Symbol:
Usp15
Name:
ubiquitin specific peptidase 15
RGD ID:
628795
Description:
Enables cysteine-type deubiquitinase activity. Involved in protein deubiquitination. Located in cytoplasm and nucleus. Orthologous to human USP15 (ubiquitin specific peptidase 15); PARTICIPATES IN mitochondrial autophagy pathway; INTERACTS WITH 2,6-dinitrotoluene; 6-propyl-2-thiouracil; acrylamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
deubiquitinating enzyme 15; deubiquitinating enzyme Ubp109; ubiquitin carboxyl-terminal hydrolase 15; ubiquitin carboxyl-terminal hydrolase of 109 kDa; ubiquitin specific protease 15; ubiquitin thioesterase 15; ubiquitin-specific-processing protease 15; Ubp109
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 60,643,611 - 60,805,137 (-) NCBI GRCr8 mRatBN7.2 7 58,756,714 - 58,848,778 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 58,756,872 - 58,848,721 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 60,630,453 - 60,720,966 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 62,833,103 - 62,923,616 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 62,610,431 - 62,700,867 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 66,595,707 - 66,687,707 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 66,595,742 - 66,687,278 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 66,793,539 - 66,885,533 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 62,871,167 - 62,961,405 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 62,891,896 - 62,982,135 (-) NCBI Celera 7 55,929,201 - 56,019,813 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Usp15 Rat 1,2-dimethylhydrazine multiple interactions ISO Usp15 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of USP15 mRNA CTD PMID:22206623 Usp15 Rat 1-nitropyrene increases expression ISO USP15 (Homo sapiens) 6480464 1-nitropyrene results in increased expression of USP15 mRNA CTD PMID:19041380 Usp15 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO USP15 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Usp15 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Usp15 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of USP15 mRNA CTD PMID:21570461 Usp15 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Usp15 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of USP15 mRNA CTD PMID:15034205 Usp15 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Usp15 (Mus musculus) 6480464 AHR protein inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of USP15 mRNA] CTD PMID:15034205 Usp15 Rat 2,4,6-tribromophenol increases expression ISO USP15 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Usp15 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of USP15 mRNA CTD PMID:21346803 Usp15 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO USP15 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of USP15 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of USP15 mRNA CTD PMID:28628672 Usp15 Rat 4,4'-diaminodiphenylmethane affects expression ISO Usp15 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of USP15 mRNA CTD PMID:18648102 Usp15 Rat 4-hydroxyphenyl retinamide decreases expression ISO Usp15 (Mus musculus) 6480464 Fenretinide results in decreased expression of USP15 mRNA CTD PMID:28973697 Usp15 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of USP15 mRNA CTD PMID:30047161 Usp15 Rat acetohydrazide decreases expression ISO Usp15 (Mus musculus) 6480464 acetylhydrazine results in decreased expression of USP15 mRNA CTD PMID:15282401 Usp15 Rat acetylsalicylic acid increases expression ISO USP15 (Homo sapiens) 6480464 Aspirin results in increased expression of USP15 mRNA CTD PMID:11906190 Usp15 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of USP15 mRNA CTD PMID:28959563 Usp15 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of USP15 mRNA CTD PMID:28959563 Usp15 Rat aflatoxin B1 increases methylation ISO USP15 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of USP15 intron CTD PMID:30157460 Usp15 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of USP15 mRNA CTD PMID:30047161 Usp15 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of USP15 mRNA CTD PMID:16483693 Usp15 Rat antirheumatic drug decreases expression ISO USP15 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of USP15 mRNA CTD PMID:24449571 Usp15 Rat aristolochic acid A decreases expression ISO USP15 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of USP15 mRNA CTD PMID:33212167 Usp15 Rat arsenite(3-) increases expression ISO Usp15 (Mus musculus) 6480464 arsenite results in increased expression of USP15 protein CTD PMID:37955338 Usp15 Rat benzo[a]pyrene decreases expression ISO Usp15 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of USP15 mRNA CTD PMID:17942131 Usp15 Rat benzo[a]pyrene increases expression ISO USP15 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of USP15 protein CTD PMID:33278487 Usp15 Rat benzo[a]pyrene increases expression ISO Usp15 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of USP15 mRNA CTD PMID:15034205 Usp15 Rat benzo[a]pyrene multiple interactions ISO Usp15 (Mus musculus) 6480464 AHR protein inhibits the reaction [Benzo(a)pyrene results in increased expression of USP15 mRNA] CTD PMID:15034205 Usp15 Rat benzo[e]pyrene increases methylation ISO USP15 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of USP15 intron CTD PMID:30157460 Usp15 Rat beta-endorphin increases expression ISO USP15 (Homo sapiens) 6480464 beta-Endorphin results in increased expression of USP15 mRNA CTD PMID:24068670 Usp15 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of USP15 mRNA CTD PMID:25181051 Usp15 Rat bisphenol A increases expression ISO USP15 (Homo sapiens) 6480464 bisphenol A results in increased expression of USP15 protein CTD PMID:34186270 Usp15 Rat bisphenol A decreases expression ISO Usp15 (Mus musculus) 6480464 bisphenol A results in decreased expression of USP15 mRNA CTD PMID:33221593 Usp15 Rat bisphenol A affects methylation ISO USP15 (Homo sapiens) 6480464 bisphenol A affects the methylation of USP15 gene CTD PMID:33391824 Usp15 Rat bisphenol A multiple interactions ISO USP15 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of USP15 mRNA CTD PMID:28628672 Usp15 Rat bisphenol F multiple interactions ISO USP15 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of USP15 mRNA CTD PMID:28628672 Usp15 Rat butanal decreases expression ISO USP15 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of USP15 mRNA CTD PMID:26079696 Usp15 Rat cadmium dichloride increases expression ISO USP15 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of USP15 protein CTD PMID:24527689 Usp15 Rat caffeine decreases phosphorylation ISO USP15 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of USP15 protein CTD PMID:35688186 Usp15 Rat calcium atom multiple interactions ISO USP15 (Homo sapiens) 6480464 Calcium affects the reaction [Morphine results in increased expression of USP15 mRNA] CTD PMID:24068670 Usp15 Rat calcium(0) multiple interactions ISO USP15 (Homo sapiens) 6480464 Calcium affects the reaction [Morphine results in increased expression of USP15 mRNA] CTD PMID:24068670 Usp15 Rat chlorpyrifos decreases expression ISO Usp15 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of USP15 mRNA CTD PMID:37019170 Usp15 Rat choline multiple interactions ISO Usp15 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of USP15 mRNA CTD PMID:20938992 Usp15 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of USP15 mRNA CTD PMID:24386269 Usp15 Rat cobalt dichloride increases expression ISO USP15 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of USP15 mRNA CTD PMID:19376846 Usp15 Rat crocidolite asbestos decreases expression ISO Usp15 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of USP15 mRNA CTD PMID:29279043 Usp15 Rat CU-O LINKAGE increases expression ISO USP15 (Homo sapiens) 6480464 cupric oxide results in increased expression of USP15 mRNA CTD PMID:22077320 Usp15 Rat cyclosporin A decreases expression ISO Usp15 (Mus musculus) 6480464 Cyclosporine results in decreased expression of USP15 mRNA CTD PMID:17942131 Usp15 Rat decabromodiphenyl ether increases expression ISO USP15 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of USP15 protein CTD PMID:31675489 Usp15 Rat deoxynivalenol increases expression ISO USP15 (Homo sapiens) 6480464 deoxynivalenol results in increased expression of USP15 mRNA CTD PMID:22846391 Usp15 Rat dexamethasone multiple interactions ISO USP15 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of USP15 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of USP15 mRNA CTD PMID:28628672 Usp15 Rat Dibutyl phosphate affects expression ISO USP15 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of USP15 mRNA CTD PMID:37042841 Usp15 Rat dicrotophos decreases expression ISO USP15 (Homo sapiens) 6480464 dicrotophos results in decreased expression of USP15 mRNA CTD PMID:28302478 Usp15 Rat dioxygen decreases expression ISO USP15 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of USP15 mRNA CTD PMID:17175027 Usp15 Rat dioxygen multiple interactions ISO Usp15 (Mus musculus) 6480464 Oxygen inhibits the reaction [Oxygen deficiency results in increased expression of USP15 mRNA] CTD PMID:22629407 Usp15 Rat dioxygen increases expression ISO Usp15 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of USP15 mRNA CTD PMID:22629407 Usp15 Rat dorsomorphin multiple interactions ISO USP15 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Usp15 Rat enzyme inhibitor multiple interactions ISO USP15 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of USP15 protein CTD PMID:23301498 Usp15 Rat ethanol affects splicing ISO Usp15 (Mus musculus) 6480464 Ethanol affects the splicing of USP15 mRNA CTD PMID:30319688 Usp15 Rat ethyl methanesulfonate increases expression ISO USP15 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of USP15 mRNA CTD PMID:23649840 Usp15 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of USP15 mRNA CTD PMID:18035473 Usp15 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of USP15 mRNA CTD PMID:24136188 Usp15 Rat folic acid multiple interactions ISO Usp15 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Usp15 Rat folic acid decreases expression ISO Usp15 (Mus musculus) 6480464 Folic Acid results in decreased expression of USP15 mRNA CTD PMID:25629700 Usp15 Rat formaldehyde increases expression ISO USP15 (Homo sapiens) 6480464 Formaldehyde results in increased expression of USP15 mRNA CTD PMID:23649840 Usp15 Rat FR900359 affects phosphorylation ISO USP15 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of USP15 protein CTD PMID:37730182 Usp15 Rat fumonisin B1 decreases expression ISO Usp15 (Mus musculus) 6480464 fumonisin B1 results in decreased expression of USP15 mRNA CTD PMID:16221962 Usp15 Rat genistein increases expression ISO Usp15 (Mus musculus) 6480464 Genistein results in increased expression of USP15 mRNA CTD PMID:32186404 Usp15 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of USP15 mRNA CTD PMID:33387578 Usp15 Rat gold atom decreases expression ISO USP15 (Homo sapiens) 6480464 Gold results in decreased expression of USP15 mRNA CTD PMID:25523186 Usp15 Rat gold(0) decreases expression ISO USP15 (Homo sapiens) 6480464 Gold results in decreased expression of USP15 mRNA CTD PMID:25523186 Usp15 Rat hypochlorous acid increases expression ISO Usp15 (Mus musculus) 6480464 Hypochlorous Acid results in increased expression of USP15 mRNA CTD PMID:19376150 Usp15 Rat indometacin multiple interactions ISO USP15 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of USP15 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of USP15 mRNA CTD PMID:28628672 Usp15 Rat ivermectin decreases expression ISO USP15 (Homo sapiens) 6480464 Ivermectin results in decreased expression of USP15 protein CTD PMID:32959892 Usp15 Rat L-methionine multiple interactions ISO Usp15 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of USP15 mRNA CTD PMID:20938992 Usp15 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of USP15 mRNA CTD PMID:24136188 Usp15 Rat manganese atom decreases expression ISO USP15 (Homo sapiens) 6480464 Manganese results in decreased expression of USP15 mRNA CTD PMID:17175027 Usp15 Rat manganese(0) decreases expression ISO USP15 (Homo sapiens) 6480464 Manganese results in decreased expression of USP15 mRNA CTD PMID:17175027 Usp15 Rat manganese(II) chloride decreases expression ISO USP15 (Homo sapiens) 6480464 manganese chloride results in decreased expression of USP15 mRNA CTD PMID:17175027 Usp15 Rat methapyrilene increases methylation ISO USP15 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of USP15 intron CTD PMID:30157460 Usp15 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of USP15 mRNA CTD PMID:30047161 Usp15 Rat methotrexate decreases expression ISO USP15 (Homo sapiens) 6480464 Methotrexate results in decreased expression of USP15 mRNA CTD PMID:24449571 Usp15 Rat methyl methanesulfonate increases expression ISO USP15 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of USP15 mRNA CTD PMID:23649840 Usp15 Rat morphine multiple interactions ISO USP15 (Homo sapiens) 6480464 Calcium affects the reaction [Morphine results in increased expression of USP15 mRNA] more ... CTD PMID:24068670 Usp15 Rat morphine increases expression ISO USP15 (Homo sapiens) 6480464 Morphine results in increased expression of USP15 mRNA and Morphine results in increased expression of USP15 protein CTD PMID:24068670 Usp15 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions EXP 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [NFE2L2 protein inhibits the reaction [Streptozocin results in increased expression of USP15 protein]] CTD PMID:35478295 Usp15 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of USP15 mRNA CTD PMID:25729387 Usp15 Rat paracetamol decreases expression ISO Usp15 (Mus musculus) 6480464 Acetaminophen results in decreased expression of USP15 mRNA CTD PMID:17942131 Usp15 Rat perfluorooctane-1-sulfonic acid decreases expression ISO USP15 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of USP15 mRNA CTD PMID:27153767 Usp15 Rat phenylmercury acetate increases expression ISO USP15 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of USP15 mRNA CTD PMID:26272509 Usp15 Rat phenylmercury acetate multiple interactions ISO USP15 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of USP15 mRNA CTD PMID:27188386 Usp15 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of USP15 protein CTD PMID:35544339 Usp15 Rat SB 431542 multiple interactions ISO USP15 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Usp15 Rat silicon dioxide increases methylation ISO USP15 (Homo sapiens) 6480464 Silicon Dioxide results in increased methylation of USP15 gene and Silicon Dioxide results in increased methylation of USP15 promoter CTD PMID:34973136 Usp15 Rat streptozocin multiple interactions EXP 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [NFE2L2 protein inhibits the reaction [Streptozocin results in increased expression of USP15 protein]] more ... CTD PMID:35478295 Usp15 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of USP15 mRNA and Streptozocin results in increased expression of USP15 protein CTD PMID:35478295 Usp15 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of USP15 mRNA CTD PMID:34492290 Usp15 Rat titanium dioxide decreases methylation ISO Usp15 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of USP15 promoter CTD PMID:35295148 Usp15 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of USP15 mRNA CTD PMID:25729387 Usp15 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of USP15 mRNA CTD PMID:25729387 Usp15 Rat Tributyltin oxide decreases expression ISO Usp15 (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in decreased expression of USP15 mRNA CTD PMID:17942131 Usp15 Rat trichostatin A increases expression ISO USP15 (Homo sapiens) 6480464 trichostatin A results in increased expression of USP15 mRNA CTD PMID:24935251 Usp15 Rat trimellitic anhydride increases expression ISO Usp15 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of USP15 mRNA CTD PMID:19042947 Usp15 Rat triphenyl phosphate affects expression ISO USP15 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of USP15 mRNA CTD PMID:37042841 Usp15 Rat tungsten decreases expression ISO Usp15 (Mus musculus) 6480464 Tungsten results in decreased expression of USP15 mRNA CTD PMID:30912803 Usp15 Rat valproic acid increases methylation ISO USP15 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of USP15 gene CTD PMID:29154799 Usp15 Rat valproic acid multiple interactions ISO USP15 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of USP15 mRNA CTD PMID:27188386 Usp15 Rat valproic acid increases expression ISO USP15 (Homo sapiens) 6480464 Valproic Acid results in increased expression of USP15 mRNA CTD PMID:19101580 more ... Usp15 Rat valproic acid affects expression ISO USP15 (Homo sapiens) 6480464 Valproic Acid affects the expression of USP15 mRNA CTD PMID:25979313 Usp15 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of USP15 mRNA CTD PMID:23034163 Usp15 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of USP15 gene CTD PMID:31682807
1,2-dimethylhydrazine (ISO) 1-nitropyrene (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (ISO) 2,6-dinitrotoluene (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetohydrazide (ISO) acetylsalicylic acid (ISO) acrylamide (EXP) aflatoxin B1 (ISO) amitrole (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) beta-endorphin (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) cadmium dichloride (ISO) caffeine (ISO) calcium atom (ISO) calcium(0) (ISO) chlorpyrifos (ISO) choline (ISO) cobalt dichloride (EXP,ISO) crocidolite asbestos (ISO) CU-O LINKAGE (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) deoxynivalenol (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) dioxygen (ISO) dorsomorphin (ISO) enzyme inhibitor (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) flavonoids (EXP) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) fumonisin B1 (ISO) genistein (ISO) gentamycin (EXP) gold atom (ISO) gold(0) (ISO) hypochlorous acid (ISO) indometacin (ISO) ivermectin (ISO) L-methionine (ISO) leflunomide (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) methimazole (EXP) methotrexate (ISO) methyl methanesulfonate (ISO) morphine (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (EXP) oxaliplatin (EXP) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenylmercury acetate (ISO) rotenone (EXP) SB 431542 (ISO) silicon dioxide (ISO) streptozocin (EXP) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) Tributyltin oxide (ISO) trichostatin A (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) tungsten (ISO) valproic acid (ISO) vinclozolin (EXP)
Biological Process
BMP signaling pathway (IEA,ISO,ISS) monoubiquitinated protein deubiquitination (IEA,ISO,ISS) negative regulation of antifungal innate immune response (IEA,ISO,ISS) negative regulation of transforming growth factor beta receptor signaling pathway (IEA,ISO,ISS) positive regulation of RIG-I signaling pathway (IEA,ISO) protein deubiquitination (IDA,IEA,ISO) protein K27-linked deubiquitination (IEA,ISO,ISS) proteolysis (IEA) regulation of intrinsic apoptotic signaling pathway in response to osmotic stress by p53 class mediator (IEA,ISO) regulation of RNA metabolic process (IEA,ISO) transcription elongation-coupled chromatin remodeling (IBA,IEA,ISO,ISS) transforming growth factor beta receptor signaling pathway (IEA,ISO)
Molecular Function
catalytic activity (IEA) cysteine-type deubiquitinase activity (IDA,IEA,ISO) cysteine-type endopeptidase activity (IEA,ISO,ISS) cysteine-type peptidase activity (IEA) deubiquitinase activity (IEA,ISO) hydrolase activity (IEA) identical protein binding (IEA,ISO) K48-linked deubiquitinase activity (IEA,ISO) peptidase activity (IEA) protein binding (ISO) SMAD binding (IEA,ISO) transforming growth factor beta receptor binding (IEA,ISO) ubiquitin-modified histone reader activity (IEA,ISO)
1.
The three 'P's of mitophagy: PARKIN, PINK1, and post-translational modifications.
Durcan TM and Fon EA, Genes Dev. 2015 May 15;29(10):989-99. doi: 10.1101/gad.262758.115.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
De-regulated STAT5A/miR-202-5p/USP15/Caspase-6 regulatory axis suppresses CML cell apoptosis and contributes to Imatinib resistance.
Nie ZY, etal., J Exp Clin Cancer Res. 2020 Jan 17;39(1):17. doi: 10.1186/s13046-019-1502-7.
6.
Tissue-specificity, functional characterization and subcellular localization of a rat ubiquitin-specific processing protease, UBP109, whose mRNA expression is developmentally regulated.
Park KC, etal., Biochem J 2000 Jul 15;349(Pt 2):443-53.
7.
GOA pipeline
RGD automated data pipeline
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Usp15 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 60,643,611 - 60,805,137 (-) NCBI GRCr8 mRatBN7.2 7 58,756,714 - 58,848,778 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 58,756,872 - 58,848,721 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 60,630,453 - 60,720,966 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 62,833,103 - 62,923,616 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 62,610,431 - 62,700,867 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 66,595,707 - 66,687,707 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 66,595,742 - 66,687,278 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 66,793,539 - 66,885,533 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 62,871,167 - 62,961,405 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 62,891,896 - 62,982,135 (-) NCBI Celera 7 55,929,201 - 56,019,813 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
USP15 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 62,260,404 - 62,416,389 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 62,260,338 - 62,417,431 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 62,654,185 - 62,810,169 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 60,940,454 - 61,086,165 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 60,940,453 - 61,086,165 NCBI Celera 12 62,323,221 - 62,468,927 (+) NCBI Celera Cytogenetic Map 12 q14.1 NCBI HuRef 12 59,705,057 - 59,854,661 (+) NCBI HuRef CHM1_1 12 62,622,031 - 62,771,333 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 62,239,218 - 62,395,185 (+) NCBI T2T-CHM13v2.0
Usp15 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 122,940,911 - 123,032,924 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 122,940,911 - 123,032,900 (-) Ensembl GRCm39 Ensembl GRCm38 10 123,105,006 - 123,197,281 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 123,105,006 - 123,196,995 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 122,550,300 - 122,633,979 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 122,516,304 - 122,599,983 (-) NCBI MGSCv36 mm8 Celera 10 125,493,807 - 125,579,763 (-) NCBI Celera Cytogenetic Map 10 D2 NCBI cM Map 10 72.31 NCBI
Usp15 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955458 9,403,097 - 9,533,653 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955458 9,440,645 - 9,533,653 (+) NCBI ChiLan1.0 ChiLan1.0
USP15 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 31,944,328 - 32,090,448 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 31,937,511 - 32,086,939 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 26,533,441 - 26,682,964 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 26,808,337 - 26,954,099 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 26,808,337 - 26,954,099 (-) Ensembl panpan1.1 panPan2
USP15 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 5,510,759 - 5,634,954 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 5,510,022 - 5,634,202 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 5,502,702 - 5,627,025 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 5,544,390 - 5,667,454 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 5,544,428 - 5,668,750 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 5,485,628 - 5,610,126 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 5,734,844 - 5,859,330 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 5,874,448 - 5,998,972 (+) NCBI UU_Cfam_GSD_1.0
Usp15 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 53,015,395 - 53,131,801 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936545 978,280 - 1,095,659 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936545 978,318 - 1,094,729 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
USP15 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 26,964,553 - 27,097,444 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 26,964,380 - 27,082,549 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 29,580,789 - 29,800,904 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
USP15 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 58,154,905 - 58,300,431 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 58,154,919 - 58,300,522 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 187,509,595 - 187,654,699 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Usp15
.
Predicted Target Of
Count of predictions: 100 Count of miRNA genes: 86 Interacting mature miRNAs: 89 Transcripts: ENSRNOT00000031191 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 2293667 Bss42 Bone structure and strength QTL 42 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 7 47651439 92651439 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 10059605 Kidm47 Kidney mass QTL 47 2.91 0.05 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 47251783 65728867 Rat 2293678 Bss24 Bone structure and strength QTL 24 6.71 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 7 47651439 92651439 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 631513 Scl7 Serum cholesterol level QTL 7 4.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 37960569 82960569 Rat 2293685 Bmd21 Bone mineral density QTL 21 4.2 0.0003 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 7 47651439 92651439 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 10755451 Coatc11 Coat color QTL 11 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 17944357 62944357 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2317059 Aia15 Adjuvant induced arthritis QTL 15 2.46 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 17004598 62004598 Rat 2293696 Bmd32 Bone mineral density QTL 32 5.1 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 7 47651439 92651439 Rat 7411605 Foco14 Food consumption QTL 14 24.1 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 34293282 79293282 Rat 1300151 Bp181 Blood pressure QTL 181 3.36 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 7 53612714 103945643 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 631534 Lnnr1 Liver neoplastic nodule remodeling QTL 1 3.85 0.001 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 7 34293282 79293282 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 2293707 Bss32 Bone structure and strength QTL 32 7.64 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 47651439 92651439 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2293644 Bmd29 Bone mineral density QTL 29 5.4 0.0001 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 7 47651439 92651439 Rat 70190 Mcs6 Mammary carcinoma susceptibility QTL 6 2.29 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 26737401 63902784 Rat 2300178 Bmd54 Bone mineral density QTL 54 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 7 47651439 92651439 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat 738033 Anxrr6 Anxiety related response QTL 6 4.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 7 15573889 60573889 Rat 61435 Cia4 Collagen induced arthritis QTL 4 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 7 58113224 62004598 Rat
RH131414
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 58,758,323 - 58,758,425 (-) MAPPER mRatBN7.2 Rnor_6.0 7 66,685,996 - 66,686,097 NCBI Rnor6.0 Rnor_5.0 7 66,883,822 - 66,883,923 UniSTS Rnor5.0 RH 3.4 Map 7 503.7 UniSTS Cytogenetic Map 7 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000031191 ⟹ ENSRNOP00000034485
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 58,756,872 - 58,848,700 (-) Ensembl Rnor_6.0 Ensembl 7 66,595,742 - 66,686,198 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000079410 ⟹ ENSRNOP00000071983
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 58,757,067 - 58,848,721 (-) Ensembl Rnor_6.0 Ensembl 7 66,624,512 - 66,687,278 (+) Ensembl
RefSeq Acc Id:
NM_145184 ⟹ NP_660185
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 60,643,613 - 60,734,099 (-) NCBI mRatBN7.2 7 58,758,223 - 58,848,721 (-) NCBI Rnor_6.0 7 66,595,742 - 66,686,198 (+) NCBI Rnor_5.0 7 66,793,539 - 66,885,533 (+) NCBI RGSC_v3.4 7 62,871,167 - 62,961,405 (-) RGD Celera 7 55,929,201 - 56,019,813 (-) RGD
Sequence:
GTCGCTGCCGCCTCCGCTACCGCTAGTGGAAGAAGATGGCGGAAGGCGGAGCGGCGGACCTGGACACCCAGCGTTCTGACATCGCGACGCTGCTCAAAACCTCGCTCCGGAAAGGGGACACCTGGTAT
hide sequence
RefSeq Acc Id:
XM_006241431 ⟹ XP_006241493
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 60,643,611 - 60,735,305 (-) NCBI mRatBN7.2 7 58,756,714 - 58,848,778 (-) NCBI Rnor_6.0 7 66,595,711 - 66,687,707 (+) NCBI Rnor_5.0 7 66,793,539 - 66,885,533 (+) NCBI
Sequence:
TTCCCACAATGCTCCGGGGCGTGCCGCCGCCGTCGCTGCCGCCTCCGCTACCGCTAGTGGAAGA
hide sequence
RefSeq Acc Id:
XM_008765376 ⟹ XP_008763598
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 60,643,611 - 60,709,300 (-) NCBI mRatBN7.2 7 58,756,714 - 58,823,442 (-) NCBI Rnor_6.0 7 66,620,530 - 66,687,707 (+) NCBI
Sequence:
TACTCTGCCTCCCAAATACTGAACATTAAGATCTCCAGTGGAGGGGGGCTTGCTTCAGCTACTT
hide sequence
RefSeq Acc Id:
XM_039078350 ⟹ XP_038934278
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 60,643,611 - 60,684,187 (-) NCBI mRatBN7.2 7 58,756,714 - 58,798,800 (-) NCBI
RefSeq Acc Id:
XM_039078351 ⟹ XP_038934279
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 60,643,611 - 60,708,034 (-) NCBI mRatBN7.2 7 58,756,714 - 58,822,656 (-) NCBI
RefSeq Acc Id:
XM_039078353 ⟹ XP_038934281
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 60,643,611 - 60,670,346 (-) NCBI mRatBN7.2 7 58,756,714 - 58,784,959 (-) NCBI
RefSeq Acc Id:
XM_063262953 ⟹ XP_063119023
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 60,643,611 - 60,805,137 (-) NCBI
RefSeq Acc Id:
XM_063262954 ⟹ XP_063119024
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 60,653,027 - 60,734,172 (-) NCBI
RefSeq Acc Id:
XM_063262955 ⟹ XP_063119025
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 60,653,029 - 60,734,167 (-) NCBI
RefSeq Acc Id:
XM_063262956 ⟹ XP_063119026
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 60,643,611 - 60,708,034 (-) NCBI
RefSeq Acc Id:
XM_063262957 ⟹ XP_063119027
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 60,689,660 - 60,735,305 (-) NCBI
RefSeq Acc Id:
XM_063262958 ⟹ XP_063119028
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 60,689,660 - 60,735,305 (-) NCBI
RefSeq Acc Id:
XR_010052935
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 60,662,405 - 60,735,956 (-) NCBI
RefSeq Acc Id:
XR_010052936
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 60,662,405 - 60,735,305 (-) NCBI
RefSeq Acc Id:
XR_010052937
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 60,662,405 - 60,735,305 (-) NCBI
RefSeq Acc Id:
XR_010052938
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 60,662,405 - 60,735,305 (-) NCBI
RefSeq Acc Id:
XR_010052939
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 60,674,796 - 60,735,305 (-) NCBI
RefSeq Acc Id:
NP_660185 ⟸ NM_145184
- UniProtKB:
Q9R085 (UniProtKB/Swiss-Prot), E9PSP9 (UniProtKB/Swiss-Prot), A0A0G2K1U1 (UniProtKB/TrEMBL), A6HQN8 (UniProtKB/TrEMBL)
- Sequence:
MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCK
hide sequence
RefSeq Acc Id:
XP_006241493 ⟸ XM_006241431
- Peptide Label:
isoform X1
- Sequence:
MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGP
hide sequence
RefSeq Acc Id:
XP_008763598 ⟸ XM_008765376
- Peptide Label:
isoform X4
- UniProtKB:
Q9R085 (UniProtKB/Swiss-Prot), E9PSP9 (UniProtKB/Swiss-Prot)
- Sequence:
MFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFNIPDEKEARLWNKYMS
hide sequence
Ensembl Acc Id:
ENSRNOP00000071983 ⟸ ENSRNOT00000079410
Ensembl Acc Id:
ENSRNOP00000034485 ⟸ ENSRNOT00000031191
RefSeq Acc Id:
XP_038934279 ⟸ XM_039078351
- Peptide Label:
isoform X8
RefSeq Acc Id:
XP_038934278 ⟸ XM_039078350
- Peptide Label:
isoform X7
- UniProtKB:
A6HQP0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038934281 ⟸ XM_039078353
- Peptide Label:
isoform X9
RefSeq Acc Id:
XP_063119023 ⟸ XM_063262953
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063119026 ⟸ XM_063262956
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_063119024 ⟸ XM_063262954
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063119025 ⟸ XM_063262955
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063119028 ⟸ XM_063262958
- Peptide Label:
isoform X11
RefSeq Acc Id:
XP_063119027 ⟸ XM_063262957
- Peptide Label:
isoform X10
RGD ID: 13695238 Promoter ID: EPDNEW_R5762 Type: initiation region Name: Usp15_1 Description: ubiquitin specific peptidase 15 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 66,595,766 - 66,595,826 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Usp15
ubiquitin specific peptidase 15
ubiquitin specific protease 15
Name updated
1299863 APPROVED
2004-02-26
Usp15
ubiquitin specific protease 15
Symbol and Name status set to approved
625702 APPROVED
2003-02-27
Usp15
ubiquitin specific protease 15
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
expression is developmentally regulated in liver, spinal cord and brain
634484
