 and PMID:20458559 Actb Rat dibenzo[a,l]pyrene increases expression ISO ACTB (Homo sapiens) 6480464 dibenzo(a and l)pyrene results in increased expression of ACTB protein CTD PMID:18495319 Actb Rat dibenzo[a,l]pyrene decreases expression ISO ACTB (Homo sapiens) 6480464 dibenzo(a and l)pyrene results in decreased expression of ACTB mRNA CTD PMID:31255691 Actb Rat Dibutyl phosphate affects expression ISO ACTB (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ACTB mRNA CTD PMID:37042841 Actb Rat dibutyl phthalate increases expression ISO Actb (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of ACTB mRNA CTD PMID:21266533 Actb Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of ACTB mRNA CTD PMID:21266533 Actb Rat dicrotophos increases expression ISO ACTB (Homo sapiens) 6480464 dicrotophos results in increased expression of ACTB mRNA CTD PMID:28302478 Actb Rat diethylstilbestrol decreases expression ISO Actb (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of ACTB mRNA CTD PMID:15171707 Actb Rat diethylstilbestrol increases expression ISO ACTB (Homo sapiens) 6480464 Diethylstilbestrol results in increased expression of ACTB mRNA CTD PMID:36621641 Actb Rat dioxygen multiple interactions ISO ACTB (Homo sapiens) 6480464 Oxygen deficiency promotes the reaction [KDM1A protein binds to ACTB promoter] CTD PMID:25043185 Actb Rat disodium selenite increases expression ISO ACTB (Homo sapiens) 6480464 Sodium Selenite results in increased expression of ACTB mRNA CTD PMID:18175754 Actb Rat diuron decreases expression ISO ACTB (Homo sapiens) 6480464 Diuron results in decreased expression of ACTB mRNA CTD PMID:35967413 Actb Rat dopamine affects expression ISO ACTB (Homo sapiens) 6480464 Dopamine affects the expression of ACTB protein CTD PMID:24675778 Actb Rat Doramectin decreases expression ISO Actb (Mus musculus) 6480464 doramectin results in decreased expression of ACTB protein CTD PMID:19879343 Actb Rat doxorubicin affects expression ISO ACTB (Homo sapiens) 6480464 Doxorubicin affects the expression of ACTB mRNA and Doxorubicin affects the expression of ACTB protein CTD PMID:29385562 and PMID:29803840 Actb Rat doxorubicin increases oxidation EXP 6480464 Doxorubicin results in increased oxidation of ACTB protein CTD PMID:28818578 Actb Rat elemental selenium increases expression ISO ACTB (Homo sapiens) 6480464 Selenium results in increased expression of ACTB mRNA CTD PMID:19244175 Actb Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ACTB mRNA CTD PMID:29391264 Actb Rat endosulfan decreases expression ISO ACTB (Homo sapiens) 6480464 Endosulfan results in decreased expression of ACTB mRNA CTD PMID:30090376 Actb Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of ACTB protein CTD PMID:23702218 Actb Rat ethanol affects splicing ISO Actb (Mus musculus) 6480464 Ethanol affects the splicing of ACTB mRNA CTD PMID:30319688 Actb Rat Evodiamine decreases expression ISO ACTB (Homo sapiens) 6480464 evodiamine results in decreased expression of ACTB mRNA CTD PMID:32057900 Actb Rat fenbuconazole increases expression ISO ACTB (Homo sapiens) 6480464 fenbuconazole results in increased expression of ACTB mRNA CTD PMID:15942997 Actb Rat fenthion decreases expression ISO Actb (Mus musculus) 6480464 Fenthion results in decreased expression of ACTB mRNA CTD PMID:34813904 Actb Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of ACTB mRNA CTD PMID:31881178 and PMID:34044035 Actb Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of ACTB mRNA CTD PMID:24136188 Actb Rat FR900359 affects phosphorylation ISO ACTB (Homo sapiens) 6480464 FR900359 affects the phosphorylation of ACTB protein CTD PMID:37730182 Actb Rat furan increases expression EXP 6480464 furan results in increased expression of ACTB mRNA CTD PMID:15120968 Actb Rat gamma-hexachlorocyclohexane affects expression EXP 6480464 Hexachlorocyclohexane affects the expression of ACTB mRNA CTD PMID:22001173 Actb Rat genistein decreases expression ISO ACTB (Homo sapiens) 6480464 Genistein results in decreased expression of ACTB mRNA CTD PMID:22228119 Actb Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ACTB mRNA CTD PMID:22061828 Actb Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of ACTB mRNA CTD PMID:33387578 Actb Rat glucose decreases expression ISO ACTB (Homo sapiens) 6480464 Glucose deficiency results in decreased expression of ACTB protein CTD PMID:22314686 Actb Rat glyphosate decreases expression ISO ACTB (Homo sapiens) 6480464 Glyphosate results in decreased expression of ACTB mRNA CTD PMID:31295307 Actb Rat hyaluronic acid multiple interactions EXP 6480464 Hyaluronic Acid analog affects the reaction [Hydrogen Peroxide results in decreased expression of ACTB protein] CTD PMID:23178681 Actb Rat hyaluronic acid affects expression EXP 6480464 Hyaluronic Acid analog affects the expression of ACTB protein CTD PMID:23178681 Actb Rat hydrogen peroxide decreases expression ISO ACTB (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of ACTB mRNA CTD PMID:12419474 Actb Rat hydrogen peroxide multiple interactions EXP 6480464 Hyaluronic Acid analog affects the reaction [Hydrogen Peroxide results in decreased expression of ACTB protein] CTD PMID:23178681 Actb Rat hydrogen peroxide decreases expression EXP 6480464 Hydrogen Peroxide results in decreased expression of ACTB protein CTD PMID:23178681 Actb Rat indirubin-3'-monoxime affects expression ISO ACTB (Homo sapiens) 6480464 indirubin-3'-monoxime affects the expression of ACTB protein CTD PMID:18958680 Actb Rat iodide salt decreases expression EXP 6480464 Iodides deficiency results in decreased expression of ACTB protein CTD PMID:26795019 Actb Rat ionomycin multiple interactions ISO ACTB (Homo sapiens) 6480464 [bathocuproine sulfonate co-treated with pyrrolidine dithiocarbamic acid] inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of ACTB mRNA] and [Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of ACTB mRNA CTD PMID:15477007 Actb Rat isoprenaline decreases expression ISO Actb (Mus musculus) 6480464 Isoproterenol results in decreased expression of ACTB mRNA CTD PMID:20003209 Actb Rat ivermectin decreases expression ISO ACTB (Homo sapiens) 6480464 Ivermectin results in decreased expression of ACTB protein CTD PMID:32959892 Actb Rat lasalocid increases expression ISO ACTB (Homo sapiens) 6480464 Lasalocid results in increased expression of ACTB protein CTD PMID:37788135 Actb Rat latrunculin A decreases response to substance ISO ACTB (Homo sapiens) 6480464 ACTB protein mutant form results in decreased susceptibility to latrunculin A CTD PMID:16685646 Actb Rat lead diacetate affects expression ISO Actb (Mus musculus) 6480464 lead acetate affects the expression of ACTB protein CTD PMID:20797405 Actb Rat lead(0) affects expression ISO ACTB (Homo sapiens) 6480464 Lead affects the expression of ACTB mRNA CTD PMID:28903495 Actb Rat lead(II) chloride decreases expression ISO ACTB (Homo sapiens) 6480464 lead chloride results in decreased expression of ACTB protein CTD PMID:24419708 Actb Rat leflunomide increases expression ISO ACTB (Homo sapiens) 6480464 leflunomide results in increased expression of ACTB mRNA CTD PMID:28988120 Actb Rat lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of ACTB mRNA CTD PMID:11779202 Actb Rat lithium atom increases expression EXP 6480464 Lithium results in increased expression of ACTB protein CTD PMID:18296634 Actb Rat lithium hydride increases expression EXP 6480464 Lithium results in increased expression of ACTB protein CTD PMID:18296634 Actb Rat lovastatin decreases expression ISO Actb (Mus musculus) 6480464 Lovastatin results in decreased expression of ACTB mRNA CTD PMID:20493250 Actb Rat lovastatin increases expression ISO Actb (Mus musculus) 6480464 Lovastatin results in increased expression of ACTB mRNA CTD PMID:20493250 Actb Rat manganese(II) chloride decreases expression ISO ACTB (Homo sapiens) 6480464 manganese chloride results in decreased expression of ACTB protein CTD PMID:20452446 Actb Rat manganese(II) chloride increases expression ISO ACTB (Homo sapiens) 6480464 manganese chloride results in increased expression of ACTB mRNA CTD PMID:20452446 Actb Rat melittin increases expression ISO ACTB (Homo sapiens) 6480464 Melitten results in increased expression of ACTB protein CTD PMID:34375656 Actb Rat mercury atom increases expression EXP 6480464 Mercury results in increased expression of ACTB mRNA CTD PMID:22688007 Actb Rat mercury dichloride increases expression ISO ACTB (Homo sapiens) 6480464 Mercuric Chloride results in increased expression of ACTB mRNA CTD PMID:20452446 Actb Rat mercury dichloride decreases expression ISO ACTB (Homo sapiens) 6480464 Mercuric Chloride results in decreased expression of ACTB protein CTD PMID:20452446 Actb Rat mercury(0) increases expression EXP 6480464 Mercury results in increased expression of ACTB mRNA CTD PMID:22688007 Actb Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of ACTB protein CTD PMID:19826936 Actb Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of ACTB protein CTD PMID:30467583 Actb Rat methidathion affects expression ISO Actb (Mus musculus) 6480464 methidathion affects the expression of ACTB mRNA CTD PMID:34813904 Actb Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of ACTB mRNA CTD PMID:30047161 Actb Rat methyl methanesulfonate decreases expression ISO ACTB (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of ACTB mRNA CTD PMID:23649840 Actb Rat methylmercury chloride increases expression ISO ACTB (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of ACTB mRNA CTD PMID:26272509 Actb Rat methylparaben multiple interactions ISO ACTB (Homo sapiens) 6480464 [mono(2-ethyl-5-hydroxyhexyl) phthalate co-treated with mono-isobutyl phthalate co-treated with mono-benzyl phthalate co-treated with methylparaben] results in increased expression of ACTB mRNA CTD PMID:38992643 Actb Rat microcystin-LR decreases expression ISO Actb (Mus musculus) 6480464 cyanoginosin LR results in decreased expression of ACTB mRNA CTD PMID:17383702 Actb Rat microcystin-LR decreases expression EXP 6480464 cyanoginosin LR results in decreased expression of ACTB mRNA CTD PMID:23342045 Actb Rat mifepristone decreases expression ISO ACTB (Homo sapiens) 6480464 Mifepristone results in decreased expression of ACTB mRNA CTD PMID:17584828 Actb Rat mono(2-ethyl-5-hydroxyhexyl) phthalate affects expression ISO ACTB (Homo sapiens) 6480464 mono(2-ethyl-5-hydroxyhexyl) phthalate affects the expression of ACTB mRNA CTD PMID:38992643 Actb Rat mono(2-ethyl-5-hydroxyhexyl) phthalate multiple interactions ISO ACTB (Homo sapiens) 6480464 [mono(2-ethyl-5-hydroxyhexyl) phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with mono(2-ethyl-5-oxohexyl)phthalate co-treated with 2-ethyl-5-carboxypentyl phthalate co-treated with mono-isobutyl phthalate co-treated with mono-benzyl phthalate co-treated with monobutyl phthalate metabolite co-treated with monoethyl phthalate co-treated with monobutyl phthalate] results in increased expression of ACTB mRNA and [mono(2-ethyl-5-hydroxyhexyl) phthalate co-treated with mono-isobutyl phthalate co-treated with mono-benzyl phthalate co-treated with methylparaben] results in increased expression of ACTB mRNA CTD PMID:38992643 Actb Rat mono(2-ethyl-5-oxohexyl) phthalate multiple interactions ISO ACTB (Homo sapiens) 6480464 [mono(2-ethyl-5-hydroxyhexyl) phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with mono(2-ethyl-5-oxohexyl)phthalate co-treated with 2-ethyl-5-carboxypentyl phthalate co-treated with mono-isobutyl phthalate co-treated with mono-benzyl phthalate co-treated with monobutyl phthalate metabolite co-treated with monoethyl phthalate co-treated with monobutyl phthalate] results in increased expression of ACTB mRNA CTD PMID:38992643 Actb Rat mono(2-ethylhexyl) phthalate increases expression ISO ACTB (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of ACTB mRNA CTD PMID:38685446 Actb Rat mono(2-ethylhexyl) phthalate multiple interactions ISO ACTB (Homo sapiens) 6480464 [mono(2-ethyl-5-hydroxyhexyl) phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with mono(2-ethyl-5-oxohexyl)phthalate co-treated with 2-ethyl-5-carboxypentyl phthalate co-treated with mono-isobutyl phthalate co-treated with mono-benzyl phthalate co-treated with monobutyl phthalate metabolite co-treated with monoethyl phthalate co-treated with monobutyl phthalate] results in increased expression of ACTB mRNA CTD PMID:38992643 Actb Rat mono(5-carboxy-2-ethylpentyl) phthalate multiple interactions ISO ACTB (Homo sapiens) 6480464 [mono(2-ethyl-5-hydroxyhexyl) phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with mono(2-ethyl-5-oxohexyl)phthalate co-treated with 2-ethyl-5-carboxypentyl phthalate co-treated with mono-isobutyl phthalate co-treated with mono-benzyl phthalate co-treated with monobutyl phthalate metabolite co-treated with monoethyl phthalate co-treated with monobutyl phthalate] results in increased expression of ACTB mRNA CTD PMID:38992643 Actb Rat monobenzyl phthalate multiple interactions ISO ACTB (Homo sapiens) 6480464 [mono(2-ethyl-5-hydroxyhexyl) phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with mono(2-ethyl-5-oxohexyl)phthalate co-treated with 2-ethyl-5-carboxypentyl phthalate co-treated with mono-isobutyl phthalate co-treated with mono-benzyl phthalate co-treated with monobutyl phthalate metabolite co-treated with monoethyl phthalate co-treated with monobutyl phthalate] results in increased expression of ACTB mRNA and [mono(2-ethyl-5-hydroxyhexyl) phthalate co-treated with mono-isobutyl phthalate co-treated with mono-benzyl phthalate co-treated with methylparaben] results in increased expression of ACTB mRNA CTD PMID:38992643 Actb Rat Monobutylphthalate increases expression ISO Actb (Mus musculus) 6480464 monobutyl phthalate results in increased expression of ACTB protein CTD PMID:20553848 Actb Rat Monobutylphthalate multiple interactions ISO ACTB (Homo sapiens) 6480464 [mono(2-ethyl-5-hydroxyhexyl) phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with mono(2-ethyl-5-oxohexyl)phthalate co-treated with 2-ethyl-5-carboxypentyl phthalate co-treated with mono-isobutyl phthalate co-treated with mono-benzyl phthalate co-treated with monobutyl phthalate metabolite co-treated with monoethyl phthalate co-treated with monobutyl phthalate] results in increased expression of ACTB mRNA CTD PMID:38992643 Actb Rat monocrotaline multiple interactions ISO ACTB (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of Monocrotaline] which results in decreased expression of ACTB mRNA CTD PMID:33884520 Actb Rat monoethyl phthalate multiple interactions ISO ACTB (Homo sapiens) 6480464 [mono(2-ethyl-5-hydroxyhexyl) phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with mono(2-ethyl-5-oxohexyl)phthalate co-treated with 2-ethyl-5-carboxypentyl phthalate co-treated with mono-isobutyl phthalate co-treated with mono-benzyl phthalate co-treated with monobutyl phthalate metabolite co-treated with monoethyl phthalate co-treated with monobutyl phthalate] results in increased expression of ACTB mRNA CTD PMID:38992643 Actb Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases expression ISO ACTB (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of ACTB mRNA CTD PMID:15857753 Actb Rat N-methyl-4-phenylpyridinium decreases expression ISO ACTB (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of ACTB protein CTD PMID:24675778 Actb Rat N-methyl-N-nitrosourea increases mutagenesis EXP 6480464 Methylnitrosourea results in increased mutagenesis of ACTB gene CTD PMID:10767621 Actb Rat N-nitrosomorpholine decreases expression EXP 6480464 N-nitrosomorpholine results in decreased expression of ACTB protein CTD PMID:19716841 Actb Rat N-nitrosomorpholine affects expression EXP 6480464 N-nitrosomorpholine affects the expression of ACTB protein CTD PMID:19716841 Actb Rat naphthalene affects binding ISO Actb (Mus musculus) 6480464 naphthalene metabolite binds to ACTB protein CTD PMID:15892573 Actb Rat naphthalene increases expression ISO Actb (Mus musculus) 6480464 naphthalene results in increased expression of ACTB protein CTD PMID:19438287 Actb Rat nickel atom increases expression ISO ACTB (Homo sapiens) 6480464 Nickel results in increased expression of ACTB mRNA CTD PMID:25583101 Actb Rat nickel dichloride decreases expression ISO ACTB (Homo sapiens) 6480464 nickel chloride results in decreased expression of ACTB protein CTD PMID:20452446 Actb Rat nickel dichloride increases expression ISO ACTB (Homo sapiens) 6480464 nickel chloride results in increased expression of ACTB mRNA CTD PMID:20452446 Actb Rat nicotine increases expression ISO Actb (Mus musculus) 6480464 Nicotine results in increased expression of ACTB mRNA CTD PMID:17997037 Actb Rat nitrates multiple interactions ISO Actb (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ACTB mRNA CTD PMID:35964746 Actb Rat nitric oxide decreases expression ISO Actb (Mus musculus) 6480464 Nitric Oxide deficiency results in decreased expression of ACTB mRNA CTD PMID:15878706 Actb Rat nitroglycerin decreases expression EXP 6480464 Nitroglycerin results in decreased expression of ACTB mRNA CTD PMID:12102619 Actb Rat Nonylphenol increases expression EXP 6480464 nonylphenol results in increased expression of ACTB protein CTD PMID:19260726 Actb Rat ochratoxin A increases expression ISO ACTB (Homo sapiens) 6480464 ochratoxin A results in increased expression of ACTB protein CTD PMID:31276768 Actb Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of ACTB mRNA CTD PMID:16330353 Actb Rat ozone multiple interactions ISO ACTB (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of and results in increased oxidation of ACTB mRNA more ... CTD PMID:32699268 and PMID:32845096 Actb Rat p-menthan-3-ol decreases expression ISO ACTB (Homo sapiens) 6480464 Menthol results in decreased expression of ACTB protein CTD PMID:26760959 Actb Rat paracetamol affects expression ISO Actb (Mus musculus) 6480464 Acetaminophen affects the expression of ACTB mRNA CTD PMID:17562736 Actb Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ACTB mRNA CTD PMID:33387578 Actb Rat paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of ACTB mRNA CTD PMID:20732408 Actb Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of ACTB mRNA and Acetaminophen results in increased expression of ACTB protein CTD PMID:16687475 and PMID:22563491 Actb Rat paraoxon increases expression ISO ACTB (Homo sapiens) 6480464 Paraoxon results in increased expression of ACTB protein CTD PMID:20931991 Actb Rat paraquat increases expression ISO ACTB (Homo sapiens) 6480464 Paraquat results in increased expression of ACTB mRNA CTD PMID:20883675 Actb Rat perfluorobutyric acid decreases expression ISO ACTB (Homo sapiens) 6480464 perfluorobutyric acid results in decreased expression of ACTB mRNA CTD PMID:23567314 Actb Rat perfluorononanoic acid decreases expression ISO ACTB (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of ACTB mRNA CTD PMID:23567314 Actb Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of ACTB protein CTD PMID:19616056 Actb Rat phenethyl isothiocyanate affects binding ISO ACTB (Homo sapiens) 6480464 ACTB protein binds to phenethyl isothiocyanate CTD PMID:21838287 Actb Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of ACTB mRNA CTD PMID:15215175 Actb Rat phlorizin increases expression ISO Actb (Mus musculus) 6480464 Phlorhizin results in increased expression of ACTB mRNA CTD PMID:22538082 Actb Rat phorbol 13-acetate 12-myristate multiple interactions ISO ACTB (Homo sapiens) 6480464 [bathocuproine sulfonate co-treated with pyrrolidine dithiocarbamic acid] inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of ACTB mRNA] and [Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of ACTB mRNA CTD PMID:15477007 Actb Rat progesterone affects expression ISO Actb (Mus musculus) 6480464 Progesterone affects the expression of ACTB mRNA CTD PMID:17251523 Actb Rat propiconazole decreases expression ISO Actb (Mus musculus) 6480464 propiconazole results in decreased expression of ACTB mRNA CTD PMID:19363144 Actb Rat pyrrolidine dithiocarbamate multiple interactions ISO ACTB (Homo sapiens) 6480464 [bathocuproine sulfonate co-treated with pyrrolidine dithiocarbamic acid] inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of ACTB mRNA] CTD PMID:15477007 Actb Rat quercetin affects binding ISO ACTB (Homo sapiens) 6480464 Quercetin analog binds to ACTB protein mutant form CTD PMID:21798748 Actb Rat quercetin decreases expression ISO ACTB (Homo sapiens) 6480464 Quercetin results in decreased expression of ACTB mRNA CTD PMID:21632981 Actb Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [3 and 4-Dihydroxyphenylacetic Acid analog binds to ACTB protein] CTD PMID:19743802 Actb Rat resveratrol affects expression EXP 6480464 resveratrol affects the expression of ACTB mRNA CTD PMID:15748624 Actb Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of ACTB protein CTD PMID:35544339 Actb Rat S-butyl-DL-homocysteine (S,R)-sulfoximine decreases expression ISO Actb (Mus musculus) 6480464 Buthionine Sulfoximine results in decreased expression of ACTB mRNA CTD PMID:15878706 Actb Rat selenium atom increases expression ISO ACTB (Homo sapiens) 6480464 Selenium results in increased expression of ACTB mRNA CTD PMID:19244175 Actb Rat serpentine asbestos increases expression ISO ACTB (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of ACTB mRNA CTD PMID:23706555 Actb Rat serpentine asbestos multiple interactions ISO ACTB (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of and results in increased phosphorylation of ACTB protein CTD PMID:23706555 Actb Rat silicon dioxide affects secretion ISO ACTB (Homo sapiens) 6480464 Silicon Dioxide analog affects the secretion of ACTB protein CTD PMID:25895662 Actb Rat silver atom decreases expression ISO Actb (Mus musculus) 6480464 Silver results in decreased expression of ACTB mRNA CTD PMID:19429238 Actb Rat silver(0) decreases expression ISO Actb (Mus musculus) 6480464 Silver results in decreased expression of ACTB mRNA CTD PMID:19429238 Actb Rat simvastatin increases expression EXP 6480464 Simvastatin results in increased expression of ACTB mRNA CTD PMID:25055962 Actb Rat sirolimus increases expression ISO Actb (Mus musculus) 6480464 Sirolimus results in increased expression of ACTB mRNA CTD PMID:7503980 Actb Rat sirolimus multiple interactions ISO Actb (Mus musculus) 6480464 [Sirolimus binds to FKBP1A protein] which results in increased expression of ACTB mRNA CTD PMID:7503980 Actb Rat sodium arsenate increases expression ISO Actb (Mus musculus) 6480464 sodium arsenate results in increased expression of ACTB mRNA CTD PMID:21795629 Actb Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of ACTB mRNA CTD PMID:19072884 Actb Rat sodium arsenite increases expression ISO ACTB (Homo sapiens) 6480464 sodium arsenite results in increased expression of ACTB mRNA CTD PMID:34032870 Actb Rat sodium fluoride increases expression ISO Actb (Mus musculus) 6480464 Sodium Fluoride results in increased expression of ACTB mRNA CTD PMID:27862939 Actb Rat sodium fluoride decreases expression ISO Actb (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of ACTB protein CTD PMID:27548804 Actb Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of ACTB mRNA CTD PMID:30047161 Actb Rat sulforaphane affects binding ISO ACTB (Homo sapiens) 6480464 ACTB protein binds to sulforaphane CTD PMID:21838287 Actb Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of ACTB protein CTD PMID:26141394 Actb Rat tert-butyl hydroperoxide decreases expression ISO ACTB (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of ACTB mRNA CTD PMID:12419474 Actb Rat tetrachloroethene decreases expression ISO Actb (Mus musculus) 6480464 Tetrachloroethylene results in decreased expression of ACTB mRNA CTD PMID:28973375 Actb Rat tetrachloromethane decreases expression ISO Actb (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of ACTB mRNA and Carbon Tetrachloride results in decreased expression of ACTB protein CTD PMID:18395095 Actb Rat tetrachloromethane increases expression ISO Actb (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of ACTB mRNA CTD PMID:31919559 Actb Rat tetrachloromethane multiple interactions EXP 6480464 [Olive Oil analog co-treated with Carbon Tetrachloride] affects the expression of ACTB protein CTD PMID:25303780 Actb Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ACTB mRNA CTD PMID:22563491 Actb Rat thioacetamide decreases expression ISO Actb (Mus musculus) 6480464 Thioacetamide results in decreased expression of ACTB mRNA and Thioacetamide results in decreased expression of ACTB protein CTD PMID:18395095 Actb Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ACTB mRNA CTD PMID:22563491 and PMID:34492290 Actb Rat thiram increases expression ISO ACTB (Homo sapiens) 6480464 Thiram results in increased expression of ACTB mRNA CTD PMID:38568856 Actb Rat titanium dioxide increases expression ISO Actb (Mus musculus) 6480464 titanium dioxide results in increased expression of ACTB mRNA CTD PMID:23557971 Actb Rat titanium dioxide increases methylation ISO Actb (Mus musculus) 6480464 titanium dioxide results in increased methylation of ACTB gene CTD PMID:35295148 Actb Rat triadimefon decreases expression ISO Actb (Mus musculus) 6480464 triadimefon results in decreased expression of ACTB mRNA CTD PMID:19363144 Actb Rat trichloroethene increases expression ISO Actb (Mus musculus) 6480464 Trichloroethylene results in increased expression of ACTB mRNA CTD PMID:19254012 Actb Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of ACTB mRNA CTD PMID:33387578 Actb Rat triphenyl phosphate affects expression ISO ACTB (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ACTB mRNA CTD PMID:37042841 Actb Rat triphenylstannane decreases expression ISO ACTB (Homo sapiens) 6480464 triphenyltin analog results in decreased expression of ACTB protein CTD PMID:31634547 Actb Rat Triptolide decreases expression EXP 6480464 triptolide results in decreased expression of ACTB mRNA and triptolide results in decreased expression of ACTB protein CTD PMID:27554044 Actb Rat tris(2-butoxyethyl) phosphate affects expression ISO ACTB (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of ACTB mRNA CTD PMID:29024780 Actb Rat triticonazole decreases expression EXP 6480464 triticonazole results in decreased expression of ACTB mRNA CTD PMID:36084822 Actb Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of ACTB mRNA CTD PMID:24136188 Actb Rat tunicamycin decreases expression ISO ACTB (Homo sapiens) 6480464 Tunicamycin results in decreased expression of ACTB mRNA CTD PMID:29453283 Actb Rat uranium atom affects expression ISO ACTB (Homo sapiens) 6480464 Uranium affects the expression of ACTB mRNA and Uranium affects the expression of ACTB protein CTD PMID:15672453 Actb Rat valproic acid increases methylation ISO ACTB (Homo sapiens) 6480464 Valproic Acid results in increased methylation of ACTB gene CTD PMID:29154799 Actb Rat valproic acid increases expression ISO ACTB (Homo sapiens) 6480464 Valproic Acid results in increased expression of ACTB mRNA CTD PMID:23179753 and PMID:27188386 Actb Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of ACTB mRNA CTD PMID:23665938 Actb Rat vancomycin increases expression ISO Actb (Mus musculus) 6480464 Vancomycin results in increased expression of ACTB mRNA CTD PMID:18930951 Actb Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of ACTB mRNA CTD PMID:19015723 Actb Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of ACTB protein CTD PMID:20616205 Actb Rat vitamin E increases expression ISO ACTB (Homo sapiens) 6480464 Vitamin E results in increased expression of ACTB mRNA CTD PMID:19244175 Actb Rat warfarin increases expression ISO Actb (Mus musculus) 6480464 Warfarin results in increased expression of ACTB mRNA CTD PMID:20493250 Actb Rat warfarin decreases expression ISO Actb (Mus musculus) 6480464 Warfarin results in decreased expression of ACTB mRNA CTD PMID:20493250 Actb Rat zinc atom multiple interactions ISO Actb (Mus musculus) 6480464 [zinc chloride results in increased abundance of Zinc] which results in increased expression of ACTB mRNA CTD PMID:31588059 Actb Rat zinc dichloride multiple interactions ISO Actb (Mus musculus) 6480464 [zinc chloride results in increased abundance of Zinc] which results in increased expression of ACTB mRNA CTD PMID:31588059 Actb Rat zinc sulfate affects expression ISO ACTB (Homo sapiens) 6480464 Zinc Sulfate affects the expression of ACTB protein CTD PMID:25162517 Actb Rat zinc(0) multiple interactions ISO Actb (Mus musculus) 6480464 [zinc chloride results in increased abundance of Zinc] which results in increased expression of ACTB mRNA CTD PMID:31588059
Imported Annotations - KEGG (archival)
(+)-catechin (EXP) (+)-epicatechin-3-O-gallate (EXP) (+)-pilocarpine (ISO) (-)-epigallocatechin 3-gallate (ISO) (3,4-dihydroxyphenyl)acetic acid (EXP) (S)-amphetamine (ISO) (S)-nicotine (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,3-dimethoxynaphthalene-1,4-dione (ISO) 2,4,6-trinitrobenzenesulfonic acid (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2-amino-2-deoxy-D-galactopyranose (EXP) 2-methylcholine (ISO) 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-phenylprop-2-enal (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroperoxycyclophosphamide (ISO) 4-hydroxynon-2-enal (ISO) 4-vinylcyclohexene dioxide (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) abamectin (ISO) acetamide (EXP) acetic acid (ISO) acetylsalicylic acid (ISO) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) all-trans-retinol (EXP) alloxan (ISO) Allylamine (EXP) alpha-pinene (ISO) amitrole (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) Aroclor 1254 (EXP,ISO) arsane (EXP) arsenic atom (EXP) arsenite(3-) (ISO) arsenous acid (ISO) bathocuproine disulfonic acid (ISO) beauvericin (ISO) benzene (EXP) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) Brodifacoum (EXP) bromobenzene (EXP) bromochloroacetic acid (ISO) bufalin (ISO) buspirone (EXP) butan-1-ol (ISO) butanal (ISO) cadmium dichloride (ISO) caffeine (ISO) calcidiol (EXP) calcitriol (EXP) calcium atom (EXP) calcium(0) (EXP) carbon disulfide (EXP) carbon nanotube (ISO) ceftriaxone (EXP) chloromethylisothiazolinone (ISO) chloropicrin (ISO) cisplatin (ISO) clobetasol (ISO) clofibrate (EXP,ISO) clozapine (ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) coumarin (ISO) crocidolite asbestos (ISO) cyclophosphamide (EXP,ISO) cyclosporin A (ISO) cylindrospermopsin (ISO) D-glucose (ISO) DDE (ISO) DDT (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) dibenzo[a,l]pyrene (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dicrotophos (ISO) diethylstilbestrol (ISO) dioxygen (ISO) disodium selenite (ISO) diuron (ISO) dopamine (ISO) Doramectin (ISO) doxorubicin (EXP,ISO) elemental selenium (ISO) endosulfan (EXP,ISO) ethanol (EXP,ISO) Evodiamine (ISO) fenbuconazole (ISO) fenthion (ISO) fipronil (EXP) flutamide (EXP) FR900359 (ISO) furan (EXP) gamma-hexachlorocyclohexane (EXP) genistein (ISO) gentamycin (EXP) glucose (ISO) glyphosate (ISO) hyaluronic acid (EXP) hydrogen peroxide (EXP,ISO) indirubin-3'-monoxime (ISO) iodide salt (EXP) ionomycin (ISO) isoprenaline (ISO) ivermectin (ISO) lasalocid (ISO) latrunculin A (ISO) lead diacetate (ISO) lead(0) (ISO) lead(II) chloride (ISO) leflunomide (ISO) lipopolysaccharide (EXP) lithium atom (EXP) lithium hydride (EXP) lovastatin (ISO) manganese(II) chloride (ISO) melittin (ISO) mercury atom (EXP) mercury dichloride (ISO) mercury(0) (EXP) methamphetamine (EXP) methapyrilene (EXP) methidathion (ISO) methimazole (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) methylparaben (ISO) microcystin-LR (EXP,ISO) mifepristone (ISO) mono(2-ethyl-5-hydroxyhexyl) phthalate (ISO) mono(2-ethyl-5-oxohexyl) phthalate (ISO) mono(2-ethylhexyl) phthalate (ISO) mono(5-carboxy-2-ethylpentyl) phthalate (ISO) monobenzyl phthalate (ISO) Monobutylphthalate (ISO) monocrotaline (ISO) monoethyl phthalate (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-methyl-4-phenylpyridinium (ISO) N-methyl-N-nitrosourea (EXP) N-nitrosomorpholine (EXP) naphthalene (ISO) nickel atom (ISO) nickel dichloride (ISO) nicotine (ISO) nitrates (ISO) nitric oxide (ISO) nitroglycerin (EXP) Nonylphenol (EXP) ochratoxin A (ISO) ozone (EXP,ISO) p-menthan-3-ol (ISO) paracetamol (EXP,ISO) paraoxon (ISO) paraquat (ISO) perfluorobutyric acid (ISO) perfluorononanoic acid (ISO) perfluorooctanoic acid (EXP) phenethyl isothiocyanate (ISO) PhIP (EXP) phlorizin (ISO) phorbol 13-acetate 12-myristate (ISO) progesterone (ISO) propiconazole (ISO) pyrrolidine dithiocarbamate (ISO) quercetin (EXP,ISO) resveratrol (EXP) rotenone (EXP) S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO) selenium atom (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) simvastatin (EXP) sirolimus (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sodium fluoride (ISO) sulfadimethoxine (EXP) sulforaphane (ISO) T-2 toxin (EXP) tert-butyl hydroperoxide (ISO) tetrachloroethene (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP,ISO) thiram (ISO) titanium dioxide (ISO) triadimefon (ISO) trichloroethene (EXP,ISO) triphenyl phosphate (ISO) triphenylstannane (ISO) Triptolide (EXP) tris(2-butoxyethyl) phosphate (ISO) triticonazole (EXP) trovafloxacin (EXP) tunicamycin (ISO) uranium atom (ISO) valproic acid (EXP,ISO) vancomycin (ISO) vinclozolin (EXP) vitamin E (ISO) warfarin (ISO) zinc atom (ISO) zinc dichloride (ISO) zinc sulfate (ISO) zinc(0) (ISO)
Biological Process
adherens junction assembly (IEA,ISO) apical protein localization (IEA,ISO) axonogenesis (IBA,IDA) cell motility (IBA,IEA,ISO) cellular response to cytochalasin B (IEA,ISO) cellular response to electrical stimulus (IDA) circadian rhythm (IEP) cytoskeleton organization (IMP) establishment or maintenance of cell polarity (IEA,ISO) morphogenesis of a polarized epithelium (IEA,ISO) platelet aggregation (ISO) positive regulation of double-strand break repair via homologous recombination (IEA,ISO) postsynaptic actin cytoskeleton organization (IEA) protein localization to adherens junction (IEA,ISO) regulation of cell cycle (IEA,ISO) regulation of norepinephrine uptake (IEA,IGI,IMP,ISO) regulation of protein localization to plasma membrane (IEA,ISO) regulation of synaptic vesicle endocytosis (IEA,ISO) regulation of transepithelial transport (IEA,ISO) response to immobilization stress (IEP) response to mechanical stimulus (IEP) retina development in camera-type eye (IEP) substantia nigra development (ISO)
Cellular Component
actin cytoskeleton (IBA,IEA,ISO) actin filament (IBA) adherens junction (IEA,ISO) apical junction complex (IEA,ISO) axon (IBA,IDA) brush border (IEA,ISO) calyx of Held (IEA,ISO) cell-cell junction (IEA,ISO) cortical cytoskeleton (IEA,ISO) cytoplasm (IBA,IEA,ISO) cytoplasmic ribonucleoprotein granule (IEA,ISO) cytoskeleton (IDA,IEA,ISO,ISS) cytosol (IEA,ISO,TAS) dense body (ISS) focal adhesion (ISS) glutamatergic synapse (IBA,IEA,ISO) lamellipodium (IEA,ISO) membrane (IBA) membrane raft (IDA) NuA4 histone acetyltransferase complex (IBA,IEA,ISO) nucleosome (IEA,ISO) nucleus (IEA,ISO,ISS) plasma membrane (ISS) podosome (IDA) postsynaptic actin cytoskeleton (IEA,ISO) protein-containing complex (IDA,IEA,ISO) ribonucleoprotein complex (IEA,ISO) Schaffer collateral - CA1 synapse (IEA,ISO) stress fiber (IDA) synapse (IBA) tight junction (IEA,ISO)
Molecular Function
ATP binding (IEA) ATP hydrolysis activity (IEA,ISO) hydrolase activity (IEA) identical protein binding (IEA,ISO) kinesin binding (IEA,ISO) nitric-oxide synthase binding (IEA,ISO) nitric-oxide synthase regulator activity (IEA,ISO) nucleotide binding (IEA) protein binding (IPI,ISO) protein kinase binding (IBA,IEA,IPI,ISO) structural constituent of postsynaptic actin cytoskeleton (IBA,IEA,ISO) Tat protein binding (IEA,ISO) transporter regulator activity (IEA,ISO,ISS)
1.
Prevalence of chronic skin and musculoskeletal conditions. United States-1976.
Bonham GS Vital Health Stat 10 1978 Nov;(124):i-iv, 1-57.
2.
Diurnal variations of tumor necrosis factor alpha mRNA and alpha-tubulin mRNA in rat brain.
Bredow S, etal., Neuroimmunomodulation. 1997 Mar-Apr;4(2):84-90.
3.
Differential actin isoform reorganization in the contracting A7r5 cell.
Brown D, etal., Can J Physiol Pharmacol. 2006 Aug-Sep;84(8-9):867-75.
4.
Fer kinase/FerT and adherens junction dynamics in the testis: an in vitro and in vivo study.
Chen YM, etal., Biol Reprod. 2003 Aug;69(2):656-72. Epub 2003 Apr 16.
5.
Localization of a beta-actin messenger ribonucleoprotein complex with zipcode-binding protein modulates the density of dendritic filopodia and filopodial synapses.
Eom T, etal., J Neurosci 2003 Nov 12;23(32):10433-44.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
ATP-dependent chromatin remodeling: genetics, genomics and mechanisms.
Hargreaves DC and Crabtree GR, Cell Res. 2011 Mar;21(3):396-420. doi: 10.1038/cr.2011.32. Epub 2011 Mar 1.
8.
p39 activates cdk5 in neurons, and is associated with the actin cytoskeleton.
Humbert S, etal., J Cell Sci. 2000 Mar;113 ( Pt 6):975-83.
9.
Regulated interactions of the norepineprhine transporter by the actin and microtubule cytoskeletons.
Jeannotte AM and Sidhu A, J Neurochem. 2008 Jun;105(5):1668-82. doi: 10.1111/j.1471-4159.2008.05258.x. Epub 2008 Mar 3.
10.
[The role of immobilization stress and sertindole on the expression of APP, MAPK-1 and beta-actin genes in rat brain].
Kallman J, etal., Ideggyogy Sz. 2012 Nov 30;65(11-12):394-400.
11.
Reference genes for real-time PCR quantification of microRNAs and messenger RNAs in rat models of hepatotoxicity.
Lardizabal MN, etal., PLoS One. 2012;7(5):e36323. doi: 10.1371/journal.pone.0036323. Epub 2012 May 1.
12.
Proteomic characterisation of neuronal sphingolipid-cholesterol microdomains: role in plasminogen activation.
Ledesma MD, etal., Brain Res. 2003 Oct 10;987(1):107-16.
13.
Acrosome-specific gene AEP1: identification, characterization and roles in spermatogenesis.
Luk JM, etal., J Cell Physiol. 2006 Dec;209(3):755-66.
14.
Increased beta-actin and tubulin polymerization in regrowing axons: relationship to the conditioning lesion effect.
Lund LM, etal., Exp Neurol 2002 Dec;178(2):306-12.
15.
Protein carbonylation associated to high-fat, high-sucrose diet and its metabolic effects.
Mendez L, etal., J Nutr Biochem. 2014 Dec;25(12):1243-53. doi: 10.1016/j.jnutbio.2014.06.014. Epub 2014 Sep 6.
16.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
17.
Identification of a multiprotein "motor" complex binding to water channel aquaporin-2.
Noda Y, etal., Biochem Biophys Res Commun. 2005 May 20;330(4):1041-7.
18.
The nucleotide sequence of the rat cytoplasmic beta-actin gene.
Nudel U, etal., Nucleic Acids Res 1983 Mar 25;11(6):1759-71.
19.
Possible role of non-muscle alpha-actinins in muscle cell mechanosensitivity.
Ogneva IV, etal., PLoS One. 2014 Apr 29;9(4):e96395. doi: 10.1371/journal.pone.0096395. eCollection 2014.
20.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
21.
Evidence for the presence of smooth muscle alpha-actin within pericytes of the renal medulla.
Park F, etal., Am J Physiol 1997 Nov;273(5 Pt 2):R1742-8.
22.
Phospho-NHE3 forms membrane patches and interacts with beta-actin to sense and maintain constant direction during cell migration.
Perike S, etal., Exp Cell Res. 2014 May 15;324(1):13-29. doi: 10.1016/j.yexcr.2014.03.005. Epub 2014 Mar 19.
23.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
24.
GOA pipeline
RGD automated data pipeline
25.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
26.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
27.
Avoiding pitfalls of internal controls: validation of reference genes for analysis by qRT-PCR and Western blot throughout rat retinal development.
Rocha-Martins M, etal., PLoS One. 2012;7(8):e43028. doi: 10.1371/journal.pone.0043028. Epub 2012 Aug 20.
28.
Dynactin.
Schroer TA, Annu Rev Cell Dev Biol. 2004;20:759-79.
29.
Review series: The cell biology of hearing.
Schwander M, etal., J Cell Biol. 2010 Jul 12;190(1):9-20. doi: 10.1083/jcb.201001138.
30.
Irreversibly sickled cell beta-actin: defective filament formation.
Shartava A, etal., Am J Hematol. 1997 Jun;55(2):97-103.
31.
Identification and characterization of a G-protein regulatory motif in WAVE1.
Song KS, etal., FEBS Lett. 2006 Apr 3;580(8):1993-8. Epub 2006 Mar 6.
32.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
33.
Validation of reference genes for quantitative real-time PCR studies in the dentate gyrus after experimental febrile seizures.
Swijsen A, etal., BMC Res Notes. 2012 Dec 13;5:685. doi: 10.1186/1756-0500-5-685.
34.
Messenger RNA profiles in liver injury and stress: a comparison of lethal and nonlethal rat models.
Tygstrup N, etal., Biochem Biophys Res Commun 2002 Jan 11;290(1):518-25.
35.
The INO80 family of chromatin-remodeling enzymes: regulators of histone variant dynamics.
Watanabe S and Peterson CL, Cold Spring Harb Symp Quant Biol. 2010;75:35-42. doi: 10.1101/sqb.2010.75.063. Epub 2011 Apr 18.
36.
Kainate-induced seizures alter protein composition and N-methyl-D-aspartate receptor function of rat forebrain postsynaptic densities.
Wyneken U, etal., Neuroscience. 2001;102(1):65-74.
37.
Identification of SAA and ACTB as potential biomarker of patients with severe HFMD using iTRAQ quantitative proteomics.
Zhou F, etal., Clin Biochem. 2019 May;67:1-6. doi: 10.1016/j.clinbiochem.2019.02.011. Epub 2019 Feb 25.
Actb Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 16,776,664 - 16,779,634 (+) NCBI GRCr8 mRatBN7.2 12 11,663,112 - 11,666,697 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 11,663,109 - 11,672,877 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 12,473,135 - 12,476,105 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 13,096,401 - 13,099,371 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 12,127,796 - 12,130,766 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 13,715,843 - 13,718,813 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 13,715,843 - 13,718,841 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 15,745,856 - 15,749,440 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 12,047,070 - 12,050,040 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 12,076,997 - 12,079,967 (+) NCBI Celera 12 13,452,443 - 13,455,413 (+) NCBI Celera Cytogenetic Map 12 p11 NCBI
ACTB Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 5,527,148 - 5,530,601 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 5,526,409 - 5,563,902 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 5,566,779 - 5,570,232 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 5,533,312 - 5,536,747 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 5,340,026 - 5,343,462 NCBI Celera 7 5,526,560 - 5,530,009 (-) NCBI Celera Cytogenetic Map 7 p22.1 NCBI HuRef 7 5,479,343 - 5,482,774 (-) NCBI HuRef CHM1_1 7 5,566,362 - 5,569,815 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 5,644,671 - 5,648,124 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 5,613,124 - 5,616,577 (-) NCBI
Actb Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 142,888,870 - 142,892,509 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 142,888,870 - 142,892,509 (-) Ensembl GRCm39 Ensembl GRCm38 5 142,903,115 - 142,907,976 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 142,903,115 - 142,906,754 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 143,664,795 - 143,668,403 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 143,168,256 - 143,171,864 (-) NCBI MGSCv36 mm8 Celera 5 139,951,533 - 139,955,141 (-) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 81.8 NCBI
Actb Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955460 10,356,699 - 10,361,585 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955460 10,358,100 - 10,361,585 (-) NCBI ChiLan1.0 ChiLan1.0
ACTB Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 10,493,693 - 10,497,227 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 58,818,394 - 58,821,932 (-) NCBI NHGRI_mPanPan1
ACTB Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 12,421,006 - 12,424,449 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 12,418,932 - 12,462,845 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 13,893,047 - 13,896,436 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 12,557,673 - 12,561,075 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 12,557,667 - 12,561,086 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 12,367,765 - 12,371,152 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 12,301,595 - 12,304,986 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 12,578,988 - 12,582,384 (+) NCBI UU_Cfam_GSD_1.0
Actb
ACTB Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 4,082,216 - 4,090,356 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 4,084,275 - 4,090,383 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 4,729,278 - 4,732,693 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ACTB Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 28 16,195,676 - 16,197,161 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 52,426,752 - 52,427,879 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666090 5,777,528 - 5,781,244 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Actb
.
Predicted Target Of
Count of predictions: 65 Count of miRNA genes: 63 Interacting mature miRNAs: 64 Transcripts: ENSRNOT00000042459 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
2312418 Kidm41 Kidney mass QTL 41 3.7 0.0001 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 12 1 19611090 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 1331739 Hrtrt14 Heart rate QTL 14 3.56232 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 12 9318216 12829686 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 8525423 28064601 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 1331786 Kidm11 Kidney mass QTL 11 3.571 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 12 11073825 24234895 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 1600391 Edcs2 Endometrial carcinoma susceptibility QTL2 3.5 0.01 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 12 6833190 17870186 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 8449490 28302290 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1331755 Bp219 Blood pressure QTL 219 3.041 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 28064557 Rat
PMC101699P1
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 p11 UniSTS
PMC102156P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,071 - 11,665,291 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,803 - 13,718,022 NCBI Rnor6.0 Rnor_5.0 12 15,747,816 - 15,748,035 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,030 - 12,049,249 UniSTS RGSC3.4 Celera 12 13,454,403 - 13,454,622 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC104029P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 120,658,192 - 120,658,630 (+) MAPPER mRatBN7.2 mRatBN7.2 12 11,666,191 - 11,666,643 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,718,922 - 13,719,373 NCBI Rnor6.0 Rnor_6.0 5 125,373,190 - 125,373,627 NCBI Rnor6.0 Rnor_5.0 12 15,748,935 - 15,749,386 UniSTS Rnor5.0 Rnor_5.0 5 129,230,583 - 129,231,020 UniSTS Rnor5.0 RGSC_v3.4 5 126,881,227 - 126,881,664 UniSTS RGSC3.4 RGSC_v3.4 12 12,050,149 - 12,050,600 UniSTS RGSC3.4 Celera 12 13,455,522 - 13,455,973 UniSTS Celera 5 119,421,278 - 119,421,715 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC108483P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,577 - 11,666,050 (+) MAPPER mRatBN7.2 mRatBN7.2 5 120,658,748 - 120,659,098 (+) MAPPER mRatBN7.2 Rnor_6.0 5 125,373,746 - 125,374,095 NCBI Rnor6.0 Rnor_6.0 12 13,718,309 - 13,718,781 NCBI Rnor6.0 Rnor_5.0 12 15,748,322 - 15,748,794 UniSTS Rnor5.0 Rnor_5.0 5 129,231,139 - 129,231,488 UniSTS Rnor5.0 RGSC_v3.4 5 126,881,783 - 126,882,132 UniSTS RGSC3.4 RGSC_v3.4 12 12,049,536 - 12,050,008 UniSTS RGSC3.4 Celera 12 13,454,909 - 13,455,381 UniSTS Celera 5 119,421,834 - 119,422,183 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 5 q34 UniSTS
PMC109669P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,199 - 11,666,019 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,931 - 13,718,750 NCBI Rnor6.0 Rnor_5.0 12 15,747,944 - 15,748,763 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,158 - 12,049,977 UniSTS RGSC3.4 Celera 12 13,454,531 - 13,455,350 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 19 q12 UniSTS
PMC110672P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,125 - 11,665,642 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,857 - 13,718,373 NCBI Rnor6.0 Rnor_5.0 12 15,747,870 - 15,748,386 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,084 - 12,049,600 UniSTS RGSC3.4 Celera 12 13,454,457 - 13,454,973 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC114236P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,293 - 11,665,960 (+) MAPPER mRatBN7.2 mRatBN7.2 4 133,310,597 - 133,311,048 (+) MAPPER mRatBN7.2 Rnor_6.0 4 133,138,300 - 133,138,750 NCBI Rnor6.0 Rnor_6.0 12 13,718,025 - 13,718,691 NCBI Rnor6.0 Rnor_5.0 12 15,748,038 - 15,748,704 UniSTS Rnor5.0 Rnor_5.0 4 197,621,561 - 197,622,011 UniSTS Rnor5.0 RGSC_v3.4 4 135,576,684 - 135,577,134 UniSTS RGSC3.4 RGSC_v3.4 12 12,049,252 - 12,049,918 UniSTS RGSC3.4 Celera 12 13,454,625 - 13,455,291 UniSTS Celera 4 122,154,375 - 122,154,825 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 4 q34 UniSTS
PMC117781P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 120,658,755 - 120,659,098 (+) MAPPER mRatBN7.2 mRatBN7.2 12 11,665,577 - 11,666,043 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,718,309 - 13,718,774 NCBI Rnor6.0 Rnor_6.0 5 125,373,753 - 125,374,095 NCBI Rnor6.0 Rnor_5.0 12 15,748,322 - 15,748,787 UniSTS Rnor5.0 Rnor_5.0 5 129,231,146 - 129,231,488 UniSTS Rnor5.0 RGSC_v3.4 5 126,881,790 - 126,882,132 UniSTS RGSC3.4 RGSC_v3.4 12 12,049,536 - 12,050,001 UniSTS RGSC3.4 Celera 12 13,454,909 - 13,455,374 UniSTS Celera 5 119,421,841 - 119,422,183 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 5 q34 UniSTS
PMC125345P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,577 - 11,666,050 (+) MAPPER mRatBN7.2 mRatBN7.2 5 120,658,748 - 120,659,098 (+) MAPPER mRatBN7.2 Rnor_6.0 5 125,373,746 - 125,374,095 NCBI Rnor6.0 Rnor_6.0 12 13,718,309 - 13,718,781 NCBI Rnor6.0 Rnor_5.0 12 15,748,322 - 15,748,794 UniSTS Rnor5.0 Rnor_5.0 5 129,231,139 - 129,231,488 UniSTS Rnor5.0 RGSC_v3.4 5 126,881,783 - 126,882,132 UniSTS RGSC3.4 RGSC_v3.4 12 12,049,536 - 12,050,008 UniSTS RGSC3.4 Celera 12 13,454,909 - 13,455,381 UniSTS Celera 5 119,421,834 - 119,422,183 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 5 q34 UniSTS
PMC133829P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,577 - 11,666,050 (+) MAPPER mRatBN7.2 mRatBN7.2 5 120,658,748 - 120,659,098 (+) MAPPER mRatBN7.2 Rnor_6.0 5 125,373,746 - 125,374,095 NCBI Rnor6.0 Rnor_6.0 12 13,718,309 - 13,718,781 NCBI Rnor6.0 Rnor_5.0 12 15,748,322 - 15,748,794 UniSTS Rnor5.0 Rnor_5.0 5 129,231,139 - 129,231,488 UniSTS Rnor5.0 RGSC_v3.4 5 126,881,783 - 126,882,132 UniSTS RGSC3.4 RGSC_v3.4 12 12,049,536 - 12,050,008 UniSTS RGSC3.4 Celera 12 13,454,909 - 13,455,381 UniSTS Celera 5 119,421,834 - 119,422,183 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 5 q34 UniSTS
PMC136359P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,577 - 11,665,752 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,718,309 - 13,718,483 NCBI Rnor6.0 Rnor_5.0 12 15,748,322 - 15,748,496 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,536 - 12,049,710 UniSTS RGSC3.4 Celera 12 13,454,909 - 13,455,083 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC137548P2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,664,548 - 11,665,447 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,280 - 13,718,178 NCBI Rnor6.0 Rnor_5.0 12 15,747,293 - 15,748,191 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,507 - 12,049,405 UniSTS RGSC3.4 Celera 12 13,453,880 - 13,454,778 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC137792P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,664,381 - 11,665,083 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,113 - 13,717,814 NCBI Rnor6.0 Rnor_5.0 12 15,747,126 - 15,747,827 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,340 - 12,049,041 UniSTS RGSC3.4 Celera 12 13,453,713 - 13,454,414 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC138261P1
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 10 q32.3 UniSTS Cytogenetic Map 18 p12 UniSTS
PMC139793P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,629 - 11,666,050 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,718,361 - 13,718,781 NCBI Rnor6.0 Rnor_5.0 12 15,748,374 - 15,748,794 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,588 - 12,050,008 UniSTS RGSC3.4 Celera 12 13,454,961 - 13,455,381 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC148838P1
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 p11 UniSTS
PMC149351P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,664,544 - 11,665,406 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,276 - 13,718,137 NCBI Rnor6.0 Rnor_5.0 12 15,747,289 - 15,748,150 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,503 - 12,049,364 UniSTS RGSC3.4 Celera 12 13,453,876 - 13,454,737 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC151001P2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,956 - 11,666,081 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,718,688 - 13,718,812 NCBI Rnor6.0 Rnor_5.0 12 15,748,701 - 15,748,825 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,915 - 12,050,039 UniSTS RGSC3.4 Celera 12 13,455,288 - 13,455,412 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC152551P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 2,281,592 - 2,281,856 (+) MAPPER mRatBN7.2 mRatBN7.2 X 2,480,869 - 2,481,133 (-) MAPPER mRatBN7.2 mRatBN7.2 12 11,665,050 - 11,665,317 (+) MAPPER mRatBN7.2 Rnor_6.0 X 2,509,978 - 2,510,240 NCBI Rnor6.0 Rnor_6.0 12 13,717,782 - 13,718,048 NCBI Rnor6.0 Rnor_5.0 12 15,747,795 - 15,748,061 UniSTS Rnor5.0 Rnor_5.0 X 3,300,207 - 3,300,469 UniSTS Rnor5.0 Celera 12 13,454,382 - 13,454,648 UniSTS Celera X 3,004,715 - 3,004,978 UniSTS Cytogenetic Map X q12 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC154439P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,106 - 11,665,634 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,838 - 13,718,365 NCBI Rnor6.0 Rnor_5.0 12 15,747,851 - 15,748,378 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,065 - 12,049,592 UniSTS RGSC3.4 Celera 12 13,454,438 - 13,454,965 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC156330P1
Rat Assembly Chr Position (strand) Source JBrowse Celera 19 51,258,498 - 51,259,502 UniSTS Celera 12 13,454,501 - 13,455,354 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 18 p12 UniSTS Cytogenetic Map 19 q12 UniSTS Cytogenetic Map 10 q32.3 UniSTS
PMC180915P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,054 - 11,665,416 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,786 - 13,718,147 NCBI Rnor6.0 Rnor_5.0 12 15,747,799 - 15,748,160 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,013 - 12,049,374 UniSTS RGSC3.4 Celera 12 13,454,386 - 13,454,747 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC201106P1
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 10 q32.3 UniSTS Cytogenetic Map 19 q12 UniSTS Cytogenetic Map 18 p12 UniSTS
PMC20960P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,621 - 11,665,967 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,718,353 - 13,718,698 NCBI Rnor6.0 Rnor_5.0 12 15,748,366 - 15,748,711 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,580 - 12,049,925 UniSTS RGSC3.4 Celera 12 13,454,953 - 13,455,298 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 4 q34 UniSTS
PMC224995P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,048 - 11,665,633 (+) MAPPER mRatBN7.2 mRatBN7.2 X 36,181,420 - 36,181,912 (+) MAPPER mRatBN7.2 Rnor_6.0 X 38,953,005 - 38,953,496 NCBI Rnor6.0 Rnor_6.0 12 13,717,780 - 13,718,364 NCBI Rnor6.0 Rnor_5.0 12 15,747,793 - 15,748,377 UniSTS Rnor5.0 Rnor_5.0 X 39,259,421 - 39,259,912 UniSTS Rnor5.0 RGSC_v3.4 X 57,424,865 - 57,425,356 UniSTS RGSC3.4 RGSC_v3.4 12 12,049,007 - 12,049,591 UniSTS RGSC3.4 Celera 12 13,454,380 - 13,454,964 UniSTS Celera X 36,832,475 - 36,832,966 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC22644P1
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 10 q32.3 UniSTS Cytogenetic Map 18 p12 UniSTS
PMC23951P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,100 - 11,665,665 (+) MAPPER mRatBN7.2 mRatBN7.2 X 109,620,324 - 109,620,789 (+) MAPPER mRatBN7.2 Rnor_6.0 X 117,762,648 - 117,763,112 NCBI Rnor6.0 Rnor_6.0 12 13,717,832 - 13,718,396 NCBI Rnor6.0 Rnor_5.0 12 15,747,845 - 15,748,409 UniSTS Rnor5.0 Rnor_5.0 X 117,900,428 - 117,900,892 UniSTS Rnor5.0 RGSC_v3.4 X 32,374,387 - 32,374,851 UniSTS RGSC3.4 RGSC_v3.4 12 12,049,059 - 12,049,623 UniSTS RGSC3.4 Celera 12 13,454,432 - 13,454,996 UniSTS Celera X 108,989,586 - 108,990,050 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map X q14 UniSTS
PMC240671P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 120,658,784 - 120,659,043 (+) MAPPER mRatBN7.2 mRatBN7.2 12 11,665,632 - 11,666,014 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,718,364 - 13,718,745 NCBI Rnor6.0 Rnor_6.0 5 125,373,782 - 125,374,040 NCBI Rnor6.0 Rnor_5.0 12 15,748,377 - 15,748,758 UniSTS Rnor5.0 Rnor_5.0 5 129,231,175 - 129,231,433 UniSTS Rnor5.0 RGSC_v3.4 5 126,881,819 - 126,882,077 UniSTS RGSC3.4 RGSC_v3.4 12 12,049,591 - 12,049,972 UniSTS RGSC3.4 Celera 12 13,454,964 - 13,455,345 UniSTS Celera 5 119,421,870 - 119,422,128 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 5 q34 UniSTS
PMC26753P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,249 - 11,665,906 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,981 - 13,718,637 NCBI Rnor6.0 Rnor_5.0 12 15,747,994 - 15,748,650 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,208 - 12,049,864 UniSTS RGSC3.4 Celera 12 13,454,581 - 13,455,237 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC275467P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 2,281,592 - 2,281,843 (+) MAPPER mRatBN7.2 mRatBN7.2 X 2,480,882 - 2,481,133 (-) MAPPER mRatBN7.2 mRatBN7.2 12 11,665,063 - 11,665,317 (+) MAPPER mRatBN7.2 Rnor_6.0 X 2,509,978 - 2,510,227 NCBI Rnor6.0 Rnor_6.0 12 13,717,795 - 13,718,048 NCBI Rnor6.0 Rnor_5.0 12 15,747,808 - 15,748,061 UniSTS Rnor5.0 Rnor_5.0 X 3,300,207 - 3,300,456 UniSTS Rnor5.0 Celera 12 13,454,395 - 13,454,648 UniSTS Celera X 3,004,728 - 3,004,978 UniSTS Cytogenetic Map X q12 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC302066P1
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 10 q32.3 UniSTS Cytogenetic Map 18 p12 UniSTS
PMC304100P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,664,998 - 11,665,119 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,730 - 13,717,850 NCBI Rnor6.0 Rnor_5.0 12 15,747,743 - 15,747,863 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,957 - 12,049,077 UniSTS RGSC3.4 Celera 12 13,454,330 - 13,454,450 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC340938P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,393 - 11,665,642 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,718,125 - 13,718,373 NCBI Rnor6.0 Rnor_5.0 12 15,748,138 - 15,748,386 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,352 - 12,049,600 UniSTS RGSC3.4 Celera 12 13,454,725 - 13,454,973 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC85361P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,052 - 11,665,409 (+) MAPPER mRatBN7.2 mRatBN7.2 X 109,620,276 - 109,620,627 (+) MAPPER mRatBN7.2 Rnor_6.0 X 117,762,600 - 117,762,950 NCBI Rnor6.0 Rnor_6.0 12 13,717,784 - 13,718,140 NCBI Rnor6.0 Rnor_5.0 12 15,747,797 - 15,748,153 UniSTS Rnor5.0 Rnor_5.0 X 117,900,380 - 117,900,730 UniSTS Rnor5.0 RGSC_v3.4 X 32,374,549 - 32,374,899 UniSTS RGSC3.4 RGSC_v3.4 12 12,049,011 - 12,049,367 UniSTS RGSC3.4 Celera 12 13,454,384 - 13,454,740 UniSTS Celera X 108,989,538 - 108,989,888 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map X q14 UniSTS
PMC96811P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,087 - 11,665,738 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,819 - 13,718,469 NCBI Rnor6.0 Rnor_5.0 12 15,747,832 - 15,748,482 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,046 - 12,049,696 UniSTS RGSC3.4 Celera 12 13,454,419 - 13,455,069 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC97568P1
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 10 q32.3 UniSTS Cytogenetic Map 18 p12 UniSTS
PMC98352P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,197 - 11,665,992 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,929 - 13,718,723 NCBI Rnor6.0 Rnor_5.0 12 15,747,942 - 15,748,736 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,156 - 12,049,950 UniSTS RGSC3.4 Celera 12 13,454,529 - 13,455,323 UniSTS Cytogenetic Map 12 p11 UniSTS
Actb-rs1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,660 - 11,666,072 (+) MAPPER mRatBN7.2 mRatBN7.2 5 120,658,727 - 120,659,015 (+) MAPPER mRatBN7.2 Rnor_6.0 5 125,373,725 - 125,374,012 NCBI Rnor6.0 Rnor_6.0 12 13,718,392 - 13,718,803 NCBI Rnor6.0 Rnor_5.0 12 15,748,405 - 15,748,816 UniSTS Rnor5.0 Rnor_5.0 5 129,231,118 - 129,231,405 UniSTS Rnor5.0 RGSC_v3.4 5 126,881,762 - 126,882,049 UniSTS RGSC3.4 RGSC_v3.4 12 12,049,619 - 12,050,030 UniSTS RGSC3.4 Celera 12 13,454,992 - 13,455,403 UniSTS Celera 5 119,421,813 - 119,422,100 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 5 q34 UniSTS
PMC122623P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 120,658,789 - 120,658,908 (+) MAPPER mRatBN7.2 mRatBN7.2 12 11,665,887 - 11,666,009 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,718,619 - 13,718,740 NCBI Rnor6.0 Rnor_6.0 5 125,373,787 - 125,373,905 NCBI Rnor6.0 Rnor_5.0 12 15,748,632 - 15,748,753 UniSTS Rnor5.0 Rnor_5.0 5 129,231,180 - 129,231,298 UniSTS Rnor5.0 RGSC_v3.4 5 126,881,824 - 126,881,942 UniSTS RGSC3.4 RGSC_v3.4 12 12,049,846 - 12,049,967 UniSTS RGSC3.4 Celera 12 13,455,219 - 13,455,340 UniSTS Celera 5 119,421,875 - 119,421,993 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 5 q34 UniSTS
PMC125678P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,664,548 - 11,665,097 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,280 - 13,717,828 NCBI Rnor6.0 Rnor_5.0 12 15,747,293 - 15,747,841 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,507 - 12,049,055 UniSTS RGSC3.4 Celera 12 13,453,880 - 13,454,428 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC133768P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,205 - 11,665,364 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,937 - 13,718,095 NCBI Rnor6.0 Rnor_5.0 12 15,747,950 - 15,748,108 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,164 - 12,049,322 UniSTS RGSC3.4 Celera 12 13,454,537 - 13,454,695 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 19 q12 UniSTS
PMC138011P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,360 - 11,666,006 (+) MAPPER mRatBN7.2 mRatBN7.2 5 120,658,792 - 120,659,225 (+) MAPPER mRatBN7.2 Rnor_6.0 5 125,373,790 - 125,374,222 NCBI Rnor6.0 Rnor_6.0 12 13,718,092 - 13,718,737 NCBI Rnor6.0 Rnor_5.0 12 15,748,105 - 15,748,750 UniSTS Rnor5.0 Rnor_5.0 5 129,231,183 - 129,231,615 UniSTS Rnor5.0 RGSC_v3.4 5 126,881,827 - 126,882,259 UniSTS RGSC3.4 RGSC_v3.4 12 12,049,319 - 12,049,964 UniSTS RGSC3.4 Celera 12 13,454,692 - 13,455,337 UniSTS Celera 5 119,421,878 - 119,422,310 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 5 q34 UniSTS
PMC145386P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,582 - 11,666,047 (+) MAPPER mRatBN7.2 mRatBN7.2 5 120,658,751 - 120,659,093 (+) MAPPER mRatBN7.2 Rnor_6.0 5 125,373,749 - 125,374,090 NCBI Rnor6.0 Rnor_6.0 12 13,718,314 - 13,718,778 NCBI Rnor6.0 Rnor_5.0 12 15,748,327 - 15,748,791 UniSTS Rnor5.0 Rnor_5.0 5 129,231,142 - 129,231,483 UniSTS Rnor5.0 RGSC_v3.4 5 126,881,786 - 126,882,127 UniSTS RGSC3.4 RGSC_v3.4 12 12,049,541 - 12,050,005 UniSTS RGSC3.4 Celera 12 13,454,914 - 13,455,378 UniSTS Celera 5 119,421,837 - 119,422,178 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 5 q34 UniSTS
PMC150974P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,202 - 11,666,036 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,934 - 13,718,767 NCBI Rnor6.0 Rnor_5.0 12 15,747,947 - 15,748,780 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,161 - 12,049,994 UniSTS RGSC3.4 RGSC_v3.4 X 13,700,285 - 13,700,891 UniSTS RGSC3.4 Celera 12 13,454,534 - 13,455,367 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map X q12 UniSTS
PMC151804P4
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,081 - 11,665,185 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,813 - 13,717,916 NCBI Rnor6.0 Rnor_5.0 12 15,747,826 - 15,747,929 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,040 - 12,049,143 UniSTS RGSC3.4 Celera 12 13,454,413 - 13,454,516 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC153958P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,639 - 11,666,112 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,718,371 - 13,718,843 NCBI Rnor6.0 Rnor_5.0 12 15,748,384 - 15,748,856 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,598 - 12,050,070 UniSTS RGSC3.4 Celera 12 13,454,971 - 13,455,444 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC156124P2
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 10 q32.3 UniSTS Cytogenetic Map 19 q12 UniSTS Cytogenetic Map 18 p12 UniSTS
PMC18465P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,664,230 - 11,664,560 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,716,962 - 13,717,291 NCBI Rnor6.0 Rnor_5.0 12 15,746,975 - 15,747,304 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,189 - 12,048,518 UniSTS RGSC3.4 Celera 12 13,453,562 - 13,453,891 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC19354P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 120,658,752 - 120,659,095 (+) MAPPER mRatBN7.2 mRatBN7.2 12 11,665,580 - 11,666,046 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,718,312 - 13,718,777 NCBI Rnor6.0 Rnor_6.0 5 125,373,750 - 125,374,092 NCBI Rnor6.0 Rnor_5.0 12 15,748,325 - 15,748,790 UniSTS Rnor5.0 Rnor_5.0 5 129,231,143 - 129,231,485 UniSTS Rnor5.0 RGSC_v3.4 5 126,881,787 - 126,882,129 UniSTS RGSC3.4 RGSC_v3.4 12 12,049,539 - 12,050,004 UniSTS RGSC3.4 Celera 12 13,454,912 - 13,455,377 UniSTS Celera 5 119,421,838 - 119,422,180 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 5 q34 UniSTS
PMC207566P4
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,664,129 - 11,664,366 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,716,861 - 13,717,097 NCBI Rnor6.0 Rnor_5.0 12 15,746,874 - 15,747,110 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,088 - 12,048,324 UniSTS RGSC3.4 Celera 12 13,453,461 - 13,453,697 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC21334P2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,666,216 - 11,666,669 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,718,947 - 13,719,399 NCBI Rnor6.0 Rnor_5.0 12 15,748,960 - 15,749,412 UniSTS Rnor5.0 RGSC_v3.4 12 12,050,174 - 12,050,626 UniSTS RGSC3.4 Celera 12 13,455,547 - 13,455,999 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC84911P1
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 p11 UniSTS
PMC102052P1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 12 16,778,994 - 16,779,568 (+) Marker Load Pipeline mRatBN7.2 12 11,665,442 - 11,666,016 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,718,174 - 13,718,747 NCBI Rnor6.0 Rnor_5.0 12 15,748,187 - 15,748,760 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,401 - 12,049,974 UniSTS RGSC3.4 Celera 12 13,454,774 - 13,455,347 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC107891P1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 12 16,777,893 - 16,778,873 (+) Marker Load Pipeline mRatBN7.2 12 11,664,341 - 11,665,321 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,073 - 13,718,052 NCBI Rnor6.0 Rnor_5.0 12 15,747,086 - 15,748,065 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,300 - 12,049,279 UniSTS RGSC3.4 Celera 12 13,453,673 - 13,454,652 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC115141P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,047 - 11,665,365 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,779 - 13,718,096 NCBI Rnor6.0 Rnor_5.0 12 15,747,792 - 15,748,109 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,006 - 12,049,323 UniSTS RGSC3.4 Celera 12 13,454,379 - 13,454,696 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC117352P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,664,336 - 11,664,496 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,068 - 13,717,227 NCBI Rnor6.0 Rnor_5.0 12 15,747,081 - 15,747,240 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,295 - 12,048,454 UniSTS RGSC3.4 Celera 12 13,453,668 - 13,453,827 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC117780P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,163 - 11,665,718 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,895 - 13,718,449 NCBI Rnor6.0 Rnor_5.0 12 15,747,908 - 15,748,462 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,122 - 12,049,676 UniSTS RGSC3.4 Celera 12 13,454,495 - 13,455,049 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC122924P2
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 12 16,777,684 - 16,778,676 (+) Marker Load Pipeline mRatBN7.2 12 11,664,132 - 11,665,124 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,716,864 - 13,717,855 NCBI Rnor6.0 Rnor_5.0 12 15,746,877 - 15,747,868 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,091 - 12,049,082 UniSTS RGSC3.4 Celera 12 13,453,464 - 13,454,455 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC133998P8
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,664,403 - 11,665,406 (+) MAPPER mRatBN7.2 mRatBN7.2 19 51,884,568 - 51,885,392 (+) MAPPER mRatBN7.2 Rnor_6.0 19 56,674,928 - 56,675,751 NCBI Rnor6.0 Rnor_6.0 12 13,717,135 - 13,718,137 NCBI Rnor6.0 Rnor_5.0 19 67,390,755 - 67,391,578 UniSTS Rnor5.0 Rnor_5.0 12 15,747,148 - 15,748,150 UniSTS Rnor5.0 RGSC_v3.4 19 54,082,352 - 54,083,175 UniSTS RGSC3.4 RGSC_v3.4 12 12,048,362 - 12,049,364 UniSTS RGSC3.4 Celera 12 13,453,735 - 13,454,737 UniSTS Celera 19 51,259,168 - 51,259,991 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 19 q12 UniSTS
PMC187403P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,121 - 11,665,341 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,853 - 13,718,072 NCBI Rnor6.0 Rnor_5.0 12 15,747,866 - 15,748,085 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,080 - 12,049,299 UniSTS RGSC3.4 Celera 12 13,454,453 - 13,454,672 UniSTS Cytogenetic Map 12 p11 UniSTS
LOC345651
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,664,470 - 11,665,066 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,202 - 13,717,797 NCBI Rnor6.0 Rnor_5.0 12 15,747,215 - 15,747,810 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,429 - 12,049,024 UniSTS RGSC3.4 Celera 12 13,453,802 - 13,454,397 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 19 q12 UniSTS Cytogenetic Map 3 q35 UniSTS
mActb
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,666,024 - 11,666,464 (+) MAPPER mRatBN7.2 mRatBN7.2 5 120,658,368 - 120,658,774 (+) MAPPER mRatBN7.2 Rnor_6.0 5 125,373,366 - 125,373,771 NCBI Rnor6.0 Rnor_6.0 12 13,718,756 - 13,719,194 NCBI Rnor6.0 Rnor_5.0 12 15,748,769 - 15,749,207 UniSTS Rnor5.0 Rnor_5.0 5 129,230,759 - 129,231,164 UniSTS Rnor5.0 RGSC_v3.4 5 126,881,403 - 126,881,808 UniSTS RGSC3.4 RGSC_v3.4 12 12,049,983 - 12,050,421 UniSTS RGSC3.4 Celera 12 13,455,356 - 13,455,794 UniSTS Celera 5 119,421,454 - 119,421,859 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 5 q34 UniSTS
PMC209527P1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 12 16,777,911 - 16,778,877 (+) Marker Load Pipeline mRatBN7.2 12 11,664,359 - 11,665,325 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,091 - 13,718,056 NCBI Rnor6.0 Rnor_5.0 12 15,747,104 - 15,748,069 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,318 - 12,049,283 UniSTS RGSC3.4 Celera 12 13,453,691 - 13,454,656 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 19 q12 UniSTS
PMC21071P1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 12 16,779,168 - 16,779,577 (+) Marker Load Pipeline mRatBN7.2 12 11,665,616 - 11,666,025 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,718,348 - 13,718,756 NCBI Rnor6.0 Rnor_5.0 12 15,748,361 - 15,748,769 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,575 - 12,049,983 UniSTS RGSC3.4 Celera 12 13,454,948 - 13,455,356 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC212730P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,726 - 11,665,925 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,718,458 - 13,718,656 NCBI Rnor6.0 Rnor_5.0 12 15,748,471 - 15,748,669 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,685 - 12,049,883 UniSTS RGSC3.4 Celera 12 13,455,058 - 13,455,256 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC24644P4
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 12 16,777,782 - 16,778,112 (+) Marker Load Pipeline mRatBN7.2 12 11,664,230 - 11,664,560 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,716,962 - 13,717,291 NCBI Rnor6.0 Rnor_5.0 12 15,746,975 - 15,747,304 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,189 - 12,048,518 UniSTS RGSC3.4 Celera 12 13,453,562 - 13,453,891 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC30411P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,664,159 - 11,664,567 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,716,891 - 13,717,298 NCBI Rnor6.0 Rnor_5.0 12 15,746,904 - 15,747,311 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,118 - 12,048,525 UniSTS RGSC3.4 Celera 12 13,453,491 - 13,453,898 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC33181P2
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 12 16,779,134 - 16,779,573 (+) Marker Load Pipeline mRatBN7.2 12 11,665,582 - 11,666,021 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,718,314 - 13,718,752 NCBI Rnor6.0 Rnor_5.0 12 15,748,327 - 15,748,765 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,541 - 12,049,979 UniSTS RGSC3.4 Celera 12 13,454,914 - 13,455,352 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC33279P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,664,386 - 11,665,312 (+) MAPPER mRatBN7.2 mRatBN7.2 4 133,310,167 - 133,310,617 (+) MAPPER mRatBN7.2 Rnor_6.0 4 133,137,870 - 133,138,319 NCBI Rnor6.0 Rnor_6.0 12 13,717,118 - 13,718,043 NCBI Rnor6.0 Rnor_5.0 12 15,747,131 - 15,748,056 UniSTS Rnor5.0 Rnor_5.0 4 197,621,131 - 197,621,580 UniSTS Rnor5.0 RGSC_v3.4 4 135,576,254 - 135,576,703 UniSTS RGSC3.4 RGSC_v3.4 12 12,048,345 - 12,049,270 UniSTS RGSC3.4 Celera 12 13,453,718 - 13,454,643 UniSTS Celera 4 122,153,945 - 122,154,394 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 4 q34 UniSTS
PMC350549P3
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,664,472 - 11,665,092 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,204 - 13,717,823 NCBI Rnor6.0 Rnor_5.0 12 15,747,217 - 15,747,836 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,431 - 12,049,050 UniSTS RGSC3.4 Celera 12 13,453,804 - 13,454,423 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC356969P12
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,664,471 - 11,665,267 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,203 - 13,717,998 NCBI Rnor6.0 Rnor_5.0 12 15,747,216 - 15,748,011 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,430 - 12,049,225 UniSTS RGSC3.4 RGSC_v3.4 X 13,904,156 - 13,904,483 UniSTS RGSC3.4 Celera 12 13,453,803 - 13,454,598 UniSTS Celera X 3,004,603 - 3,004,930 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map X q12 UniSTS
PMC37512P3
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,071 - 11,665,321 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,803 - 13,718,052 NCBI Rnor6.0 Rnor_5.0 12 15,747,816 - 15,748,065 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,030 - 12,049,279 UniSTS RGSC3.4 Celera 12 13,454,403 - 13,454,652 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC86032P2
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 12 16,777,966 - 16,778,876 (+) Marker Load Pipeline mRatBN7.2 12 11,664,414 - 11,665,324 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,146 - 13,718,055 NCBI Rnor6.0 Rnor_5.0 12 15,747,159 - 15,748,068 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,373 - 12,049,282 UniSTS RGSC3.4 Celera 12 13,453,746 - 13,454,655 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC87052P1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 12 16,778,931 - 16,779,578 (+) Marker Load Pipeline mRatBN7.2 12 11,665,379 - 11,666,026 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,718,111 - 13,718,757 NCBI Rnor6.0 Rnor_5.0 12 15,748,124 - 15,748,770 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,338 - 12,049,984 UniSTS RGSC3.4 Celera 12 13,454,711 - 13,455,357 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 19 q12 UniSTS
PMC97445P1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 12 16,777,684 - 16,778,677 (+) Marker Load Pipeline mRatBN7.2 12 11,664,132 - 11,665,125 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,716,864 - 13,717,856 NCBI Rnor6.0 Rnor_5.0 12 15,746,877 - 15,747,869 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,091 - 12,049,083 UniSTS RGSC3.4 Celera 12 13,453,464 - 13,454,456 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC99880P2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,050 - 11,665,368 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,782 - 13,718,099 NCBI Rnor6.0 Rnor_5.0 12 15,747,795 - 15,748,112 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,009 - 12,049,326 UniSTS RGSC3.4 Celera 12 13,454,382 - 13,454,699 UniSTS Cytogenetic Map 12 p11 UniSTS
Actb
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 2,281,288 - 2,281,798 (+) MAPPER mRatBN7.2 mRatBN7.2 X 2,480,927 - 2,481,437 (-) MAPPER mRatBN7.2 Rnor_6.0 X 2,509,674 - 2,510,182 NCBI Rnor6.0 Rnor_5.0 X 3,299,903 - 3,300,411 UniSTS Rnor5.0 RGSC_v3.4 X 13,700,476 - 13,700,985 UniSTS RGSC3.4 Celera 12 13,453,754 - 13,454,454 UniSTS Cytogenetic Map X q12 UniSTS Cytogenetic Map 12 p11 UniSTS
aa658676
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 12 16,779,499 - 16,779,786 (+) Marker Load Pipeline mRatBN7.2 12 11,665,947 - 11,666,235 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,718,679 - 13,718,965 NCBI Rnor6.0 Rnor_5.0 12 15,748,692 - 15,748,978 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,906 - 12,050,192 UniSTS RGSC3.4 Celera 12 13,455,279 - 13,455,565 UniSTS Cytogenetic Map 12 p11 UniSTS
Actb
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 12 16,777,974 - 16,778,675 (+) Marker Load Pipeline mRatBN7.2 12 11,664,422 - 11,665,123 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,154 - 13,717,854 NCBI Rnor6.0 Rnor_5.0 12 15,747,167 - 15,747,867 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,381 - 12,049,081 UniSTS RGSC3.4 Celera 12 13,453,754 - 13,454,454 UniSTS Cytogenetic Map 12 p11 UniSTS
PMC85795P4
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 2,281,589 - 2,282,085 (+) MAPPER mRatBN7.2 mRatBN7.2 X 2,480,640 - 2,481,136 (-) MAPPER mRatBN7.2 mRatBN7.2 12 11,664,354 - 11,665,320 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,086 - 13,718,051 NCBI Rnor6.0 Rnor_6.0 X 2,509,975 - 2,510,469 NCBI Rnor6.0 Rnor_5.0 X 3,300,204 - 3,300,698 UniSTS Rnor5.0 Rnor_5.0 12 15,747,099 - 15,748,064 UniSTS Rnor5.0 Celera 12 13,453,686 - 13,454,651 UniSTS Celera X 3,004,486 - 3,004,981 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map X q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000042459 ⟹ ENSRNOP00000044296
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 11,664,123 - 11,666,694 (+) Ensembl Rnor_6.0 Ensembl 12 13,715,843 - 13,718,812 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000080216 ⟹ ENSRNOP00000072672
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 11,663,867 - 11,672,877 (+) Ensembl Rnor_6.0 Ensembl 12 13,716,596 - 13,718,841 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000105242 ⟹ ENSRNOP00000088195
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 11,663,109 - 11,672,877 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000116486 ⟹ ENSRNOP00000083381
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 11,664,130 - 11,672,877 (+) Ensembl
RefSeq Acc Id:
NM_031144 ⟹ NP_112406
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 16,776,664 - 16,779,634 (+) NCBI mRatBN7.2 12 11,663,112 - 11,666,082 (+) NCBI Rnor_6.0 12 13,715,843 - 13,718,813 (+) NCBI Rnor_5.0 12 15,745,856 - 15,749,440 (+) NCBI RGSC_v3.4 12 12,047,070 - 12,050,040 (+) RGD Celera 12 13,452,443 - 13,455,413 (+) RGD
Sequence:
GTCGAGTCCGCGTCCACCCGCGAGTACAACCTTCTTGCAGCTCCTCCGTCGCCGGTCCACACCCGCCACCAGTTCGCCATGGATGACGATATCGCTGCGCTCGTCGTCGACAACGGCTCCGGCATGTG
hide sequence
RefSeq Acc Id:
NP_112406 ⟸ NM_031144
- UniProtKB:
P60711 (UniProtKB/Swiss-Prot), A6K1N6 (UniProtKB/TrEMBL), A0A8L2QLX4 (UniProtKB/TrEMBL)
- Sequence:
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN
hide sequence
Ensembl Acc Id:
ENSRNOP00000072672 ⟸ ENSRNOT00000080216
Ensembl Acc Id:
ENSRNOP00000044296 ⟸ ENSRNOT00000042459
Ensembl Acc Id:
ENSRNOP00000083381 ⟸ ENSRNOT00000116486
Ensembl Acc Id:
ENSRNOP00000088195 ⟸ ENSRNOT00000105242
RGD ID: 13698446 Promoter ID: EPDNEW_R8971 Type: multiple initiation site Name: Actb_1 Description: actin, beta SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 13,715,840 - 13,715,900 EPDNEW
RGD ID: 6849468 Promoter ID: EP07062 Type: single initiation site Name: RN_ACTB Description: beta-actin. SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Notes: homology_group=Homology group 19; Mammalian, avian beta-actin. Tissues & Cell Lines: housekeeping gene Experiment Methods: Nuclease protection with homologous sequence ladder Position: No map positions available.
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-12-14
Actb
actin, beta
Symbol and Name status set to approved
1299863 APPROVED
2003-02-27
Actb
actin, beta
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
ubiquitously expressed in all eukaryotic cells
724707
gene_process
actins are highly conserved proteins that are involved in various types of cell motility
724707
