Symbol:
Ptk2b
Name:
protein tyrosine kinase 2 beta
RGD ID:
628758
Description:
Enables several functions, including enzyme binding activity; neurotransmitter receptor regulator activity; and protein kinase activity. Involved in several processes, including modulation of chemical synaptic transmission; negative regulation of apoptotic process; and positive regulation of metabolic process. Located in several cellular components, including apical dendrite; focal adhesion; and postsynaptic density. Part of NMDA selective glutamate receptor complex. Is active in Schaffer collateral - CA1 synapse; glutamatergic synapse; and postsynaptic density, intracellular component. Used to study brain ischemia; diabetic angiopathy; and nephritis. Biomarker of anti-basement membrane glomerulonephritis; hypertension; and status epilepticus. Human ortholog(s) of this gene implicated in breast cancer and hypertension. Orthologous to human PTK2B (protein tyrosine kinase 2 beta); PARTICIPATES IN Jak-Stat signaling pathway; Rho/Rac/Cdc42 mediated signaling pathway; the extracellular signal-regulated Raf/Mek/Erk signaling pathway; INTERACTS WITH (+)-pilocarpine; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
CADTK; CAK beta; CAK-beta; CAKB; CAKbeta; calcium-dependent tyrosine kinase; calcium-regulated non-receptor proline-rich tyrosine kinase; cell adhesion kinase beta; FADK 2; focal adhesion kinase 2; MGC124628; proline-rich tyrosine kinase 2; protein-tyrosine kinase 2-beta; PTK2 protein tyrosine kinase 2 beta; PTK2B protein tyrosine kinase 2 beta; Pyk2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PTK2B (protein tyrosine kinase 2 beta) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ptk2b (PTK2 protein tyrosine kinase 2 beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ptk2b (protein tyrosine kinase 2 beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PTK2B (protein tyrosine kinase 2 beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PTK2B (protein tyrosine kinase 2 beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ptk2b (protein tyrosine kinase 2 beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PTK2B (protein tyrosine kinase 2 beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PTK2B (protein tyrosine kinase 2 beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ptk2b (protein tyrosine kinase 2 beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SPMAP2L (sperm microtubule associated protein 2 like) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Ptk2b (PTK2 protein tyrosine kinase 2 beta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PTK2B (protein tyrosine kinase 2 beta)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ptk2bb (protein tyrosine kinase 2 beta, b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ptk2ba (protein tyrosine kinase 2 beta, a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
kin-32
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Fak
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ptk2b
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
Ptk2bem1Mcwi
Genetic Models:
SS-Ptk2bem1Mcwi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 44,536,275 - 44,656,754 (-) NCBI GRCr8 mRatBN7.2 15 40,360,722 - 40,481,235 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 40,360,723 - 40,481,282 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 42,228,028 - 42,348,822 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 43,378,225 - 43,499,021 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 41,821,037 - 41,941,390 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 42,827,306 - 42,947,796 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 42,827,310 - 42,947,656 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 48,646,476 - 48,766,708 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 45,589,222 - 45,717,866 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 45,604,992 - 45,733,824 (-) NCBI Celera 15 40,034,001 - 40,153,993 (-) NCBI Celera Cytogenetic Map 15 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ptk2b Rat (+)-pilocarpine multiple interactions EXP 6480464 [Lithium co-treated with Pilocarpine] results in increased activity of PTK2B protein CTD PMID:16600505 Ptk2b Rat (1->4)-beta-D-glucan multiple interactions ISO Ptk2b (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PTK2B mRNA CTD PMID:36331819 Ptk2b Rat (S)-colchicine multiple interactions ISO PTK2B (Homo sapiens) 6480464 2-cyclopentyl-5-(5-isoquinolylsulfonyl)-6-nitro-1H-benzo(D)imidazole inhibits the reaction [Colchicine results in increased phosphorylation of PTK2B protein] CTD PMID:11478917 Ptk2b Rat (S)-colchicine increases phosphorylation ISO PTK2B (Homo sapiens) 6480464 Colchicine results in increased phosphorylation of PTK2B protein CTD PMID:11478917 Ptk2b Rat 1,2-dimethylhydrazine multiple interactions ISO Ptk2b (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of PTK2B mRNA CTD PMID:22206623 Ptk2b Rat 1,2-dimethylhydrazine increases expression ISO Ptk2b (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PTK2B mRNA CTD PMID:22206623 Ptk2b Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of PTK2B mRNA CTD PMID:30723492 Ptk2b Rat 1-octadec-9-enoylglycero-3-phosphate increases phosphorylation ISO Ptk2b (Mus musculus) 6480464 lysophosphatidic acid results in increased phosphorylation of PTK2B protein CTD PMID:11792571 Ptk2b Rat 17beta-estradiol multiple interactions ISO Ptk2b (Mus musculus) 6480464 Estradiol affects the reaction [PTK2B protein affects the expression of COL1A1 mRNA] more ... CTD PMID:29428397 Ptk2b Rat 17beta-estradiol decreases expression ISO Ptk2b (Mus musculus) 6480464 Estradiol results in decreased expression of PTK2B mRNA CTD PMID:39298647 Ptk2b Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Ptk2b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Ptk2b Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Ptk2b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Ptk2b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PTK2B mRNA CTD PMID:22298810 and PMID:34747641 Ptk2b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PTK2B mRNA CTD PMID:32109520 Ptk2b Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Ptk2b Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PTK2B mRNA CTD PMID:21346803 Ptk2b Rat 2-butoxyethanol decreases expression ISO Ptk2b (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of PTK2B mRNA CTD PMID:19812364 Ptk2b Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Ptk2b Rat 4,4'-diaminodiphenylmethane increases expression ISO Ptk2b (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of PTK2B mRNA CTD PMID:18648102 Ptk2b Rat 4,4'-sulfonyldiphenol increases expression ISO Ptk2b (Mus musculus) 6480464 bisphenol S results in increased expression of PTK2B mRNA CTD PMID:30951980 Ptk2b Rat 4,4'-sulfonyldiphenol affects methylation ISO PTK2B (Homo sapiens) 6480464 bisphenol S affects the methylation of PTK2B gene CTD PMID:31601247 Ptk2b Rat 4,4'-sulfonyldiphenol decreases expression ISO Ptk2b (Mus musculus) 6480464 bisphenol S results in decreased expression of PTK2B mRNA CTD PMID:39298647 Ptk2b Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PTK2B mRNA CTD PMID:22504374 Ptk2b Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione multiple interactions ISO PTK2B (Homo sapiens) 6480464 Apigenin inhibits the reaction [Uric Acid results in increased phosphorylation of PTK2B protein] CTD PMID:29960001 Ptk2b Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione increases phosphorylation ISO PTK2B (Homo sapiens) 6480464 Uric Acid results in increased phosphorylation of PTK2B protein CTD PMID:29960001 Ptk2b Rat 7-ketocholesterol multiple interactions ISO PTK2B (Homo sapiens) 6480464 7-ketocholesterol results in increased phosphorylation of and results in increased activity of PTK2B protein CTD PMID:15955068 Ptk2b Rat [2,8-bis(trifluoromethyl)quinolin-4-yl]-(2-piperidyl)methanol increases response to substance EXP 6480464 PTK2B protein results in increased susceptibility to Mefloquine CTD PMID:21241737 Ptk2b Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of PTK2B mRNA CTD PMID:31881176 Ptk2b Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of PTK2B mRNA CTD PMID:28959563 Ptk2b Rat acrylamide increases phosphorylation ISO PTK2B (Homo sapiens) 6480464 Acrylamide results in increased phosphorylation of PTK2B protein CTD PMID:11478917 Ptk2b Rat acrylamide multiple interactions ISO PTK2B (Homo sapiens) 6480464 2-cyclopentyl-5-(5-isoquinolylsulfonyl)-6-nitro-1H-benzo(D)imidazole inhibits the reaction [Acrylamide results in increased phosphorylation of PTK2B protein] CTD PMID:11478917 Ptk2b Rat aflatoxin B1 increases expression ISO Ptk2b (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of PTK2B mRNA CTD PMID:19770486 Ptk2b Rat aflatoxin B1 increases methylation ISO PTK2B (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of PTK2B exon and Aflatoxin B1 results in increased methylation of PTK2B intron CTD PMID:30157460 Ptk2b Rat aflatoxin B1 decreases methylation ISO PTK2B (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PTK2B gene CTD PMID:27153756 Ptk2b Rat Aflatoxin B2 alpha increases methylation ISO PTK2B (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of PTK2B exon and aflatoxin B2 results in increased methylation of PTK2B intron CTD PMID:30157460 Ptk2b Rat AICA ribonucleotide multiple interactions EXP 6480464 AICA ribonucleotide results in increased phosphorylation of and results in increased activity of PTK2B protein more ... CTD PMID:11978788 Ptk2b Rat alachlor multiple interactions ISO Ptk2b (Mus musculus) 6480464 [alachlor co-treated with Captan co-treated with Diazinon co-treated with Endosulfan co-treated with mancozeb co-treated with Maneb] results in decreased expression of PTK2B protein modified form CTD PMID:19883720 Ptk2b Rat all-trans-retinoic acid multiple interactions ISO PTK2B (Homo sapiens) 6480464 [Tretinoin co-treated with CXCL12 protein] results in increased expression of PTK2B protein CTD PMID:17656649 Ptk2b Rat all-trans-retinoic acid increases expression ISO PTK2B (Homo sapiens) 6480464 Tretinoin results in increased expression of PTK2B mRNA CTD PMID:15498508 more ... Ptk2b Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PTK2B mRNA CTD PMID:16483693 Ptk2b Rat ammonium chloride increases expression EXP 6480464 Ammonium Chloride results in increased expression of PTK2B protein and Ammonium Chloride results in increased expression of PTK2B protein modified form CTD PMID:16483693 Ptk2b Rat ammonium chloride decreases expression EXP 6480464 Ammonium Chloride results in decreased expression of PTK2B protein modified form CTD PMID:16483693 Ptk2b Rat Ampullosporin multiple interactions EXP 6480464 [ampullosporin co-treated with Ketamine] results in decreased expression of PTK2B mRNA CTD PMID:16635253 Ptk2b Rat apigenin multiple interactions ISO PTK2B (Homo sapiens) 6480464 Apigenin inhibits the reaction [Uric Acid results in increased phosphorylation of PTK2B protein] CTD PMID:29960001 Ptk2b Rat apocynin multiple interactions EXP 6480464 acetovanillone inhibits the reaction [TNF protein results in decreased phosphorylation of PTK2B protein] CTD PMID:23774252 Ptk2b Rat arsane affects methylation ISO PTK2B (Homo sapiens) 6480464 Arsenic affects the methylation of PTK2B gene CTD PMID:25304211 Ptk2b Rat arsenic atom affects methylation ISO PTK2B (Homo sapiens) 6480464 Arsenic affects the methylation of PTK2B gene CTD PMID:25304211 Ptk2b Rat arsenite(3-) increases expression ISO Ptk2b (Mus musculus) 6480464 arsenite results in increased expression of PTK2B mRNA CTD PMID:33053406 Ptk2b Rat arsenous acid affects expression ISO PTK2B (Homo sapiens) 6480464 Arsenic Trioxide affects the expression of PTK2B mRNA CTD PMID:28786057 Ptk2b Rat asbestos decreases expression ISO PTK2B (Homo sapiens) 6480464 Asbestos results in decreased expression of PTK2B mRNA CTD PMID:22076105 Ptk2b Rat azoxystrobin decreases expression ISO PTK2B (Homo sapiens) 6480464 azoxystrobin results in decreased expression of PTK2B mRNA CTD PMID:33512557 Ptk2b Rat Benoxacor increases expression ISO Ptk2b (Mus musculus) 6480464 benoxacor results in increased expression of PTK2B mRNA CTD PMID:34850242 Ptk2b Rat benzo[a]pyrene increases expression ISO Ptk2b (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PTK2B mRNA CTD PMID:22228805 Ptk2b Rat benzo[a]pyrene decreases expression ISO PTK2B (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PTK2B mRNA CTD PMID:32234424 Ptk2b Rat benzo[a]pyrene affects methylation ISO PTK2B (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PTK2B 5' UTR more ... CTD PMID:27901495 and PMID:30157460 Ptk2b Rat benzo[a]pyrene increases methylation ISO Ptk2b (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of PTK2B exon and Benzo(a)pyrene results in increased methylation of PTK2B intron CTD PMID:27901495 Ptk2b Rat benzo[b]fluoranthene increases expression ISO Ptk2b (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of PTK2B mRNA CTD PMID:26377693 Ptk2b Rat benzo[e]pyrene increases methylation ISO PTK2B (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of PTK2B exon and benzo(e)pyrene results in increased methylation of PTK2B intron CTD PMID:30157460 Ptk2b Rat beta-lapachone increases expression ISO PTK2B (Homo sapiens) 6480464 beta-lapachone results in increased expression of PTK2B mRNA CTD PMID:38218311 Ptk2b Rat bisphenol A increases expression ISO Ptk2b (Mus musculus) 6480464 bisphenol A results in increased expression of PTK2B mRNA CTD PMID:26063408 and PMID:38701888 Ptk2b Rat bisphenol A decreases methylation ISO PTK2B (Homo sapiens) 6480464 bisphenol A results in decreased methylation of PTK2B gene CTD PMID:31601247 Ptk2b Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PTK2B mRNA CTD PMID:30816183 and PMID:32528016 Ptk2b Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PTK2B mRNA CTD PMID:25181051 Ptk2b Rat bisphenol F increases expression ISO Ptk2b (Mus musculus) 6480464 bisphenol F results in increased expression of PTK2B mRNA CTD PMID:38685157 Ptk2b Rat buta-1,3-diene decreases expression ISO Ptk2b (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of PTK2B mRNA CTD PMID:29038090 Ptk2b Rat butan-1-ol multiple interactions EXP 6480464 1-Butanol inhibits the reaction [Hydrogen Peroxide results in increased phosphorylation of PTK2B protein] and 1-Butanol inhibits the reaction [Potassium Chloride results in increased phosphorylation of PTK2B protein] CTD PMID:15705590 and PMID:18004999 Ptk2b Rat butanal decreases expression ISO PTK2B (Homo sapiens) 6480464 butyraldehyde results in decreased expression of PTK2B mRNA CTD PMID:26079696 Ptk2b Rat cadmium dichloride increases expression ISO PTK2B (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PTK2B mRNA CTD PMID:38382870 Ptk2b Rat cadmium dichloride decreases expression ISO PTK2B (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of PTK2B mRNA CTD PMID:38568856 Ptk2b Rat calcium atom multiple interactions ISO PTK2B (Homo sapiens) 6480464 Calcium affects the reaction [(N)-methanocarba-2MeSADP results in increased phosphorylation of PTK2B protein] CTD PMID:16236484 Ptk2b Rat calcium atom multiple interactions EXP 6480464 Calcium affects the phosphorylation of and affects the activity of PTK2B protein CTD PMID:16877402 Ptk2b Rat calcium(0) multiple interactions ISO PTK2B (Homo sapiens) 6480464 Calcium affects the reaction [(N)-methanocarba-2MeSADP results in increased phosphorylation of PTK2B protein] CTD PMID:16236484 Ptk2b Rat calcium(0) multiple interactions EXP 6480464 Calcium affects the phosphorylation of and affects the activity of PTK2B protein CTD PMID:16877402 Ptk2b Rat captan multiple interactions ISO Ptk2b (Mus musculus) 6480464 [alachlor co-treated with Captan co-treated with Diazinon co-treated with Endosulfan co-treated with mancozeb co-treated with Maneb] results in decreased expression of PTK2B protein modified form CTD PMID:19883720 Ptk2b Rat carbachol multiple interactions EXP 6480464 4-amino-5-(4-methylphenyl)-7-(tert-butyl)pyrazolo(3 more ... CTD PMID:16877402 Ptk2b Rat carbon nanotube decreases expression ISO PTK2B (Homo sapiens) 6480464 Nanotubes and Carbon results in decreased expression of PTK2B mRNA CTD PMID:22076105 Ptk2b Rat carbon nanotube decreases expression ISO Ptk2b (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Ptk2b Rat CGP 52608 multiple interactions ISO PTK2B (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PTK2B gene] CTD PMID:28238834 Ptk2b Rat chlordecone decreases expression ISO Ptk2b (Mus musculus) 6480464 Chlordecone results in decreased expression of PTK2B mRNA CTD PMID:33711761 Ptk2b Rat choline multiple interactions ISO Ptk2b (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PTK2B mRNA CTD PMID:20938992 Ptk2b Rat chromium(6+) increases expression ISO PTK2B (Homo sapiens) 6480464 chromium hexavalent ion results in increased expression of PTK2B mRNA CTD PMID:27793765 Ptk2b Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of PTK2B protein CTD PMID:12117546 Ptk2b Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of PTK2B mRNA CTD PMID:26577399 Ptk2b Rat dexamethasone multiple interactions ISO PTK2B (Homo sapiens) 6480464 NR3C1 protein affects the reaction [Dexamethasone results in increased phosphorylation of PTK2B protein] CTD PMID:18515658 Ptk2b Rat dexamethasone increases expression ISO PTK2B (Homo sapiens) 6480464 Dexamethasone results in increased expression of PTK2B mRNA CTD PMID:12782123 and PMID:25047013 Ptk2b Rat diarsenic trioxide affects expression ISO PTK2B (Homo sapiens) 6480464 Arsenic Trioxide affects the expression of PTK2B mRNA CTD PMID:28786057 Ptk2b Rat diazinon multiple interactions ISO Ptk2b (Mus musculus) 6480464 [alachlor co-treated with Captan co-treated with Diazinon co-treated with Endosulfan co-treated with mancozeb co-treated with Maneb] results in decreased expression of PTK2B protein modified form CTD PMID:19883720 Ptk2b Rat dibenziodolium multiple interactions EXP 6480464 diphenyleneiodonium inhibits the reaction [TNF protein results in decreased phosphorylation of PTK2B protein] CTD PMID:23774252 Ptk2b Rat dibutyl phthalate increases expression ISO Ptk2b (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of PTK2B mRNA CTD PMID:17361019 and PMID:21266533 Ptk2b Rat dicrotophos increases expression ISO PTK2B (Homo sapiens) 6480464 dicrotophos results in increased expression of PTK2B mRNA CTD PMID:28302478 Ptk2b Rat dimethylarsinic acid increases expression EXP 6480464 Cacodylic Acid results in increased expression of PTK2B mRNA CTD PMID:16122865 Ptk2b Rat doxorubicin multiple interactions ISO PTK2B (Homo sapiens) 6480464 PTK2B protein inhibits the reaction [Doxorubicin results in increased phosphorylation of AKT1 protein] CTD PMID:16168102 Ptk2b Rat doxorubicin decreases expression ISO PTK2B (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PTK2B mRNA CTD PMID:29803840 Ptk2b Rat endosulfan multiple interactions ISO Ptk2b (Mus musculus) 6480464 [alachlor co-treated with Captan co-treated with Diazinon co-treated with Endosulfan co-treated with mancozeb co-treated with Maneb] results in decreased expression of PTK2B protein modified form CTD PMID:19883720 Ptk2b Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of PTK2B mRNA CTD PMID:29391264 Ptk2b Rat epoxiconazole decreases expression ISO Ptk2b (Mus musculus) 6480464 epoxiconazole results in decreased expression of PTK2B mRNA CTD PMID:35436446 Ptk2b Rat ethanol increases phosphorylation ISO PTK2B (Homo sapiens) 6480464 Ethanol results in increased phosphorylation of PTK2B protein CTD PMID:18182400 Ptk2b Rat ethanol affects splicing ISO Ptk2b (Mus musculus) 6480464 Ethanol affects the splicing of PTK2B mRNA CTD PMID:30319688 Ptk2b Rat ethanol multiple interactions ISO PTK2B (Homo sapiens) 6480464 sodium arsenite promotes the reaction [Ethanol results in increased phosphorylation of PTK2B protein] CTD PMID:18182400 Ptk2b Rat ethylene glycol bis(2-aminoethyl)tetraacetic acid multiple interactions EXP 6480464 Egtazic Acid inhibits the reaction [Carbachol results in increased phosphorylation of and results in increased activity of PTK2B protein] CTD PMID:16877402 Ptk2b Rat fenpyroximate decreases expression ISO PTK2B (Homo sapiens) 6480464 fenpyroximate results in decreased expression of PTK2B mRNA CTD PMID:33512557 Ptk2b Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of PTK2B mRNA CTD PMID:30307764 Ptk2b Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of PTK2B mRNA CTD PMID:18035473 Ptk2b Rat fluoxetine decreases expression EXP 6480464 Fluoxetine results in decreased expression of PTK2B mRNA CTD PMID:17033635 Ptk2b Rat folic acid multiple interactions ISO Ptk2b (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Ptk2b Rat folpet decreases expression ISO Ptk2b (Mus musculus) 6480464 folpet results in decreased expression of PTK2B mRNA CTD PMID:31558096 Ptk2b Rat furan decreases expression ISO Ptk2b (Mus musculus) 6480464 furan results in decreased expression of PTK2B mRNA CTD PMID:24183702 Ptk2b Rat furan increases expression EXP 6480464 furan results in increased expression of PTK2B mRNA CTD PMID:25539665 Ptk2b Rat glyphosate increases methylation EXP 6480464 Glyphosate results in increased methylation of PTK2B gene CTD PMID:31011160 Ptk2b Rat hydralazine multiple interactions ISO PTK2B (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of PTK2B mRNA CTD PMID:17183730 Ptk2b Rat hydrogen peroxide multiple interactions EXP 6480464 1-Butanol inhibits the reaction [Hydrogen Peroxide results in increased phosphorylation of PTK2B protein] more ... CTD PMID:15705590 and PMID:16187300 Ptk2b Rat hydrogen peroxide increases phosphorylation EXP 6480464 Hydrogen Peroxide results in increased phosphorylation of PTK2B protein CTD PMID:15705590 Ptk2b Rat ionomycin multiple interactions EXP 6480464 Ionomycin results in increased phosphorylation of and results in increased activity of PTK2B protein CTD PMID:16877402 Ptk2b Rat ketamine multiple interactions EXP 6480464 [ampullosporin co-treated with Ketamine] results in decreased expression of PTK2B mRNA CTD PMID:16635253 Ptk2b Rat L-methionine multiple interactions ISO Ptk2b (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PTK2B mRNA CTD PMID:20938992 Ptk2b Rat lead(0) decreases expression ISO PTK2B (Homo sapiens) 6480464 Lead results in decreased expression of PTK2B mRNA CTD PMID:19921347 Ptk2b Rat lithium atom multiple interactions EXP 6480464 [Lithium co-treated with Pilocarpine] results in increased activity of PTK2B protein CTD PMID:16600505 Ptk2b Rat lithium hydride multiple interactions EXP 6480464 [Lithium co-treated with Pilocarpine] results in increased activity of PTK2B protein CTD PMID:16600505 Ptk2b Rat Malonoben multiple interactions ISO PTK2B (Homo sapiens) 6480464 tyrphostin A9 inhibits the reaction [S100A4 protein results in increased phosphorylation of PTK2B protein] CTD PMID:16948116 Ptk2b Rat mancozeb multiple interactions ISO Ptk2b (Mus musculus) 6480464 [alachlor co-treated with Captan co-treated with Diazinon co-treated with Endosulfan co-treated with mancozeb co-treated with Maneb] results in decreased expression of PTK2B protein modified form CTD PMID:19883720 Ptk2b Rat maneb multiple interactions ISO Ptk2b (Mus musculus) 6480464 [alachlor co-treated with Captan co-treated with Diazinon co-treated with Endosulfan co-treated with mancozeb co-treated with Maneb] results in decreased expression of PTK2B protein modified form and [Maneb co-treated with Paraquat] results in decreased expression of PTK2B mRNA CTD PMID:19883720 and PMID:36117858 Ptk2b Rat manganese atom decreases expression ISO PTK2B (Homo sapiens) 6480464 Manganese results in decreased expression of PTK2B mRNA CTD PMID:17175027 Ptk2b Rat manganese(0) decreases expression ISO PTK2B (Homo sapiens) 6480464 Manganese results in decreased expression of PTK2B mRNA CTD PMID:17175027 Ptk2b Rat manganese(II) chloride decreases expression ISO PTK2B (Homo sapiens) 6480464 manganese chloride results in decreased expression of PTK2B mRNA CTD PMID:17175027 Ptk2b Rat mefloquine increases response to substance EXP 6480464 PTK2B protein results in increased susceptibility to Mefloquine CTD PMID:21241737 Ptk2b Rat methapyrilene increases methylation ISO PTK2B (Homo sapiens) 6480464 Methapyrilene results in increased methylation of PTK2B exon and Methapyrilene results in increased methylation of PTK2B intron CTD PMID:30157460 Ptk2b Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of PTK2B mRNA CTD PMID:22504374 Ptk2b Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PTK2B gene CTD PMID:35440735 Ptk2b Rat mono(2-ethylhexyl) phthalate decreases expression ISO Ptk2b (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of PTK2B mRNA CTD PMID:22401849 Ptk2b Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [TNF protein results in decreased phosphorylation of PTK2B protein] CTD PMID:23774252 Ptk2b Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Ptk2b (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde affects the reaction [PTK2B protein affects the ubiquitination of ESR1 protein] CTD PMID:29428397 Ptk2b Rat N-Nitrosopyrrolidine decreases expression ISO PTK2B (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of PTK2B mRNA CTD PMID:32234424 Ptk2b Rat naphthalene increases expression ISO Ptk2b (Mus musculus) 6480464 naphthalene results in increased expression of PTK2B mRNA CTD PMID:18978301 Ptk2b Rat niclosamide increases expression ISO PTK2B (Homo sapiens) 6480464 Niclosamide results in increased expression of PTK2B mRNA CTD PMID:36318118 Ptk2b Rat nitrates multiple interactions ISO Ptk2b (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PTK2B mRNA CTD PMID:35964746 Ptk2b Rat ozone multiple interactions ISO PTK2B (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of PTK2B mRNA CTD PMID:35430440 Ptk2b Rat paracetamol increases expression ISO PTK2B (Homo sapiens) 6480464 Acetaminophen results in increased expression of PTK2B mRNA CTD PMID:22230336 Ptk2b Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PTK2B mRNA CTD PMID:33387578 Ptk2b Rat paraoxon increases expression ISO PTK2B (Homo sapiens) 6480464 Paraoxon results in increased expression of PTK2B mRNA CTD PMID:24413757 Ptk2b Rat paraquat multiple interactions ISO Ptk2b (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of PTK2B mRNA CTD PMID:36117858 Ptk2b Rat PCB138 multiple interactions ISO Ptk2b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Ptk2b Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ptk2b (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PTK2B mRNA CTD PMID:36331819 Ptk2b Rat perfluorooctanoic acid increases expression ISO PTK2B (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of PTK2B mRNA CTD PMID:37738295 Ptk2b Rat phorbol 13-acetate 12-myristate multiple interactions EXP 6480464 Tetradecanoylphorbol Acetate results in increased phosphorylation of and results in increased activity of PTK2B protein CTD PMID:16877402 Ptk2b Rat picoxystrobin decreases expression ISO PTK2B (Homo sapiens) 6480464 picoxystrobin results in decreased expression of PTK2B mRNA CTD PMID:33512557 Ptk2b Rat pinostrobin increases expression ISO PTK2B (Homo sapiens) 6480464 pinostrobin results in increased expression of PTK2B mRNA CTD PMID:37777166 Ptk2b Rat pirinixic acid decreases expression ISO Ptk2b (Mus musculus) 6480464 pirinixic acid results in decreased expression of PTK2B mRNA CTD PMID:23811191 Ptk2b Rat ponatinib decreases activity ISO PTK2B (Homo sapiens) 6480464 ponatinib results in decreased activity of PTK2B protein CTD PMID:19878872 Ptk2b Rat potassium chloride multiple interactions EXP 6480464 1-Butanol inhibits the reaction [Potassium Chloride results in increased phosphorylation of PTK2B protein] more ... CTD PMID:18004999 Ptk2b Rat potassium chloride increases phosphorylation EXP 6480464 Potassium Chloride results in increased phosphorylation of PTK2B protein CTD PMID:18004999 Ptk2b Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Ptk2b (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of PTK2B mRNA CTD PMID:28903501 Ptk2b Rat propiconazole decreases expression ISO Ptk2b (Mus musculus) 6480464 propiconazole results in decreased expression of PTK2B mRNA CTD PMID:21278054 Ptk2b Rat prostaglandin F2alpha increases expression EXP 6480464 Dinoprost results in increased expression of PTK2B mRNA CTD PMID:11517196 Ptk2b Rat quercitrin affects expression ISO PTK2B (Homo sapiens) 6480464 quercitrin affects the expression of PTK2B mRNA CTD PMID:25193878 Ptk2b Rat rotenone decreases expression ISO PTK2B (Homo sapiens) 6480464 Rotenone results in decreased expression of PTK2B mRNA CTD PMID:33512557 Ptk2b Rat silicon dioxide decreases expression ISO PTK2B (Homo sapiens) 6480464 Silicon Dioxide results in decreased expression of PTK2B mRNA CTD PMID:23623845 Ptk2b Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of PTK2B mRNA CTD PMID:32721576 Ptk2b Rat sodium arsenite multiple interactions ISO PTK2B (Homo sapiens) 6480464 sodium arsenite promotes the reaction [Ethanol results in increased phosphorylation of PTK2B protein] CTD PMID:18182400 Ptk2b Rat sodium arsenite decreases expression ISO Ptk2b (Mus musculus) 6480464 sodium arsenite results in decreased expression of PTK2B mRNA CTD PMID:37682722 Ptk2b Rat sodium arsenite decreases expression ISO PTK2B (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PTK2B mRNA CTD PMID:38568856 Ptk2b Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of PTK2B protein CTD PMID:19072884 Ptk2b Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of PTK2B mRNA CTD PMID:19281266 Ptk2b Rat sulforaphane decreases expression ISO PTK2B (Homo sapiens) 6480464 sulforaphane results in decreased expression of PTK2B mRNA CTD PMID:31838189 Ptk2b Rat sunitinib increases expression ISO PTK2B (Homo sapiens) 6480464 Sunitinib results in increased expression of PTK2B mRNA CTD PMID:31533062 Ptk2b Rat tamibarotene increases expression ISO PTK2B (Homo sapiens) 6480464 tamibarotene results in increased expression of PTK2B mRNA CTD PMID:15498508 Ptk2b Rat tamoxifen decreases expression ISO PTK2B (Homo sapiens) 6480464 Tamoxifen results in decreased expression of PTK2B mRNA CTD PMID:15590111 Ptk2b Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of PTK2B protein CTD PMID:35544339 Ptk2b Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PTK2B mRNA CTD PMID:34492290 Ptk2b Rat titanium dioxide increases expression ISO Ptk2b (Mus musculus) 6480464 titanium dioxide results in increased expression of PTK2B mRNA CTD PMID:23557971 and PMID:29264374 Ptk2b Rat trichloroethene decreases expression ISO Ptk2b (Mus musculus) 6480464 Trichloroethylene results in decreased expression of PTK2B mRNA CTD PMID:25549359 Ptk2b Rat triphenyl phosphate affects expression ISO PTK2B (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PTK2B mRNA CTD PMID:37042841 Ptk2b Rat tungsten decreases expression ISO Ptk2b (Mus musculus) 6480464 Tungsten results in decreased expression of PTK2B mRNA CTD PMID:30912803 Ptk2b Rat urethane decreases expression ISO PTK2B (Homo sapiens) 6480464 Urethane results in decreased expression of PTK2B mRNA CTD PMID:28818685 Ptk2b Rat valproic acid multiple interactions ISO PTK2B (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of PTK2B mRNA CTD PMID:17183730 Ptk2b Rat vanadium atom decreases expression ISO PTK2B (Homo sapiens) 6480464 Vanadium results in decreased expression of PTK2B mRNA CTD PMID:19000753 Ptk2b Rat vanadium(0) decreases expression ISO PTK2B (Homo sapiens) 6480464 Vanadium results in decreased expression of PTK2B mRNA CTD PMID:19000753 Ptk2b Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PTK2B mRNA CTD PMID:23034163 Ptk2b Rat vincristine increases phosphorylation ISO PTK2B (Homo sapiens) 6480464 Vincristine results in increased phosphorylation of PTK2B protein CTD PMID:11478917 Ptk2b Rat zinc atom increases expression ISO PTK2B (Homo sapiens) 6480464 Zinc deficiency results in increased expression of PTK2B mRNA CTD PMID:22171008 Ptk2b Rat zinc(0) increases expression ISO PTK2B (Homo sapiens) 6480464 Zinc deficiency results in increased expression of PTK2B mRNA CTD PMID:22171008
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-pilocarpine (EXP) (1->4)-beta-D-glucan (ISO) (S)-colchicine (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 1-octadec-9-enoylglycero-3-phosphate (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,6-dinitrotoluene (EXP) 2-butoxyethanol (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) 7,9-dihydro-1H-purine-2,6,8(3H)-trione (ISO) 7-ketocholesterol (ISO) [2,8-bis(trifluoromethyl)quinolin-4-yl]-(2-piperidyl)methanol (EXP) acetamide (EXP) acrylamide (EXP,ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) AICA ribonucleotide (EXP) alachlor (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) Ampullosporin (EXP) apigenin (ISO) apocynin (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) asbestos (ISO) azoxystrobin (ISO) Benoxacor (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buta-1,3-diene (ISO) butan-1-ol (EXP) butanal (ISO) cadmium dichloride (ISO) calcium atom (EXP,ISO) calcium(0) (EXP,ISO) captan (ISO) carbachol (EXP) carbon nanotube (ISO) CGP 52608 (ISO) chlordecone (ISO) choline (ISO) chromium(6+) (ISO) cocaine (EXP) Cuprizon (EXP) dexamethasone (ISO) diarsenic trioxide (ISO) diazinon (ISO) dibenziodolium (EXP) dibutyl phthalate (ISO) dicrotophos (ISO) dimethylarsinic acid (EXP) doxorubicin (ISO) endosulfan (EXP,ISO) epoxiconazole (ISO) ethanol (ISO) ethylene glycol bis(2-aminoethyl)tetraacetic acid (EXP) fenpyroximate (ISO) fenvalerate (EXP) flavonoids (EXP) fluoxetine (EXP) folic acid (ISO) folpet (ISO) furan (EXP,ISO) glyphosate (EXP) hydralazine (ISO) hydrogen peroxide (EXP) ionomycin (EXP) ketamine (EXP) L-methionine (ISO) lead(0) (ISO) lithium atom (EXP) lithium hydride (EXP) Malonoben (ISO) mancozeb (ISO) maneb (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mefloquine (EXP) methapyrilene (ISO) methimazole (EXP) methoxychlor (EXP) mono(2-ethylhexyl) phthalate (ISO) N-acetyl-L-cysteine (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-Nitrosopyrrolidine (ISO) naphthalene (ISO) niclosamide (ISO) nitrates (ISO) ozone (ISO) paracetamol (EXP,ISO) paraoxon (ISO) paraquat (ISO) PCB138 (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phorbol 13-acetate 12-myristate (EXP) picoxystrobin (ISO) pinostrobin (ISO) pirinixic acid (ISO) ponatinib (ISO) potassium chloride (EXP) pregnenolone 16alpha-carbonitrile (ISO) propiconazole (ISO) prostaglandin F2alpha (EXP) quercitrin (ISO) rotenone (ISO) silicon dioxide (EXP,ISO) sodium arsenite (EXP,ISO) Soman (EXP) sulforaphane (ISO) sunitinib (ISO) tamibarotene (ISO) tamoxifen (ISO) thapsigargin (EXP) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (ISO) triphenyl phosphate (ISO) tungsten (ISO) urethane (ISO) valproic acid (ISO) vanadium atom (ISO) vanadium(0) (ISO) vinclozolin (EXP) vincristine (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
actin filament organization (IMP) activation of GTPase activity (IMP,ISO) activation of Janus kinase activity (IMP,ISO) adaptive immune response (IEA) angiogenesis (IEA,IMP) blood vessel endothelial cell migration (IMP) bone resorption (ISO,ISS) cell adhesion (IMP) cell differentiation (IEP) cell surface receptor signaling pathway (ISO,ISS) cellular defense response (IMP) cellular response to fluid shear stress (ISO) cellular response to retinoic acid (ISO) chemokine-mediated signaling pathway (ISO,ISS) cortical cytoskeleton organization (ISO,ISS) cytoskeleton organization (ISO) endothelin receptor signaling pathway (ISO,ISS) epidermal growth factor receptor signaling pathway (IBA,IMP) focal adhesion assembly (IMP) glial cell proliferation (IEP) Golgi organization (ISO) immune system process (IEA) integrin-mediated signaling pathway (ISO,ISS) ionotropic glutamate receptor signaling pathway (IMP) long-term synaptic depression (IMP) long-term synaptic potentiation (IMP) MAPK cascade (IMP) marginal zone B cell differentiation (ISO,ISS) negative regulation of apoptotic process (ISO,ISS) negative regulation of bone mineralization (ISO,ISS) negative regulation of cell population proliferation (ISO,ISS) negative regulation of muscle cell apoptotic process (IMP) negative regulation of myeloid cell differentiation (ISO) negative regulation of neuron apoptotic process (IMP) negative regulation of ossification (IMP) negative regulation of potassium ion transport (ISO) neuron migration (ISO) neuron projection development (IMP) oocyte maturation (IMP) peptidyl-tyrosine autophosphorylation (ISO) peptidyl-tyrosine phosphorylation (IDA,ISO) positive regulation of actin filament polymerization (ISO,ISS) positive regulation of angiogenesis (ISO) positive regulation of B cell chemotaxis (ISO,ISS) positive regulation of cell growth (IMP) positive regulation of cell migration (IBA,IMP,ISO) positive regulation of cell population proliferation (IEA,IEP,ISO) positive regulation of cell-matrix adhesion (ISO,ISS) positive regulation of cytosolic calcium ion concentration (IMP) positive regulation of DNA biosynthetic process (IMP) positive regulation of endothelial cell migration (ISO) positive regulation of ERK1 and ERK2 cascade (ISO,ISS) positive regulation of excitatory postsynaptic potential (IMP) positive regulation of JNK cascade (ISO,ISS) positive regulation of JUN kinase activity (IMP) positive regulation of neuron projection development (ISO) positive regulation of nitric oxide biosynthetic process (IMP) positive regulation of nitric-oxide synthase activity (IMP) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (ISO,ISS) positive regulation of protein kinase activity (ISO,ISS) positive regulation of protein metabolic process (IMP) positive regulation of reactive oxygen species metabolic process (IMP) positive regulation of synaptic transmission, glutamatergic (IMP) positive regulation of translation (IMP) positive regulation of ubiquitin-dependent protein catabolic process (ISO,ISS) postsynaptic modulation of chemical synaptic transmission (IDA,IMP) protein phosphorylation (ISO) regulation of actin cytoskeleton organization (ISO,ISS) regulation of biological quality (IEA) regulation of cell adhesion (IBA,ISO,ISS) regulation of cell shape (ISO,ISS) regulation of cellular component organization (IEA) regulation of macrophage chemotaxis (ISO,ISS) regulation of multicellular organismal process (IEA) regulation of postsynaptic density assembly (ISO) regulation of release of sequestered calcium ion into cytosol (ISO,ISS) regulation of ubiquitin-dependent protein catabolic process (ISO) response to calcium ion (IEP) response to cAMP (IEP) response to cation stress (IDA) response to cocaine (IEP) response to ethanol (IEP) response to glucose (IEP) response to hormone (IEP) response to hydrogen peroxide (IPI) response to hypoxia (IEP) response to immobilization stress (IEP) response to ischemia (IMP) response to mechanical stimulus (IEP) response to reactive oxygen species (IEP) response to xenobiotic stimulus (IEP) signal complex assembly (IEA) sprouting angiogenesis (ISO,ISS) stress fiber assembly (IMP) tumor necrosis factor-mediated signaling pathway (ISO) vascular endothelial growth factor receptor signaling pathway (ISO)
Cellular Component
anchoring junction (IEA) apical dendrite (IDA) axon (IDA) cell body (IDA) cell cortex (IDA,IEA) cell projection (IDA,IEA) cytoplasm (IEA) cytoskeleton (IEA) dendrite (IDA) focal adhesion (IBA,IDA,IEA,ISO) glutamatergic synapse (IDA,IEA,ISO) growth cone (IDA) lamellipodium (IEA,ISO,ISS) membrane (IEA) neuronal cell body (IDA) NMDA selective glutamate receptor complex (IDA) nucleus (IEA,ISO) perinuclear region of cytoplasm (IDA,IEA,ISO) plasma membrane (IBA,IEA) postsynapse (IDA) postsynaptic density (IDA) postsynaptic density, intracellular component (IDA,IMP,ISO) presynapse (ISO) Schaffer collateral - CA1 synapse (IDA,IMP)
1.
Divergent regulation of Pyk2/CAKbeta phosphorylation by Ca2+ and cAMP in the hippocampus.
Alier KA and Morris BJ, Biochim Biophys Acta. 2005 Sep 30;1745(3):342-9.
2.
Adapter protein CRKII signaling is involved in the rat pancreatic acini response to reactive oxygen species.
Andreolotti AG, etal., J Cell Biochem. 2006 Feb 1;97(2):359-67.
3.
Integrin dynamics produce a delayed stage of long-term potentiation and memory consolidation.
Babayan AH, etal., J Neurosci. 2012 Sep 12;32(37):12854-61. doi: 10.1523/JNEUROSCI.2024-12.2012.
4.
Stromal cell-derived factor-1alpha induces astrocyte proliferation through the activation of extracellular signal-regulated kinases 1/2 pathway.
Bajetto A, etal., J Neurochem. 2001 Jun;77(5):1226-36.
5.
Glucose activates protein kinase C-zeta /lambda through proline-rich tyrosine kinase-2, extracellular signal-regulated kinase, and phospholipase D: a novel mechanism for activating glucose transporter translocation.
Bandyopadhyay G, etal., J Biol Chem. 2001 Sep 21;276(38):35537-45. Epub 2001 Jul 19.
6.
Postsynaptic clustering and activation of Pyk2 by PSD-95.
Bartos JA, etal., J Neurosci. 2010 Jan 13;30(2):449-63. doi: 10.1523/JNEUROSCI.4992-08.2010.
7.
PYK2 expression and phosphorylation increases in pressure overload-induced left ventricular hypertrophy.
Bayer AL, etal., Am J Physiol Heart Circ Physiol. 2002 Aug;283(2):H695-706.
8.
Calcium-dependent activation of Pyk2 by hypoxia.
Beitner-Johnson D, etal., Cell Signal. 2002 Feb;14(2):133-7.
9.
Integrins regulate opioid receptor signaling in trigeminal ganglion neurons.
Berg KA, etal., Neuroscience. 2007 Feb 9;144(3):889-97. Epub 2006 Dec 8.
10.
Mechanical strain on osteoblasts activates autophosphorylation of focal adhesion kinase and proline-rich tyrosine kinase 2 tyrosine sites involved in ERK activation.
Boutahar N, etal., J Biol Chem. 2004 Jul 16;279(29):30588-99. Epub 2004 Apr 19.
11.
Proline-rich tyrosine kinase 2 regulates osteoprogenitor cells and bone formation, and offers an anabolic treatment approach for osteoporosis.
Buckbinder L, etal., Proc Natl Acad Sci U S A. 2007 Jun 19;104(25):10619-24. Epub 2007 May 30.
12.
Signal transduction of physiological concentrations of vasopressin in A7r5 vascular smooth muscle cells. A role for PYK2 and tyrosine phosphorylation of K+ channels in the stimulation of Ca2+ spiking.
Byron KL and Lucchesi PA, J Biol Chem. 2002 Mar 1;277(9):7298-307. Epub 2001 Dec 5.
13.
Role of p38 map kinase in glycine-induced hepatocyte resistance to hypoxic injury.
Carini R, etal., J Hepatol. 2007 Apr;46(4):692-9. Epub 2006 Nov 27.
14.
[Effects of prednisone on renal FAK and Pyk2 expressions in rats with adriamycin- induced nephritis].
Chen X, etal., Nan Fang Yi Ke Da Xue Xue Bao. 2014 Jul;34(8):1149-53.
15.
Identification of a novel protein complex containing annexin VI, Fyn, Pyk2, and the p120(GAP) C2 domain.
Chow A, etal., FEBS Lett. 2000 Mar 3;469(1):88-92.
16.
Depolarization activates ERK and proline-rich tyrosine kinase 2 (PYK2) independently in different cellular compartments in hippocampal slices.
Corvol JC, etal., J Biol Chem. 2005 Jan 7;280(1):660-8. Epub 2004 Nov 10.
17.
Reactive oxygen species mediate Endothelin-1-induced activation of ERK1/2, PKB, and Pyk2 signaling, as well as protein synthesis, in vascular smooth muscle cells.
Daou GB and Srivastava AK, Free Radic Biol Med. 2004 Jul 15;37(2):208-15.
18.
A role for Pyk2 and Src in linking G-protein-coupled receptors with MAP kinase activation.
Dikic I, etal., Nature. 1996 Oct 10;383(6600):547-50. doi: 10.1038/383547a0.
19.
Mitochondrial signals initiate the activation of c-Jun N-terminal kinase (JNK) by hypoxia-reoxygenation.
Dougherty CJ, etal., FASEB J. 2004 Jul;18(10):1060-70.
20.
Requirement of Ca(2+) and PKCdelta for Janus kinase 2 activation by angiotensin II: involvement of PYK2.
Frank GD, etal., Mol Endocrinol 2002 Feb;16(2):367-77.
21.
Changes in rat frontal cortex gene expression following chronic cocaine.
Freeman WM, etal., Brain Res Mol Brain Res. 2002 Jul 15;104(1):11-20.
22.
Novel role of proline-rich nonreceptor tyrosine kinase 2 in vascular wall remodeling after balloon injury.
Gadepalli R, etal., Arterioscler Thromb Vasc Biol. 2012 Nov;32(11):2652-61. doi: 10.1161/ATVBAHA.112.253112. Epub 2012 Aug 23.
23.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
24.
Arginine vasopressin stimulates mesangial cell proliferation by activating the epidermal growth factor receptor.
Ghosh PM, etal., Am J Physiol Renal Physiol. 2001 Jun;280(6):F972-9.
25.
Recruitment of Pyk2 and Cbl to lipid rafts mediates signals important for actin reorganization in growing neurites.
Haglund K, etal., J Cell Sci. 2004 May 15;117(Pt 12):2557-68. Epub 2004 May 5.
26.
Nifedipine suppresses neointimal thickening by its inhibitory effect on vascular smooth muscle cell growth via a MEK-ERK pathway coupling with Pyk2.
Hirata A, etal., Br J Pharmacol. 2000 Dec;131(8):1521-30.
27.
Ca(2+)-sensitive tyrosine kinase Pyk2/CAK beta-dependent signaling is essential for G-protein-coupled receptor agonist-induced hypertrophy.
Hirotani S, etal., J Mol Cell Cardiol. 2004 Jun;36(6):799-807.
28.
Roles of protein kinase C, Ca2+, Pyk2, and c-Src in agonist activation of rat lacrimal gland p42/p44 MAPK.
Hodges RR, etal., Invest Ophthalmol Vis Sci. 2006 Aug;47(8):3352-9.
29.
Suppression of postsynaptic density protein 95 by antisense oligonucleotides diminishes postischemic pyramidal cell death in rat hippocampal CA1 subfield.
Hou XY, etal., Neurosci Lett. 2005 Sep 16;385(3):230-3.
30.
Proline-rich tyrosine kinase 2 regulates hippocampal long-term depression.
Hsin H, etal., J Neurosci. 2010 Sep 8;30(36):11983-93. doi: 10.1523/JNEUROSCI.1029-10.2010.
31.
CAKbeta/Pyk2 kinase is a signaling link for induction of long-term potentiation in CA1 hippocampus.
Huang Y, etal., Neuron. 2001 Feb;29(2):485-96.
32.
Increase in tyrosine phosphorylation of the NMDA receptor following the induction of status epilepticus.
Huo JZ, etal., Neurosci Lett. 2006 Jul 3;401(3):266-70. Epub 2006 Apr 4.
33.
Pyk2 and FAK regulate neurite outgrowth induced by growth factors and integrins.
Ivankovic-Dikic I, etal., Nat Cell Biol. 2000 Sep;2(9):574-81.
34.
Protein tyrosine kinase 2beta as a candidate gene for hypertension.
Kamide K, etal., Pharmacogenet Genomics. 2007 Nov;17(11):931-9.
35.
Osmotic stress induces HB-EGF gene expression via Ca(2+)/Pyk2/JNK signal cascades in rat aortic smooth muscle cells.
Koh YH, etal., J Biochem (Tokyo). 2001 Sep;130(3):351-8.
36.
The tyrosine kinase Pyk2 regulates Arf1 activity by phosphorylation and inhibition of the Arf-GTPase-activating protein ASAP1.
Kruljac-Letunic A, etal., J Biol Chem. 2003 Aug 8;278(32):29560-70. Epub 2003 May 27.
37.
Identification of a novel family of targets of PYK2 related to Drosophila retinal degeneration B (rdgB) protein.
Lev S, etal., Mol Cell Biol. 1999 Mar;19(3):2278-88.
38.
Suppression of Pyk2 attenuated the increased tyrosine phosphorylation of NMDA receptor subunit 2A after brain ischemia in rat hippocampus.
Liu Y, etal., Neurosci Lett. 2005 Apr 29;379(1):55-8. Epub 2005 Jan 12.
39.
Lithium suppressed Tyr-402 phosphorylation of proline-rich tyrosine kinase (Pyk2) and interactions of Pyk2 and PSD-95 with NR2A in rat hippocampus following cerebral ischemia.
Ma J, etal., Neurosci Res. 2004 Aug;49(4):357-62.
40.
Activation of pyk2/related focal adhesion tyrosine kinase and focal adhesion kinase in cardiac remodeling.
Melendez J, etal., J Biol Chem 2002 Nov 22;277(47):45203-10.
41.
FAK+ and PYK2/CAKbeta, two related tyrosine kinases highly expressed in the central nervous system: similarities and differences in the expression pattern.
Menegon A, etal., Eur J Neurosci. 1999 Nov;11(11):3777-88.
42.
Proline-rich tyrosine kinase2 is involved in F-actin organization during in vitro maturation of rat oocyte.
Meng XQ, etal., Reproduction. 2006 Dec;132(6):859-67.
43.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
44.
High resolution genomic analysis of sporadic breast cancer using array-based comparative genomic hybridization.
Naylor TL, etal., Breast Cancer Res. 2005;7(6):R1186-98. Epub 2005 Nov 24.
45.
Losartan improves aortic endothelium-dependent relaxation via proline-rich tyrosine kinase 2/Src/Akt pathway in type 2 diabetic Goto-Kakizaki rats.
Nemoto S, etal., Am J Physiol Heart Circ Physiol. 2011 Dec;301(6):H2383-94. doi: 10.1152/ajpheart.00178.2011. Epub 2011 Sep 16.
46.
Antiapoptotic effect of endothelin-1 in rat cardiomyocytes in vitro.
Ogata Y, etal., Hypertension. 2003 May;41(5):1156-63. Epub 2003 Mar 31.
47.
The Src family kinase, Lyn, is activated in pancreatic acinar cells by gastrointestinal hormones/neurotransmitters and growth factors which stimulate its association with numerous other signaling molecules.
Pace A, etal., Biochim Biophys Acta. 2006 Apr;1763(4):356-65. Epub 2006 Apr 7.
48.
RAFTK/Pyk2 regulates EGF-induced PC12 cell spreading and movement.
Park SY, etal., Cell Signal. 2007 Feb;19(2):289-300. Epub 2006 Aug 30.
49.
PYK2 signaling is required for PDGF-dependent vascular smooth muscle cell proliferation.
Perez J, etal., Am J Physiol Cell Physiol. 2011 Jul;301(1):C242-51. doi: 10.1152/ajpcell.00315.2010. Epub 2011 Mar 30.
50.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
51.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
52.
Chronic ethanol feeding impairs endothelin-1-stimulated glucose uptake via decreased G alpha 11 expression in rat adipocytes.
Rachdaoui N, etal., Am J Physiol Endocrinol Metab 2003 Aug;285(2):E303-10.
53.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
54.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
55.
A role for PYK2 in ANG II-dependent regulation of the PHAS-1-eIF4E complex by multiple signaling cascades in vascular smooth muscle.
Rocic P, etal., Am J Physiol Cell Physiol. 2003 Dec;285(6):C1437-44. Epub 2003 Jul 30.
56.
Antidepressant effect of the calcium-activated tyrosine kinase Pyk2 in the lateral septum.
Sheehan TP, etal., Biol Psychiatry. 2003 Sep 1;54(5):540-51.
57.
Variations of proline-rich kinase Pyk2 expression correlate with prostate cancer progression.
Stanzione R, etal., Lab Invest. 2001 Jan;81(1):51-9.
58.
Survival response-linked Pyk2 activation during potassium depletion-induced apoptosis of cerebellar granule neurons.
Strappazzon F, etal., Mol Cell Neurosci. 2007 Mar;34(3):355-65. Epub 2006 Dec 22.
59.
Hypertension promotes phosphorylation of focal adhesion kinase and proline-rich tyrosine kinase 2 in rats: implication for the pathogenesis of hypertensive vascular disease.
Sugimura K, etal., Tohoku J Exp Med. 2010 Nov;222(3):201-10.
60.
Increased expression of cell adhesion kinase beta in human and rat crescentic glomerulonephritis.
Takagi C, etal., Am J Kidney Dis 2002 Jan;39(1):174-82.
61.
Pyk2/CAKbeta tyrosine kinase activity-mediated angiogenesis of pulmonary vascular endothelial cells.
Tang H, etal., J Biol Chem 2002 Feb 15;277(7):5441-7.
62.
Pyk2- and Src-dependent tyrosine phosphorylation of PDK1 regulates focal adhesions.
Taniyama Y, etal., Mol Cell Biol. 2003 Nov;23(22):8019-29.
63.
Cerebral ischemia and seizures induce tyrosine phosphorylation of PYK2 in neurons and microglial cells.
Tian D, etal., J Neurosci. 2000 Sep 1;20(17):6478-87.
64.
The role of the Ca2+-sensitive tyrosine kinase Pyk2 and Src in thrombin signalling in rat astrocytes.
Wang H and Reiser G, J Neurochem 2003 Mar;84(6):1349-57.
65.
Expression and characterization of splice variants of PYK2, a focal adhesion kinase-related protein.
Xiong WC, etal., J Cell Sci 1998 Jul 30;111 ( Pt 14):1981-91.
66.
Role of PYK2 in the development of obesity and insulin resistance.
Yu Y, etal., Biochem Biophys Res Commun. 2005 Sep 9;334(4):1085-91.
Ptk2b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 44,536,275 - 44,656,754 (-) NCBI GRCr8 mRatBN7.2 15 40,360,722 - 40,481,235 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 40,360,723 - 40,481,282 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 42,228,028 - 42,348,822 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 43,378,225 - 43,499,021 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 41,821,037 - 41,941,390 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 42,827,306 - 42,947,796 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 42,827,310 - 42,947,656 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 48,646,476 - 48,766,708 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 45,589,222 - 45,717,866 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 45,604,992 - 45,733,824 (-) NCBI Celera 15 40,034,001 - 40,153,993 (-) NCBI Celera Cytogenetic Map 15 p12 NCBI
PTK2B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 27,310,506 - 27,459,391 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 27,311,482 - 27,459,391 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 27,168,995 - 27,316,908 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 27,224,916 - 27,372,820 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 27,238,970 - 27,372,820 NCBI Celera 8 26,131,907 - 26,277,021 (+) NCBI Celera Cytogenetic Map 8 p21.2 NCBI HuRef 8 25,714,123 - 25,861,970 (+) NCBI HuRef CHM1_1 8 27,370,923 - 27,518,777 (+) NCBI CHM1_1 T2T-CHM13v2.0 8 27,583,138 - 27,736,745 (+) NCBI T2T-CHM13v2.0
Ptk2b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 66,390,706 - 66,518,549 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 66,390,706 - 66,518,501 (-) Ensembl GRCm39 Ensembl GRCm38 14 66,153,257 - 66,281,100 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 66,153,257 - 66,281,052 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 66,772,094 - 66,899,889 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 65,107,372 - 65,235,162 (-) NCBI MGSCv36 mm8 Celera 14 63,901,704 - 64,032,818 (-) NCBI Celera Cytogenetic Map 14 D1 NCBI cM Map 14 34.36 NCBI
Ptk2b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955403 49,855,541 - 49,973,225 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955403 49,856,056 - 49,970,800 (+) NCBI ChiLan1.0 ChiLan1.0
PTK2B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 45,841,364 - 45,989,859 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 21,555,525 - 21,704,087 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 26,580,855 - 26,729,378 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 23,783,624 - 23,932,472 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 23,869,825 - 23,932,474 (+) Ensembl panpan1.1 panPan2
PTK2B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 25 30,137,546 - 30,264,221 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 25 30,138,209 - 30,264,133 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 25 30,723,893 - 30,850,311 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 25 30,327,673 - 30,454,390 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 25 30,327,667 - 30,454,389 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 25 30,257,967 - 30,384,306 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 25 30,138,848 - 30,265,191 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 25 30,305,247 - 30,431,983 (-) NCBI UU_Cfam_GSD_1.0
Ptk2b
PTK2B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 11,064,492 - 11,194,192 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 11,063,662 - 11,194,196 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 12,244,257 - 12,375,188 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PTK2B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 25,437,680 - 25,571,594 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 25,437,564 - 25,571,782 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666052 16,572,610 - 16,706,737 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ptk2b
.
Predicted Target Of
Count of predictions: 1070 Count of miRNA genes: 261 Interacting mature miRNAs: 312 Transcripts: ENSRNOT00000030007, ENSRNOT00000030036 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331729 Rf42 Renal function QTL 42 3.071 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 15 17362897 73690657 Rat 1641887 Alcrsp14 Alcohol response QTL 14 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 15 1 42356671 Rat 1582227 Gluco30 Glucose level QTL 30 3.6 0.0003 blood glucose amount (VT:0000188) absolute change in blood glucose level area under curve (CMO:0002034) 15 28030665 82262678 Rat 1582228 Epfw3 Epididymal fat weight QTL 3 4.1 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 1578646 Bmd18 Bone mineral density QTL 18 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 15 22806240 98288169 Rat 1578647 Bmd17 Bone mineral density QTL 17 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 15 22806240 98288169 Rat 10401805 Kidm51 Kidney mass QTL 51 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 15 306329 45306329 Rat 2293686 Bmd36 Bone mineral density QTL 36 7.4 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 15 33611058 71477291 Rat 2317750 Glom26 Glomerulus QTL 26 4.3 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 15 12496141 65205939 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 2293691 Bmd37 Bone mineral density QTL 37 6.6 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 15 33611058 71477291 Rat 2293688 Bss29 Bone structure and strength QTL 29 5.31 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 15 11111142 56111142 Rat 1582214 Stl21 Serum triglyceride level QTL 21 3.1 0.022 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 15 28030665 82262678 Rat 631273 Lecl2 Lens clarity QTL 2 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 15 10596089 55596089 Rat 2300167 Bmd63 Bone mineral density QTL 63 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 731170 Pur3 Proteinuria QTL 3 2.3 0.0005 urine protein amount (VT:0005160) urine protein excretion rate (CMO:0000759) 15 1 41686771 Rat 738017 Hcas7 Hepatocarcinoma susceptibility QTL 7 2.91 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 15 2266368 46921453 Rat 152025253 Hrtrt24 Heart rate QTL 24 3.82 heart pumping trait (VT:2000009) 15 27885774 86257085 Rat 10054130 Srcrt8 Stress Responsive Cort QTL 8 2.18 0.0085 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 15 22117933 67117933 Rat 2300173 Bmd62 Bone mineral density QTL 62 12.8 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 2324620 Coatc3 Coat color QTL 3 coat/hair pigmentation trait (VT:0010463) pigmented coat/hair area to total coat/hair area ratio (CMO:0001810) 15 19856566 46187442 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 1582251 Gluco24 Glucose level QTL 24 3.2 0.0008 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 5530756 50530756 Rat 1598828 Glom14 Glomerulus QTL 14 2.5 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 15 34054139 79054139 Rat 1582242 Gluco28 Glucose level QTL 28 3.3 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 15 28030665 82262678 Rat 1578660 Bss19 Bone structure and strength QTL 19 4.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 15 22806240 98288169 Rat 1582244 Bw79 Body weight QTL 79 4 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 7411725 Strs7 Sensitivity to stroke QTL 7 3.8 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 15 40289901 49308583 Rat
BE120275
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 40,476,452 - 40,476,626 (+) MAPPER mRatBN7.2 Rnor_6.0 15 42,943,009 - 42,943,182 NCBI Rnor6.0 Rnor_5.0 15 48,651,092 - 48,651,265 UniSTS Rnor5.0 RGSC_v3.4 15 45,713,220 - 45,713,393 UniSTS RGSC3.4 Celera 15 40,149,347 - 40,149,520 UniSTS RH 3.4 Map 15 311.61 UniSTS Cytogenetic Map 15 p12 UniSTS
BE120442
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 40,411,680 - 40,411,830 (+) MAPPER mRatBN7.2 Rnor_6.0 15 42,878,251 - 42,878,400 NCBI Rnor6.0 Rnor_5.0 15 48,715,589 - 48,715,738 UniSTS Rnor5.0 RGSC_v3.4 15 45,640,451 - 45,640,600 UniSTS RGSC3.4 Celera 15 40,084,831 - 40,084,980 UniSTS RH 3.4 Map 15 309.6 UniSTS Cytogenetic Map 15 p12 UniSTS
This gene Ptk2b is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000030007 ⟹ ENSRNOP00000031615
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 40,360,723 - 40,481,282 (-) Ensembl Rnor_6.0 Ensembl 15 42,827,310 - 42,947,656 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000030036 ⟹ ENSRNOP00000036813
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 40,360,723 - 40,481,282 (-) Ensembl Rnor_6.0 Ensembl 15 42,827,846 - 42,898,150 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000105571 ⟹ ENSRNOP00000078730
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 40,360,723 - 40,481,282 (-) Ensembl
RefSeq Acc Id:
NM_017318 ⟹ NP_059014
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 44,536,275 - 44,656,628 (-) NCBI mRatBN7.2 15 40,360,732 - 40,481,104 (-) NCBI Rnor_6.0 15 42,827,310 - 42,947,656 (-) NCBI Rnor_5.0 15 48,646,476 - 48,766,708 (+) NCBI RGSC_v3.4 15 45,589,222 - 45,717,866 (-) RGD Celera 15 40,034,001 - 40,153,993 (-) RGD
Sequence:
CTTGCCCAGCCCGGAGCCCTGGCCCGAGTCCGCGCCTCGCCCGAGGGACTGCAATGTGCTGGTCCTAGCTGCAGTCTGAGAGGATGTCCGGGGTGTCTGAGCCCCTGAGCCGTGTAAAAGTGGGCACT
hide sequence
RefSeq Acc Id:
XM_006252145 ⟹ XP_006252207
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 44,536,277 - 44,656,754 (-) NCBI mRatBN7.2 15 40,360,722 - 40,481,235 (-) NCBI Rnor_6.0 15 42,827,306 - 42,947,796 (-) NCBI Rnor_5.0 15 48,646,476 - 48,766,708 (+) NCBI
Sequence:
AAGGAAGTAAAGAGGAGAGCAGCAGGGGTGTGGTTAACGACCGAAAGGAGGAGGTGGGTGGGGGGAAAACAACCTGTCAGCCTCTTACTCAGCCTCTGCCGGCTGAGCCTTGCGTCCTACCTGCTGGC
hide sequence
RefSeq Acc Id:
XM_008770773 ⟹ XP_008768995
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 44,536,277 - 44,605,237 (-) NCBI mRatBN7.2 15 40,360,722 - 40,429,442 (-) NCBI Rnor_6.0 15 42,827,306 - 42,897,560 (-) NCBI
Sequence:
TCTTCCTTCCTATCCCCTTCCCTTTTCTTTCTTTCTAATTTCAGATAAACTGATGATCTCTCTC
hide sequence
RefSeq Acc Id:
XM_008770774 ⟹ XP_008768996
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 44,536,277 - 44,598,788 (-) NCBI mRatBN7.2 15 40,360,722 - 40,423,256 (-) NCBI Rnor_6.0 15 42,827,306 - 42,894,599 (-) NCBI
Sequence:
GGGAATTGAACCCAGGTCCTCTTGAAGAACAGCTTGTGCTCGTAACTACAGATCCATCTCTCCAGCCCCTCAAGTTTTCTTTTTTATTACCATTTTTAAATTAAATATCTGGATCACATTAGATCCCT
hide sequence
RefSeq Acc Id:
XM_039093607 ⟹ XP_038949535
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 44,536,277 - 44,656,754 (-) NCBI mRatBN7.2 15 40,360,722 - 40,481,235 (-) NCBI
RefSeq Acc Id:
XM_039093608 ⟹ XP_038949536
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 44,536,277 - 44,590,202 (-) NCBI mRatBN7.2 15 40,360,722 - 40,414,740 (-) NCBI
RefSeq Acc Id:
XM_063274587 ⟹ XP_063130657
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 44,536,277 - 44,656,754 (-) NCBI
RefSeq Acc Id:
NP_059014 ⟸ NM_017318
- UniProtKB:
Q3T1H4 (UniProtKB/Swiss-Prot), O88489 (UniProtKB/Swiss-Prot), Q63201 (UniProtKB/Swiss-Prot), P70600 (UniProtKB/Swiss-Prot), A6K6M1 (UniProtKB/TrEMBL), A6K6M2 (UniProtKB/TrEMBL)
- Sequence:
MSGVSEPLSRVKVGTLRPPEGPPEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVKCTVQTEIQEIITSILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECLHVEAEWR
hide sequence
RefSeq Acc Id:
XP_006252207 ⟸ XM_006252145
- Peptide Label:
isoform X2
- UniProtKB:
A6K6M2 (UniProtKB/TrEMBL)
- Sequence:
MSGVSEPLSRVKVGTLRPPEGPPEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVKCTVQTEIQEIITSILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECLHVEAEWR
hide sequence
RefSeq Acc Id:
XP_008768995 ⟸ XM_008770773
- Peptide Label:
isoform X1
- UniProtKB:
Q3T1H4 (UniProtKB/Swiss-Prot), O88489 (UniProtKB/Swiss-Prot), Q63201 (UniProtKB/Swiss-Prot), P70600 (UniProtKB/Swiss-Prot), A6K6M1 (UniProtKB/TrEMBL), A6K6M2 (UniProtKB/TrEMBL)
- Sequence:
MSGVSEPLSRVKVGTLRPPEGPPEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVKCTVQTEIQEIITSILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECLHVEAEWR
hide sequence
RefSeq Acc Id:
XP_008768996 ⟸ XM_008770774
- Peptide Label:
isoform X1
- UniProtKB:
Q3T1H4 (UniProtKB/Swiss-Prot), O88489 (UniProtKB/Swiss-Prot), Q63201 (UniProtKB/Swiss-Prot), P70600 (UniProtKB/Swiss-Prot), A6K6M1 (UniProtKB/TrEMBL), A6K6M2 (UniProtKB/TrEMBL)
- Sequence:
MSGVSEPLSRVKVGTLRPPEGPPEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVKCTVQTEIQEIITSILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECLHVEAEWR
hide sequence
Ensembl Acc Id:
ENSRNOP00000036813 ⟸ ENSRNOT00000030036
Ensembl Acc Id:
ENSRNOP00000031615 ⟸ ENSRNOT00000030007
RefSeq Acc Id:
XP_038949535 ⟸ XM_039093607
- Peptide Label:
isoform X1
- UniProtKB:
Q3T1H4 (UniProtKB/Swiss-Prot), P70600 (UniProtKB/Swiss-Prot), O88489 (UniProtKB/Swiss-Prot), Q63201 (UniProtKB/Swiss-Prot), A6K6M1 (UniProtKB/TrEMBL), A6K6M2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038949536 ⟸ XM_039093608
- Peptide Label:
isoform X3
- UniProtKB:
A6K6M2 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000078730 ⟸ ENSRNOT00000105571
RefSeq Acc Id:
XP_063130657 ⟸ XM_063274587
- Peptide Label:
isoform X2
- UniProtKB:
A6K6M2 (UniProtKB/TrEMBL)
RGD ID: 13699756 Promoter ID: EPDNEW_R10279 Type: initiation region Name: Ptk2b_1 Description: protein tyrosine kinase 2 beta SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 42,947,710 - 42,947,770 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-03-20
Ptk2b
protein tyrosine kinase 2 beta
Ptk2b
PTK2B protein tyrosine kinase 2 beta
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-11-20
Ptk2b
PTK2B protein tyrosine kinase 2 beta
Ptk2b
PTK2 protein tyrosine kinase 2 beta
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-05-15
Ptk2b
PTK2 protein tyrosine kinase 2 beta
Ptk2b
protein tyrosine kinase 2 beta
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Ptk2b
protein tyrosine kinase 2 beta
Symbol and Name status set to approved
1299863 APPROVED
2003-02-27
Ptk2b
protein tyrosine kinase 2 beta
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
selectively expressed in the lung and pulmonary vascular endothelial cells
70597
gene_physical_interaction
forms a complex with Src tyrosine kinase in response to thrombin stimulation
729770
gene_process
involved in cell motility, cell spreading, migration and morphogenesis processes
70597
gene_process
involved in angiogenesis
70597
gene_process
kinase activity may be involved in the expression of FAK and Cas proteins
70597
gene_process
regulator of pulmonary angiogenesis
70597
