Symbol:
Mafk
Name:
MAF bZIP transcription factor K
RGD ID:
628633
Description:
Enables RING-like zinc finger domain binding activity. Involved in nervous system development. Predicted to be located in nucleoplasm. Orthologous to human MAFK (MAF bZIP transcription factor K); PARTICIPATES IN nuclear factor, erythroid 2 like 2 signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding (Ensembl: lncRNA)
RefSeq Status:
PROVISIONAL
Previously known as:
transcription factor MafK; v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog K; v-maf musculoaponeurotic fibrosarcoma oncogene family, protein K; v-maf musculoaponeurotic fibrosarcoma oncogene family, protein K (avian); v-maf musculoaponeurotic fibrosarcoma oncogene homolog K; v-maf musculoaponeurotic fibrosarcoma oncogene homolog K (avian)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MAFK (MAF bZIP transcription factor K) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Mafk (v-maf musculoaponeurotic fibrosarcoma oncogene family, protein K (avian)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mafk (MAF bZIP transcription factor K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MAFK (MAF bZIP transcription factor K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MAFK (MAF bZIP transcription factor K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mafk (MAF bZIP transcription factor K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MAFK (MAF bZIP transcription factor K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MAFK (MAF bZIP transcription factor K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mafk (MAF bZIP transcription factor K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Mafk (v-maf musculoaponeurotic fibrosarcoma oncogene family, protein K (avian))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MAFK (MAF bZIP transcription factor K)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mafk (v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog K)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
maf-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
maf-S
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mafk
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 19,948,473 - 19,970,351 (-) NCBI GRCr8 mRatBN7.2 12 14,834,628 - 14,856,414 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 14,833,984 - 14,837,048 (+) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 12 14,832,249 - 14,858,888 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 15,643,621 - 15,654,344 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 16,267,374 - 16,278,097 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 15,292,794 - 15,303,525 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 16,923,989 - 16,934,706 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 16,923,990 - 16,934,706 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 18,914,796 - 18,936,523 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 15,312,420 - 15,323,137 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 15,342,348 - 15,353,065 (-) NCBI Celera 12 16,593,511 - 16,604,228 (-) NCBI Celera Cytogenetic Map 12 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mafk Rat (E)-cinnamyl alcohol increases expression ISO MAFK (Homo sapiens) 6480464 cinnamyl alcohol results in increased expression of MAFK mRNA CTD PMID:20566472 Mafk Rat 1,2-dimethylhydrazine multiple interactions ISO Mafk (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MAFK mRNA CTD PMID:22206623 Mafk Rat 1,2-dimethylhydrazine decreases expression ISO Mafk (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of MAFK mRNA CTD PMID:22206623 Mafk Rat 1-chloro-2,4-dinitrobenzene increases expression ISO MAFK (Homo sapiens) 6480464 Dinitrochlorobenzene results in increased expression of MAFK mRNA CTD PMID:17374397 and PMID:20566472 Mafk Rat 17alpha-ethynylestradiol increases expression ISO Mafk (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of MAFK mRNA CTD PMID:17942748 Mafk Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Mafk (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of MAFK mRNA CTD PMID:19770486 more ... Mafk Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MAFK mRNA CTD PMID:32109520 Mafk Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Mafk (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to MAFK gene] CTD PMID:28213091 Mafk Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mafk (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MAFK mRNA CTD PMID:21570461 Mafk Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MAFK mRNA CTD PMID:21215274 and PMID:33387578 Mafk Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MAFK mRNA CTD PMID:22298810 Mafk Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of MAFK mRNA CTD PMID:21346803 Mafk Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of MAFK mRNA CTD PMID:21346803 Mafk Rat 2-palmitoylglycerol increases expression ISO MAFK (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of MAFK mRNA CTD PMID:37199045 Mafk Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one increases expression ISO MAFK (Homo sapiens) 6480464 Oxazolone results in increased expression of MAFK mRNA CTD PMID:17374397 Mafk Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of MAFK mRNA CTD PMID:24780913 Mafk Rat acrolein multiple interactions ISO MAFK (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of MAFK mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of MAFK mRNA CTD PMID:32699268 Mafk Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of MAFK mRNA CTD PMID:28959563 Mafk Rat acrylamide increases expression ISO MAFK (Homo sapiens) 6480464 Acrylamide results in increased expression of MAFK mRNA CTD PMID:32763439 Mafk Rat alpha-hexylcinnamaldehyde increases expression ISO MAFK (Homo sapiens) 6480464 hexyl cinnamic aldehyde results in increased expression of MAFK mRNA CTD PMID:20566472 Mafk Rat alpha-pinene multiple interactions ISO MAFK (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of MAFK mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of MAFK mRNA CTD PMID:32699268 Mafk Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MAFK mRNA CTD PMID:16483693 Mafk Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of MAFK mRNA CTD PMID:30779732 Mafk Rat aristolochic acid A increases expression ISO MAFK (Homo sapiens) 6480464 aristolochic acid I results in increased expression of MAFK mRNA CTD PMID:33212167 Mafk Rat arsenous acid affects methylation ISO MAFK (Homo sapiens) 6480464 Arsenic Trioxide affects the methylation of MAFK promoter CTD PMID:26046465 Mafk Rat Bandrowski's base increases expression ISO MAFK (Homo sapiens) 6480464 Bandrowski's base results in increased expression of MAFK mRNA CTD PMID:20566472 Mafk Rat benzene decreases expression ISO MAFK (Homo sapiens) 6480464 Benzene results in decreased expression of MAFK mRNA CTD PMID:33064461 Mafk Rat benzo[a]pyrene increases expression ISO Mafk (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MAFK mRNA CTD PMID:19770486 more ... Mafk Rat benzo[a]pyrene affects methylation ISO MAFK (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MAFK 5' UTR CTD PMID:27901495 Mafk Rat benzo[a]pyrene increases methylation ISO MAFK (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of MAFK promoter CTD PMID:27901495 Mafk Rat beta-lapachone increases expression ISO MAFK (Homo sapiens) 6480464 beta-lapachone results in increased expression of MAFK mRNA CTD PMID:38218311 Mafk Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of MAFK mRNA CTD PMID:18164116 Mafk Rat bis(2-chloroethyl) sulfide multiple interactions ISO Mafk (Mus musculus) 6480464 Dimercaprol inhibits the reaction [Mustard Gas results in increased expression of MAFK mRNA] CTD PMID:16377760 Mafk Rat bis(2-chloroethyl) sulfide increases expression ISO Mafk (Mus musculus) 6480464 Mustard Gas results in increased expression of MAFK mRNA CTD PMID:15674843 and PMID:16377760 Mafk Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Mafk (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MAFK mRNA CTD PMID:39150890 Mafk Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MAFK mRNA CTD PMID:25181051 Mafk Rat bisphenol A increases expression ISO Mafk (Mus musculus) 6480464 bisphenol A results in increased expression of MAFK mRNA CTD PMID:34585602 Mafk Rat bisphenol A decreases expression ISO MAFK (Homo sapiens) 6480464 bisphenol A results in decreased expression of MAFK mRNA CTD PMID:29275510 Mafk Rat bisphenol A affects expression ISO MAFK (Homo sapiens) 6480464 bisphenol A affects the expression of MAFK mRNA CTD PMID:30903817 Mafk Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MAFK mRNA CTD PMID:30816183 and PMID:32528016 Mafk Rat bisphenol A decreases methylation ISO Mafk (Mus musculus) 6480464 bisphenol A results in decreased methylation of MAFK promoter CTD PMID:27312807 Mafk Rat Butylbenzyl phthalate multiple interactions ISO Mafk (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MAFK mRNA CTD PMID:39150890 Mafk Rat cadmium atom multiple interactions ISO Mafk (Mus musculus) 6480464 Cadmium inhibits the reaction [MAFK protein affects the localization of BACH2 protein] CTD PMID:14504288 Mafk Rat cadmium atom multiple interactions ISO MAFK (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MAFK mRNA CTD PMID:35301059 Mafk Rat cadmium dichloride increases expression ISO Mafk (Mus musculus) 6480464 Cadmium Chloride results in increased expression of MAFK mRNA CTD PMID:20061341 Mafk Rat cadmium dichloride multiple interactions ISO MAFK (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MAFK mRNA CTD PMID:35301059 Mafk Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of MAFK mRNA CTD PMID:19010381 Mafk Rat caffeine increases phosphorylation ISO MAFK (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of MAFK protein CTD PMID:35688186 Mafk Rat chenodeoxycholic acid multiple interactions ISO MAFK (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA CTD PMID:32152650 Mafk Rat cinnamyl alcohol increases expression ISO MAFK (Homo sapiens) 6480464 cinnamyl alcohol results in increased expression of MAFK mRNA CTD PMID:20566472 Mafk Rat cisplatin decreases expression ISO MAFK (Homo sapiens) 6480464 Cisplatin results in decreased expression of MAFK mRNA CTD PMID:27392435 and PMID:27594783 Mafk Rat cisplatin multiple interactions ISO MAFK (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of MAFK mRNA CTD PMID:27392435 Mafk Rat clobetasol increases expression ISO Mafk (Mus musculus) 6480464 Clobetasol results in increased expression of MAFK mRNA CTD PMID:27462272 Mafk Rat clofibrate multiple interactions ISO Mafk (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of MAFK mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of MAFK mRNA] CTD PMID:17585979 Mafk Rat clofibrate decreases expression ISO Mafk (Mus musculus) 6480464 Clofibrate results in decreased expression of MAFK mRNA CTD PMID:17585979 Mafk Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of MAFK mRNA CTD PMID:24386269 Mafk Rat cobalt dichloride increases expression ISO MAFK (Homo sapiens) 6480464 cobaltous chloride results in increased expression of MAFK mRNA CTD PMID:19320972 Mafk Rat copper(II) sulfate increases expression ISO MAFK (Homo sapiens) 6480464 Copper Sulfate results in increased expression of MAFK mRNA CTD PMID:19549813 Mafk Rat coumarin increases phosphorylation ISO MAFK (Homo sapiens) 6480464 coumarin results in increased phosphorylation of MAFK protein CTD PMID:35688186 Mafk Rat CU-O LINKAGE increases expression ISO MAFK (Homo sapiens) 6480464 cupric oxide results in increased expression of MAFK mRNA CTD PMID:22077320 Mafk Rat cyclosporin A increases expression ISO MAFK (Homo sapiens) 6480464 Cyclosporine results in increased expression of MAFK mRNA CTD PMID:20106945 more ... Mafk Rat cyclosporin A multiple interactions ISO MAFK (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA CTD PMID:32152650 Mafk Rat cyclosporin A decreases methylation ISO MAFK (Homo sapiens) 6480464 Cyclosporine results in decreased methylation of MAFK promoter CTD PMID:27989131 Mafk Rat DDE decreases expression ISO MAFK (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of MAFK mRNA CTD PMID:38568856 Mafk Rat deoxycholic acid multiple interactions ISO MAFK (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA CTD PMID:32152650 Mafk Rat diarsenic trioxide affects methylation ISO MAFK (Homo sapiens) 6480464 Arsenic Trioxide affects the methylation of MAFK promoter CTD PMID:26046465 Mafk Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of MAFK mRNA CTD PMID:22546817 Mafk Rat Dibutyl phosphate affects expression ISO MAFK (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MAFK mRNA CTD PMID:37042841 Mafk Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of MAFK mRNA CTD PMID:21266533 Mafk Rat dibutyl phthalate multiple interactions ISO Mafk (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MAFK mRNA CTD PMID:39150890 Mafk Rat dibutyl phthalate increases expression ISO Mafk (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of MAFK mRNA CTD PMID:17361019 and PMID:21266533 Mafk Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of MAFK mRNA CTD PMID:22546817 Mafk Rat diethyl phthalate multiple interactions ISO Mafk (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MAFK mRNA CTD PMID:39150890 Mafk Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of MAFK mRNA CTD PMID:21658437 Mafk Rat diisobutyl phthalate multiple interactions ISO Mafk (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MAFK mRNA CTD PMID:39150890 Mafk Rat diisononyl phthalate multiple interactions ISO Mafk (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MAFK mRNA CTD PMID:39150890 Mafk Rat dimercaprol multiple interactions ISO Mafk (Mus musculus) 6480464 Dimercaprol inhibits the reaction [Mustard Gas results in increased expression of MAFK mRNA] CTD PMID:16377760 Mafk Rat dioxygen multiple interactions ISO Mafk (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of MAFK mRNA CTD PMID:30529165 Mafk Rat disulfiram increases expression ISO MAFK (Homo sapiens) 6480464 Disulfiram results in increased expression of MAFK mRNA CTD PMID:20566472 Mafk Rat dorsomorphin multiple interactions ISO MAFK (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAFK mRNA CTD PMID:27188386 Mafk Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of MAFK mRNA CTD PMID:29391264 Mafk Rat eugenol increases expression ISO MAFK (Homo sapiens) 6480464 Eugenol results in increased expression of MAFK mRNA CTD PMID:20566472 Mafk Rat fluoranthene multiple interactions ISO Mafk (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of MAFK mRNA CTD PMID:28329830 Mafk Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of MAFK mRNA CTD PMID:24136188 and PMID:24793618 Mafk Rat folic acid multiple interactions ISO Mafk (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MAFK mRNA CTD PMID:22206623 Mafk Rat folic acid decreases expression ISO Mafk (Mus musculus) 6480464 Folic Acid results in decreased expression of MAFK mRNA CTD PMID:25629700 Mafk Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of MAFK mRNA CTD PMID:33387578 Mafk Rat glycochenodeoxycholic acid multiple interactions ISO MAFK (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA CTD PMID:32152650 Mafk Rat glycocholic acid multiple interactions ISO MAFK (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA CTD PMID:32152650 Mafk Rat glycodeoxycholic acid multiple interactions ISO MAFK (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA CTD PMID:32152650 Mafk Rat glyphosate increases expression ISO Mafk (Mus musculus) 6480464 Glyphosate results in increased expression of MAFK mRNA CTD PMID:35897073 Mafk Rat hydroquinone O-beta-D-glucopyranoside decreases expression ISO MAFK (Homo sapiens) 6480464 Arbutin results in decreased expression of MAFK mRNA CTD PMID:17103032 Mafk Rat isoeugenol increases expression ISO MAFK (Homo sapiens) 6480464 isoeugenol results in increased expression of MAFK mRNA CTD PMID:20566472 Mafk Rat kojic acid decreases expression ISO MAFK (Homo sapiens) 6480464 kojic acid results in decreased expression of MAFK mRNA CTD PMID:16595896 Mafk Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of MAFK mRNA CTD PMID:24136188 Mafk Rat lipopolysaccharide increases expression ISO Mafk (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of MAFK mRNA CTD PMID:10975854 Mafk Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of MAFK mRNA CTD PMID:19564919 Mafk Rat methoxychlor increases methylation EXP 6480464 Methoxychlor results in increased methylation of MAFK gene CTD PMID:23303685 Mafk Rat methylmercury chloride increases expression ISO Mafk (Mus musculus) 6480464 methylmercuric chloride results in increased expression of MAFK mRNA CTD PMID:20061341 Mafk Rat methylmercury chloride increases expression ISO MAFK (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of MAFK mRNA CTD PMID:28001369 Mafk Rat mono(2-ethylhexyl) phthalate increases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of MAFK mRNA CTD PMID:16809437 Mafk Rat N-methylformamide affects expression ISO Mafk (Mus musculus) 6480464 methylformamide affects the expression of MAFK mRNA and methylformamide analog affects the expression of MAFK mRNA CTD PMID:17040096 Mafk Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of MAFK mRNA CTD PMID:18164116 Mafk Rat nefazodone increases expression ISO MAFK (Homo sapiens) 6480464 nefazodone results in increased expression of MAFK mRNA CTD PMID:32152650 Mafk Rat nefazodone multiple interactions ISO MAFK (Homo sapiens) 6480464 [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA CTD PMID:32152650 Mafk Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of MAFK mRNA CTD PMID:22546817 Mafk Rat nickel sulfate increases expression ISO MAFK (Homo sapiens) 6480464 nickel sulfate results in increased expression of MAFK mRNA CTD PMID:17374397 and PMID:20566472 Mafk Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of MAFK mRNA CTD PMID:33484710 Mafk Rat ozone multiple interactions ISO MAFK (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of MAFK mRNA more ... CTD PMID:32699268 and PMID:35430440 Mafk Rat ozone multiple interactions ISO Mafk (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of MAFK mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of MAFK mRNA CTD PMID:34911549 Mafk Rat paracetamol multiple interactions ISO Mafk (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of MAFK mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of MAFK mRNA] CTD PMID:17585979 Mafk Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of MAFK mRNA CTD PMID:33387578 Mafk Rat paracetamol increases expression ISO MAFK (Homo sapiens) 6480464 Acetaminophen results in increased expression of MAFK mRNA CTD PMID:29067470 Mafk Rat paracetamol affects expression ISO Mafk (Mus musculus) 6480464 Acetaminophen affects the expression of MAFK mRNA CTD PMID:17562736 Mafk Rat paraquat increases expression ISO Mafk (Mus musculus) 6480464 Paraquat results in increased expression of MAFK mRNA CTD PMID:12595580 Mafk Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of MAFK mRNA CTD PMID:32680482 Mafk Rat pentachlorophenol increases expression ISO Mafk (Mus musculus) 6480464 Pentachlorophenol results in increased expression of MAFK mRNA CTD PMID:23892564 Mafk Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of MAFK mRNA CTD PMID:19162173 Mafk Rat phenobarbital multiple interactions ISO Mafk (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of MAFK mRNA] CTD PMID:19482888 Mafk Rat phenobarbital affects expression ISO MAFK (Homo sapiens) 6480464 Phenobarbital affects the expression of MAFK mRNA CTD PMID:19159669 Mafk Rat phenobarbital increases expression ISO Mafk (Mus musculus) 6480464 Phenobarbital results in increased expression of MAFK mRNA CTD PMID:19482888 Mafk Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of MAFK mRNA CTD PMID:18158353 Mafk Rat phenylmercury acetate increases expression ISO MAFK (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of MAFK mRNA CTD PMID:26272509 Mafk Rat phenylmercury acetate multiple interactions ISO MAFK (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAFK mRNA CTD PMID:27188386 Mafk Rat reactive oxygen species increases expression ISO MAFK (Homo sapiens) 6480464 Reactive Oxygen Species results in increased expression of MAFK mRNA CTD PMID:25800948 Mafk Rat SB 431542 multiple interactions ISO MAFK (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAFK mRNA CTD PMID:27188386 Mafk Rat senecionine increases expression ISO Mafk (Mus musculus) 6480464 senecionine results in increased expression of MAFK protein CTD PMID:35357534 Mafk Rat silicon dioxide increases expression ISO Mafk (Mus musculus) 6480464 Silicon Dioxide results in increased expression of MAFK mRNA CTD PMID:19073995 and PMID:33720480 Mafk Rat silver atom increases expression ISO MAFK (Homo sapiens) 6480464 Silver results in increased expression of MAFK mRNA CTD PMID:26014281 Mafk Rat silver(0) increases expression ISO MAFK (Homo sapiens) 6480464 Silver results in increased expression of MAFK mRNA CTD PMID:26014281 Mafk Rat sodium arsenite increases expression ISO MAFK (Homo sapiens) 6480464 sodium arsenite results in increased expression of MAFK mRNA CTD PMID:20886546 and PMID:38568856 Mafk Rat sodium arsenite increases expression ISO Mafk (Mus musculus) 6480464 sodium arsenite results in increased expression of MAFK mRNA CTD PMID:16014739 Mafk Rat sodium arsenite multiple interactions ISO Mafk (Mus musculus) 6480464 sodium arsenite promotes the reaction [[NFE2L2 protein binds to MAFK protein] which binds to NQO1 promoter] CTD PMID:16785233 Mafk Rat Soman increases expression EXP 6480464 Soman results in increased expression of MAFK mRNA CTD PMID:19281266 Mafk Rat tacrolimus hydrate increases expression ISO Mafk (Mus musculus) 6480464 Tacrolimus results in increased expression of MAFK mRNA CTD PMID:23958496 Mafk Rat tamoxifen increases expression ISO Mafk (Mus musculus) 6480464 Tamoxifen results in increased expression of MAFK mRNA CTD PMID:17555576 Mafk Rat tert-butyl hydroperoxide increases methylation ISO MAFK (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased methylation of MAFK gene CTD PMID:27509014 Mafk Rat tert-butyl hydroperoxide increases expression ISO MAFK (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of MAFK mRNA CTD PMID:27509014 Mafk Rat tetrachloromethane increases expression ISO Mafk (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of MAFK mRNA CTD PMID:31919559 Mafk Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of MAFK mRNA CTD PMID:23411599 and PMID:34492290 Mafk Rat thiram increases expression ISO MAFK (Homo sapiens) 6480464 Thiram results in increased expression of MAFK mRNA CTD PMID:38568856 Mafk Rat titanium dioxide increases expression ISO Mafk (Mus musculus) 6480464 titanium dioxide results in increased expression of MAFK mRNA CTD PMID:27760801 Mafk Rat titanium dioxide decreases methylation ISO Mafk (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MAFK promoter CTD PMID:35295148 Mafk Rat trans-isoeugenol increases expression ISO MAFK (Homo sapiens) 6480464 isoeugenol results in increased expression of MAFK mRNA CTD PMID:20566472 Mafk Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of MAFK mRNA CTD PMID:33387578 Mafk Rat triphenyl phosphate affects expression ISO MAFK (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MAFK mRNA CTD PMID:37042841 Mafk Rat triptonide increases expression ISO Mafk (Mus musculus) 6480464 triptonide results in increased expression of MAFK mRNA CTD PMID:33045310 Mafk Rat urethane increases expression ISO MAFK (Homo sapiens) 6480464 Urethane results in increased expression of MAFK mRNA CTD PMID:28818685 Mafk Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of MAFK mRNA CTD PMID:24136188 Mafk Rat valproic acid increases methylation ISO MAFK (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MAFK gene CTD PMID:29154799 Mafk Rat valproic acid increases expression ISO MAFK (Homo sapiens) 6480464 Valproic Acid results in increased expression of MAFK mRNA CTD PMID:28001369 Mafk Rat xylitol increases expression ISO MAFK (Homo sapiens) 6480464 Xylitol results in increased expression of MAFK mRNA CTD PMID:32275922 Mafk Rat zinc atom multiple interactions ISO MAFK (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of MAFK mRNA CTD PMID:18593933 Mafk Rat zinc(0) multiple interactions ISO MAFK (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of MAFK mRNA CTD PMID:18593933
(E)-cinnamyl alcohol (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-palmitoylglycerol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) acrylamide (EXP,ISO) alpha-hexylcinnamaldehyde (ISO) alpha-pinene (ISO) ammonium chloride (EXP) amphetamine (EXP) aristolochic acid A (ISO) arsenous acid (ISO) Bandrowski's base (ISO) benzene (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) beta-naphthoflavone (EXP) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Butylbenzyl phthalate (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) chenodeoxycholic acid (ISO) cinnamyl alcohol (ISO) cisplatin (ISO) clobetasol (ISO) clofibrate (ISO) cobalt dichloride (EXP,ISO) copper(II) sulfate (ISO) coumarin (ISO) CU-O LINKAGE (ISO) cyclosporin A (ISO) DDE (ISO) deoxycholic acid (ISO) diarsenic trioxide (ISO) diazinon (EXP) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dieldrin (EXP) diethyl phthalate (ISO) diethylstilbestrol (EXP) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dimercaprol (ISO) dioxygen (ISO) disulfiram (ISO) dorsomorphin (ISO) endosulfan (EXP) eugenol (ISO) fluoranthene (ISO) flutamide (EXP) folic acid (ISO) gentamycin (EXP) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) glyphosate (ISO) hydroquinone O-beta-D-glucopyranoside (ISO) isoeugenol (ISO) kojic acid (ISO) leflunomide (EXP) lipopolysaccharide (ISO) methamphetamine (EXP) methoxychlor (EXP) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (EXP) N-methylformamide (ISO) N-nitrosodiethylamine (EXP) nefazodone (ISO) nickel dichloride (EXP) nickel sulfate (ISO) nitrofen (EXP) ozone (ISO) paracetamol (EXP,ISO) paraquat (EXP,ISO) pentachlorophenol (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) phenylephrine (EXP) phenylmercury acetate (ISO) reactive oxygen species (ISO) SB 431542 (ISO) senecionine (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) Soman (EXP) tacrolimus hydrate (ISO) tamoxifen (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trans-isoeugenol (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) triptonide (ISO) urethane (ISO) valdecoxib (EXP) valproic acid (ISO) xylitol (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
The Nrf2 regulatory network provides an interface between redox and intermediary metabolism.
Hayes JD and Dinkova-Kostova AT, Trends Biochem Sci. 2014 Apr;39(4):199-218. doi: 10.1016/j.tibs.2014.02.002. Epub 2014 Mar 16.
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
The carboxy-terminal Neh3 domain of Nrf2 is required for transcriptional activation.
Nioi P, etal., Mol Cell Biol. 2005 Dec;25(24):10895-906.
5.
Histone acetyltransferase MOZ acts as a co-activator of Nrf2-MafK and induces tumour marker gene expression during hepatocarcinogenesis.
Ohta K, etal., Biochem J. 2007 Mar 15;402(3):559-66.
6.
GOA pipeline
RGD automated data pipeline
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
9.
The basic region and leucine zipper transcription factor MafK is a new nerve growth factor-responsive immediate early gene that regulates neurite outgrowth.
Torocsik B, etal., J Neurosci 2002 Oct 15;22(20):8971-80.
Mafk Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 19,948,473 - 19,970,351 (-) NCBI GRCr8 mRatBN7.2 12 14,834,628 - 14,856,414 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 14,833,984 - 14,837,048 (+) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 12 14,832,249 - 14,858,888 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 15,643,621 - 15,654,344 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 16,267,374 - 16,278,097 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 15,292,794 - 15,303,525 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 16,923,989 - 16,934,706 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 16,923,990 - 16,934,706 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 18,914,796 - 18,936,523 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 15,312,420 - 15,323,137 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 15,342,348 - 15,353,065 (-) NCBI Celera 12 16,593,511 - 16,604,228 (-) NCBI Celera Cytogenetic Map 12 q11 NCBI
MAFK Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 1,530,702 - 1,543,043 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 1,530,702 - 1,543,043 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 1,570,338 - 1,582,679 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 1,536,894 - 1,549,205 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 1,343,608 - 1,354,151 NCBI Celera 7 1,537,624 - 1,549,935 (+) NCBI Celera Cytogenetic Map 7 p22.3 NCBI HuRef 7 1,499,263 - 1,503,161 (+) NCBI HuRef CHM1_1 7 1,569,960 - 1,582,262 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 1,642,830 - 1,655,171 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 1,622,776 - 1,635,087 (+) NCBI
Mafk Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 139,777,291 - 139,788,409 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 139,777,268 - 139,788,408 (+) Ensembl GRCm39 Ensembl GRCm38 5 139,791,536 - 139,802,653 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 139,791,513 - 139,802,653 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 140,267,490 - 140,278,606 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 140,044,010 - 140,055,126 (+) NCBI MGSCv36 mm8 Celera 5 136,846,479 - 136,857,581 (+) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 78.81 NCBI
Mafk Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955460 9,155,713 - 9,167,291 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955460 9,155,713 - 9,167,291 (+) NCBI ChiLan1.0 ChiLan1.0
MAFK Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 6,480,254 - 6,492,566 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 54,804,956 - 54,817,267 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 1,778,862 - 1,791,163 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 1,902,411 - 1,909,774 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 1,904,031 - 1,909,774 (+) Ensembl panpan1.1 panPan2
MAFK Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 15,421,918 - 15,426,650 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 15,424,095 - 15,425,594 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 16,889,609 - 16,901,307 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 15,547,885 - 15,559,587 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 15,547,886 - 15,559,718 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 15,350,661 - 15,362,365 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 15,277,453 - 15,289,141 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 15,564,445 - 15,576,148 (-) NCBI UU_Cfam_GSD_1.0
Mafk Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 143,353,784 - 143,364,317 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936754 1,651,704 - 1,656,549 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936754 1,652,412 - 1,656,570 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MAFK Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 1,030,858 - 1,033,671 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 1,023,366 - 1,034,855 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 1,138,008 - 1,149,711 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MAFK Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 28 20,057,386 - 20,070,020 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 28 20,060,001 - 20,061,170 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666090 1,647,542 - 1,659,816 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mafk
.
Assembly: mRatBN7.2 Assembly: RGSC_v3.4 Assembly: Rnor_6.0
Predicted Target Of
Count of predictions: 233 Count of miRNA genes: 153 Interacting mature miRNAs: 173 Transcripts: ENSRNOT00000001720 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
2312418 Kidm41 Kidney mass QTL 41 3.7 0.0001 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 12 1 19611090 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 8525423 28064601 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1331786 Kidm11 Kidney mass QTL 11 3.571 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 12 11073825 24234895 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 1600391 Edcs2 Endometrial carcinoma susceptibility QTL2 3.5 0.01 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 12 6833190 17870186 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 61416 Pia4 Pristane induced arthritis QTL 4 8.4 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 12 13635523 30827399 Rat 7204484 Bp358 Blood pressure QTL 358 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 13008296 19212979 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 61421 Cia12 Collagen induced arthritis QTL 12 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 13635523 35682913 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 8449490 28302290 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1331755 Bp219 Blood pressure QTL 219 3.041 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 28064557 Rat
BI284461
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 12 19,948,900 - 19,949,085 (+) Marker Load Pipeline mRatBN7.2 12 14,835,053 - 14,835,238 (+) MAPPER mRatBN7.2 Rnor_6.0 12 16,924,415 - 16,924,599 NCBI Rnor6.0 Rnor_5.0 12 18,915,222 - 18,915,406 UniSTS Rnor5.0 RGSC_v3.4 12 15,312,846 - 15,313,030 UniSTS RGSC3.4 Celera 12 16,593,937 - 16,594,121 UniSTS RH 3.4 Map 12 237.72 UniSTS Cytogenetic Map 12 q11 UniSTS
Mafk
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 14,834,656 - 14,835,244 (+) MAPPER mRatBN7.2 Rnor_6.0 12 16,924,018 - 16,924,605 NCBI Rnor6.0 Rnor_5.0 12 18,914,825 - 18,915,412 UniSTS Rnor5.0 RGSC_v3.4 12 15,312,449 - 15,313,036 UniSTS RGSC3.4 Celera 12 16,593,540 - 16,594,127 UniSTS Cytogenetic Map 12 q11 UniSTS
UniSTS:257105
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 12 19,950,843 - 19,951,810 (+) Marker Load Pipeline mRatBN7.2 12 14,836,995 - 14,837,963 (+) MAPPER mRatBN7.2 Rnor_6.0 12 16,926,357 - 16,927,324 NCBI Rnor6.0 Rnor_5.0 12 18,917,164 - 18,918,131 UniSTS Rnor5.0 RGSC_v3.4 12 15,314,788 - 15,315,755 UniSTS RGSC3.4 Celera 12 16,595,879 - 16,596,846 UniSTS Cytogenetic Map 12 q11 UniSTS
UniSTS:274182
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 14,836,595 - 14,837,978 (+) MAPPER mRatBN7.2 Rnor_6.0 12 16,925,957 - 16,927,339 NCBI Rnor6.0 Rnor_5.0 12 18,916,764 - 18,918,146 UniSTS Rnor5.0 RGSC_v3.4 12 15,314,388 - 15,315,770 UniSTS RGSC3.4 Celera 12 16,595,479 - 16,596,861 UniSTS Cytogenetic Map 12 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001720 ⟹ ENSRNOP00000001720
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 14,834,630 - 14,858,888 (-) Ensembl Rnor_6.0 Ensembl 12 16,923,990 - 16,934,706 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000094745
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 14,834,443 - 14,839,924 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000098949
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 14,833,984 - 14,837,048 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000099198
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 14,834,634 - 14,856,489 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000117128
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 14,832,249 - 14,845,488 (-) Ensembl
RefSeq Acc Id:
NM_145673 ⟹ NP_663706
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,948,475 - 19,959,192 (-) NCBI mRatBN7.2 12 14,834,628 - 14,845,345 (-) NCBI Rnor_6.0 12 16,923,989 - 16,934,706 (-) NCBI Rnor_5.0 12 18,914,796 - 18,936,523 (-) NCBI RGSC_v3.4 12 15,312,420 - 15,323,137 (-) RGD Celera 12 16,593,511 - 16,604,228 (-) RGD
Sequence:
CCGGGACTTGTTGTTCTTTGCCGAGTCGGAACGAGTAGTCCGAAGCGCGCAGGCGGAGACGGCGACTGAGGGGAGCGCGAGAGCAGAAGCGCGCGTGAAGAGTGCGTGTCTACAGGAGCCGCCGCGCC
hide sequence
RefSeq Acc Id:
XM_006248915 ⟹ XP_006248977
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,948,473 - 19,957,286 (-) NCBI mRatBN7.2 12 14,834,628 - 14,843,437 (-) NCBI Rnor_6.0 12 16,923,989 - 16,931,564 (-) NCBI Rnor_5.0 12 18,914,796 - 18,936,523 (-) NCBI
Sequence:
TCCTCTGACCTTCACACCCACTTTGGCAAGTACACACACACACACACACACAGTCTGGACTTAGCTGTTTCCTGGGCACATCCCCACTGAAACATGGAGTAGAAGGTGACTGAAGCCCCAGGACCACC
hide sequence
RefSeq Acc Id:
XM_039089073 ⟹ XP_038945001
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,948,473 - 19,970,351 (-) NCBI mRatBN7.2 12 14,834,628 - 14,856,414 (-) NCBI
RefSeq Acc Id:
NP_663706 ⟸ NM_145673
- UniProtKB:
Q6IRI7 (UniProtKB/TrEMBL), Q8K4B3 (UniProtKB/TrEMBL)
- Sequence:
MTTNPKPNKTLKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLKNRGYAASCRIKRVTQKEELERQRVELQQEVEKLARENSSMRLELDALRSKYEALQTFARTVARGPVTP
hide sequence
RefSeq Acc Id:
XP_006248977 ⟸ XM_006248915
- Peptide Label:
isoform X1
- UniProtKB:
Q6IRI7 (UniProtKB/TrEMBL), Q8K4B3 (UniProtKB/TrEMBL)
- Sequence:
MTTNPKPNKTLKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLKNRGY
hide sequence
Ensembl Acc Id:
ENSRNOP00000001720 ⟸ ENSRNOT00000001720
RefSeq Acc Id:
XP_038945001 ⟸ XM_039089073
- Peptide Label:
isoform X1
- UniProtKB:
Q6IRI7 (UniProtKB/TrEMBL), Q8K4B3 (UniProtKB/TrEMBL)
RGD ID: 13698462 Promoter ID: EPDNEW_R8987 Type: multiple initiation site Name: Mafk_1 Description: MAF bZIP transcription factor K SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 16,934,739 - 16,934,799 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-18
Mafk
MAF bZIP transcription factor K
Mafk
v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog K
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-07-18
Mafk
v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog K
Mafk
v-maf musculoaponeurotic fibrosarcoma oncogene homolog K (avian)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-10-30
Mafk
v-maf musculoaponeurotic fibrosarcoma oncogene homolog K (avian)
Mafk
v-maf musculoaponeurotic fibrosarcoma oncogene family, protein K (avian)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Mafk
v-maf musculoaponeurotic fibrosarcoma oncogene family, protein K (avian)
Symbol and Name status set to approved
1299863 APPROVED
2003-02-27
Mafk
v-maf musculoaponeurotic fibrosarcoma oncogene family, protein K (avian)
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed in immature neurons
628386
gene_process
involved in neuronal outgrowth and maintenance
628386
gene_process
regulator of neuronal differentiation
628386
gene_product
member of the Maf family of basic region and leucine zipper transciption factors
628386
gene_product
member of the Maf family has a leucine zipper transcriptional repressor
628386
gene_regulation
expression in immature neurons is induced by NGF
628386
