Symbol:
Prkch
Name:
protein kinase C, eta
RGD ID:
621888
Description:
Enables diacylglycerol-dependent, calcium-independent serine/threonine kinase activity. Involved in phospholipase C/protein kinase C signal transduction and protein phosphorylation. Predicted to be located in cell-cell junction; cytosol; and plasma membrane. Human ortholog(s) of this gene implicated in cerebral infarction. Orthologous to human PRKCH (protein kinase C eta); PARTICIPATES IN protein kinase C (PKC) signaling pathway; eicosanoid signaling pathway; endothelin signaling pathway; INTERACTS WITH (+)-pilocarpine; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MGC93383; nPKC-eta; PKC-L; protein kinase C eta type; protein kinase C-eta
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRKCH (protein kinase C eta) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Prkch (protein kinase C, eta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Prkch (protein kinase C eta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRKCH (protein kinase C eta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRKCH (protein kinase C eta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prkch (protein kinase C eta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRKCH (protein kinase C eta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PRKCH (protein kinase C eta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prkch (protein kinase C eta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PRKCE (protein kinase C epsilon) HGNC
OrthoDB
Homo sapiens (human):
KCNA7 (potassium voltage-gated channel subfamily A member 7) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Prkch (protein kinase C, eta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PRKCH (protein kinase C eta)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prkcha (protein kinase C, eta, a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prkchb (protein kinase C, eta, b)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
PKC1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Pkc98E
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pkc-1
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
prkch
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 98,027,830 - 98,226,486 (+) NCBI GRCr8 mRatBN7.2 6 92,292,000 - 92,490,663 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 92,292,000 - 92,490,654 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 92,681,221 - 92,880,182 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 92,980,754 - 93,179,715 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 92,408,607 - 92,607,569 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 96,479,243 - 96,677,368 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 96,479,430 - 96,676,225 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 105,910,127 - 106,109,230 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 96,069,354 - 96,281,790 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 96,072,809 - 96,285,242 (+) NCBI Celera 6 90,752,440 - 90,949,802 (+) NCBI Celera Cytogenetic Map 6 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prkch Rat (+)-pilocarpine increases expression EXP 6480464 Pilocarpine results in increased expression of PRKCH protein CTD PMID:15058486 Prkch Rat (-)-epigallocatechin 3-gallate multiple interactions ISO PRKCH (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PRKCH mRNA CTD PMID:22079256 Prkch Rat 1,2-dichloroethane affects expression ISO Prkch (Mus musculus) 6480464 ethylene dichloride affects the expression of PRKCH mRNA CTD PMID:28960355 Prkch Rat 1,2-dimethylhydrazine increases expression ISO Prkch (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PRKCH mRNA CTD PMID:22206623 Prkch Rat 1-nitropyrene increases expression ISO PRKCH (Homo sapiens) 6480464 1-nitropyrene results in increased expression of PRKCH mRNA CTD PMID:19041380 Prkch Rat 17alpha-ethynylestradiol multiple interactions ISO Prkch (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PRKCH mRNA CTD PMID:17942748 Prkch Rat 17beta-estradiol multiple interactions ISO PRKCH (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of PRKCH mRNA CTD PMID:30165855 Prkch Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO PRKCH (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of PRKCH mRNA CTD PMID:29581250 Prkch Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:27291303 Prkch Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Prkch (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PRKCH mRNA and [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of PRKCH mRNA CTD PMID:17942748 and PMID:25975270 Prkch Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRKCH mRNA CTD PMID:34747641 Prkch Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO PRKCH (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of PRKCH mRNA CTD PMID:23152189 Prkch Rat 2-acetamidofluorene multiple interactions EXP 6480464 [2-Acetylaminofluorene co-treated with Diethylnitrosamine] results in increased expression of PRKCH mRNA and [Diethylnitrosamine co-treated with 2-Acetylaminofluorene] results in increased expression of PRKCH mRNA CTD PMID:14656948 and PMID:16158176 Prkch Rat 2-palmitoylglycerol increases expression ISO PRKCH (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of PRKCH mRNA CTD PMID:37199045 Prkch Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of PRKCH mRNA CTD PMID:19162173 Prkch Rat 4,4'-sulfonyldiphenol increases expression ISO PRKCH (Homo sapiens) 6480464 bisphenol S results in increased expression of PRKCH mRNA CTD PMID:25912373 Prkch Rat 4,4'-sulfonyldiphenol decreases methylation ISO PRKCH (Homo sapiens) 6480464 bisphenol S results in decreased methylation of PRKCH gene CTD PMID:31601247 Prkch Rat 4,4'-sulfonyldiphenol multiple interactions ISO PRKCH (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in decreased methylation of PRKCH gene CTD PMID:31601247 Prkch Rat 4,4'-sulfonyldiphenol increases expression ISO Prkch (Mus musculus) 6480464 bisphenol S results in increased expression of PRKCH mRNA CTD PMID:30951980 Prkch Rat 4-hydroxyphenyl retinamide increases expression ISO Prkch (Mus musculus) 6480464 Fenretinide results in increased expression of PRKCH mRNA CTD PMID:28973697 Prkch Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of PRKCH mRNA CTD PMID:31881176 Prkch Rat acrylamide increases expression ISO Prkch (Mus musculus) 6480464 Acrylamide results in increased expression of PRKCH mRNA CTD PMID:30807115 Prkch Rat aflatoxin B1 increases methylation ISO PRKCH (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of PRKCH intron CTD PMID:30157460 Prkch Rat aflatoxin B1 decreases methylation ISO PRKCH (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PRKCH promoter CTD PMID:30157460 Prkch Rat Aflatoxin B2 alpha decreases methylation ISO PRKCH (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of PRKCH promoter CTD PMID:30157460 Prkch Rat aldehydo-D-glucose decreases expression ISO Prkch (Mus musculus) 6480464 Glucose results in decreased expression of PRKCH mRNA CTD PMID:17178593 Prkch Rat all-trans-retinoic acid increases expression ISO PRKCH (Homo sapiens) 6480464 Tretinoin results in increased expression of PRKCH mRNA CTD PMID:17431108 Prkch Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of PRKCH mRNA CTD PMID:30047161 Prkch Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PRKCH mRNA CTD PMID:16483693 Prkch Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of PRKCH mRNA CTD PMID:16101753 Prkch Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of PRKCH mRNA CTD PMID:30779732 Prkch Rat aristolochic acid A increases expression ISO PRKCH (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PRKCH mRNA CTD PMID:33212167 Prkch Rat arsane multiple interactions ISO PRKCH (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PRKCH mRNA CTD PMID:39836092 Prkch Rat arsenic atom multiple interactions ISO PRKCH (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PRKCH mRNA CTD PMID:39836092 Prkch Rat arsenite(3-) increases expression ISO Prkch (Mus musculus) 6480464 arsenite results in increased expression of PRKCH mRNA CTD PMID:33053406 Prkch Rat arsenous acid increases expression ISO PRKCH (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PRKCH mRNA CTD PMID:20458559 Prkch Rat atrazine decreases expression ISO PRKCH (Homo sapiens) 6480464 Atrazine results in decreased expression of PRKCH mRNA CTD PMID:22378314 Prkch Rat benzene increases expression ISO PRKCH (Homo sapiens) 6480464 Benzene results in increased expression of PRKCH mRNA CTD PMID:20036648 Prkch Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of PRKCH mRNA CTD PMID:21839799 Prkch Rat benzo[a]pyrene affects methylation ISO PRKCH (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PRKCH promoter CTD PMID:27901495 Prkch Rat benzo[a]pyrene decreases methylation ISO PRKCH (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PRKCH 5' UTR and Benzo(a)pyrene results in decreased methylation of PRKCH exon CTD PMID:27901495 Prkch Rat benzo[e]pyrene decreases methylation ISO PRKCH (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of PRKCH promoter CTD PMID:30157460 Prkch Rat bis(2-ethylhexyl) phthalate increases expression ISO PRKCH (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of PRKCH mRNA CTD PMID:31163220 Prkch Rat bisphenol A increases methylation ISO PRKCH (Homo sapiens) 6480464 bisphenol A results in increased methylation of PRKCH gene CTD PMID:22576693 Prkch Rat bisphenol A increases expression ISO Prkch (Mus musculus) 6480464 bisphenol A results in increased expression of PRKCH mRNA CTD PMID:32156529 Prkch Rat bisphenol A multiple interactions ISO PRKCH (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PRKCH gene CTD PMID:31601247 Prkch Rat bisphenol A decreases methylation ISO PRKCH (Homo sapiens) 6480464 bisphenol A results in decreased methylation of PRKCH gene CTD PMID:31601247 Prkch Rat bisphenol A decreases expression ISO PRKCH (Homo sapiens) 6480464 bisphenol A results in decreased expression of PRKCH mRNA CTD PMID:22576693 and PMID:27685785 Prkch Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PRKCH mRNA CTD PMID:25181051 Prkch Rat bisphenol A decreases expression ISO Prkch (Mus musculus) 6480464 bisphenol A results in decreased expression of PRKCH mRNA CTD PMID:26063408 and PMID:34585602 Prkch Rat bisphenol F increases expression ISO Prkch (Mus musculus) 6480464 bisphenol F results in increased expression of PRKCH mRNA CTD PMID:30951980 Prkch Rat captan decreases expression ISO Prkch (Mus musculus) 6480464 Captan results in decreased expression of PRKCH mRNA CTD PMID:31558096 Prkch Rat carbon nanotube increases expression ISO Prkch (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Prkch Rat CGP 52608 multiple interactions ISO PRKCH (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PRKCH gene] CTD PMID:28238834 Prkch Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of PRKCH mRNA CTD PMID:17452286 and PMID:19368821 Prkch Rat chlorpyrifos increases expression ISO Prkch (Mus musculus) 6480464 Chlorpyrifos results in increased expression of PRKCH mRNA CTD PMID:37019170 Prkch Rat chromium(6+) affects expression ISO Prkch (Mus musculus) 6480464 chromium hexavalent ion affects the expression of PRKCH mRNA CTD PMID:28472532 Prkch Rat clotrimazole increases expression EXP 6480464 Clotrimazole results in increased expression of PRKCH mRNA CTD PMID:30047161 Prkch Rat cobalt dichloride decreases expression ISO PRKCH (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PRKCH mRNA CTD PMID:19320972 Prkch Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of PRKCH mRNA CTD PMID:24386269 Prkch Rat coumarin decreases phosphorylation ISO PRKCH (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of PRKCH protein CTD PMID:35688186 Prkch Rat coumestrol decreases expression ISO PRKCH (Homo sapiens) 6480464 Coumestrol results in decreased expression of PRKCH mRNA CTD PMID:19167446 Prkch Rat curcumin multiple interactions ISO PRKCH (Homo sapiens) 6480464 Curcumin inhibits the reaction [PRKCH protein results in increased expression of IVL mRNA] CTD PMID:17148446 Prkch Rat D-glucose decreases expression ISO Prkch (Mus musculus) 6480464 Glucose results in decreased expression of PRKCH mRNA CTD PMID:17178593 Prkch Rat diarsenic trioxide increases expression ISO PRKCH (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PRKCH mRNA CTD PMID:20458559 Prkch Rat diazinon decreases expression EXP 6480464 Diazinon results in decreased expression of PRKCH mRNA CTD PMID:17452286 Prkch Rat dorsomorphin multiple interactions ISO PRKCH (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Prkch Rat doxorubicin decreases expression ISO PRKCH (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PRKCH mRNA CTD PMID:29803840 Prkch Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of PRKCH mRNA CTD PMID:29391264 Prkch Rat entinostat increases expression ISO PRKCH (Homo sapiens) 6480464 entinostat results in increased expression of PRKCH mRNA CTD PMID:26272509 Prkch Rat entinostat multiple interactions ISO PRKCH (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PRKCH mRNA CTD PMID:27188386 Prkch Rat epoxiconazole decreases expression ISO Prkch (Mus musculus) 6480464 epoxiconazole results in decreased expression of PRKCH mRNA CTD PMID:35436446 Prkch Rat ethanol affects expression ISO Prkch (Mus musculus) 6480464 Ethanol affects the expression of PRKCH mRNA CTD PMID:30319688 Prkch Rat folpet decreases expression ISO Prkch (Mus musculus) 6480464 folpet results in decreased expression of PRKCH mRNA CTD PMID:31558096 Prkch Rat FR900359 affects phosphorylation ISO PRKCH (Homo sapiens) 6480464 FR900359 affects the phosphorylation of PRKCH protein CTD PMID:37730182 Prkch Rat fulvestrant multiple interactions ISO PRKCH (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PRKCH gene and [bisphenol S co-treated with Fulvestrant] results in decreased methylation of PRKCH gene CTD PMID:31601247 Prkch Rat gallic acid decreases expression ISO PRKCH (Homo sapiens) 6480464 Gallic Acid results in decreased expression of PRKCH mRNA CTD PMID:34408198 Prkch Rat gamma-hexachlorocyclohexane affects expression EXP 6480464 Hexachlorocyclohexane affects the expression of PRKCH mRNA CTD PMID:22001173 Prkch Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PRKCH mRNA CTD PMID:22061828 Prkch Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PRKCH mRNA CTD PMID:33387578 Prkch Rat glucose decreases expression ISO Prkch (Mus musculus) 6480464 Glucose results in decreased expression of PRKCH mRNA CTD PMID:17178593 Prkch Rat hydrogen cyanide decreases expression ISO Prkch (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of PRKCH mRNA CTD PMID:33914522 Prkch Rat hydrogen peroxide affects expression ISO PRKCH (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of PRKCH mRNA CTD PMID:20044591 Prkch Rat indometacin increases expression ISO PRKCH (Homo sapiens) 6480464 Indomethacin results in increased expression of PRKCH protein CTD PMID:10702201 Prkch Rat lead diacetate increases expression ISO Prkch (Mus musculus) 6480464 lead acetate results in increased expression of PRKCH mRNA CTD PMID:20542052 Prkch Rat lipopolysaccharide decreases expression ISO Prkch (Mus musculus) 6480464 Lipopolysaccharides results in decreased expression of PRKCH mRNA CTD PMID:26582142 Prkch Rat mercury dibromide increases expression ISO PRKCH (Homo sapiens) 6480464 mercuric bromide results in increased expression of PRKCH mRNA CTD PMID:26272509 Prkch Rat mercury dibromide multiple interactions ISO PRKCH (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PRKCH mRNA CTD PMID:27188386 Prkch Rat methapyrilene decreases methylation ISO PRKCH (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of PRKCH promoter CTD PMID:30157460 Prkch Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of PRKCH mRNA CTD PMID:30047161 Prkch Rat methoxyacetic acid affects expression EXP 6480464 methoxyacetic acid affects the expression of PRKCH mRNA CTD PMID:20864626 Prkch Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PRKCH gene CTD PMID:35440735 Prkch Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of PRKCH gene CTD PMID:33148267 Prkch Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [2-Acetylaminofluorene co-treated with Diethylnitrosamine] results in increased expression of PRKCH mRNA and [Diethylnitrosamine co-treated with 2-Acetylaminofluorene] results in increased expression of PRKCH mRNA CTD PMID:14656948 and PMID:16158176 Prkch Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of PRKCH mRNA CTD PMID:17032414 Prkch Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of PRKCH mRNA CTD PMID:23665939 Prkch Rat ozone multiple interactions ISO Prkch (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of PRKCH mRNA CTD PMID:34911549 Prkch Rat p-chloromercuribenzoic acid increases expression ISO PRKCH (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of PRKCH mRNA CTD PMID:26272509 Prkch Rat p-chloromercuribenzoic acid multiple interactions ISO PRKCH (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PRKCH mRNA CTD PMID:27188386 Prkch Rat panobinostat multiple interactions ISO PRKCH (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PRKCH mRNA CTD PMID:27188386 Prkch Rat panobinostat increases expression ISO PRKCH (Homo sapiens) 6480464 panobinostat results in increased expression of PRKCH mRNA CTD PMID:26272509 Prkch Rat paracetamol multiple interactions ISO PRKCH (Homo sapiens) 6480464 [Dietary Carbohydrates co-treated with Acetaminophen] results in decreased expression of PRKCH mRNA CTD PMID:17093179 Prkch Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PRKCH mRNA CTD PMID:33387578 Prkch Rat paracetamol affects expression ISO Prkch (Mus musculus) 6480464 Acetaminophen affects the expression of PRKCH mRNA CTD PMID:17562736 Prkch Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of PRKCH gene CTD PMID:33148267 Prkch Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of PRKCH mRNA CTD PMID:19162173 Prkch Rat phenylmercury acetate increases expression ISO PRKCH (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of PRKCH mRNA CTD PMID:26272509 Prkch Rat phenylmercury acetate multiple interactions ISO PRKCH (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PRKCH mRNA CTD PMID:27188386 Prkch Rat phlorizin increases expression ISO Prkch (Mus musculus) 6480464 Phlorhizin results in increased expression of PRKCH mRNA CTD PMID:22538082 Prkch Rat phorbol 13-acetate 12-myristate increases activity ISO PRKCH (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased activity of PRKCH protein CTD PMID:16832347 Prkch Rat phorbol 13-acetate 12-myristate multiple interactions ISO PRKCH (Homo sapiens) 6480464 [Tetradecanoylphorbol Acetate results in increased activity of PRKCH protein] inhibits the reaction [Sirolimus results in decreased phosphorylation of RPS6 protein] CTD PMID:16832347 Prkch Rat potassium chromate decreases expression ISO PRKCH (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of PRKCH mRNA CTD PMID:22079256 Prkch Rat potassium chromate multiple interactions ISO PRKCH (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PRKCH mRNA CTD PMID:22079256 Prkch Rat potassium cyanide increases expression ISO Prkch (Mus musculus) 6480464 Potassium Cyanide results in increased expression of PRKCH mRNA CTD PMID:33914522 Prkch Rat propanal increases expression ISO PRKCH (Homo sapiens) 6480464 propionaldehyde results in increased expression of PRKCH mRNA CTD PMID:26079696 Prkch Rat quercetin decreases expression ISO Prkch (Mus musculus) 6480464 Quercetin results in decreased expression of PRKCH mRNA CTD PMID:26076811 Prkch Rat SB 431542 multiple interactions ISO PRKCH (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Prkch Rat sirolimus decreases response to substance ISO PRKCH (Homo sapiens) 6480464 PRKCH results in decreased susceptibility to Sirolimus CTD PMID:16832347 Prkch Rat sirolimus multiple interactions ISO PRKCH (Homo sapiens) 6480464 [Tetradecanoylphorbol Acetate results in increased activity of PRKCH protein] inhibits the reaction [Sirolimus results in decreased phosphorylation of RPS6 protein] CTD PMID:16832347 Prkch Rat sodium arsenite multiple interactions ISO PRKCH (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PRKCH mRNA CTD PMID:39836092 Prkch Rat sodium dichromate decreases expression ISO Prkch (Mus musculus) 6480464 sodium bichromate results in decreased expression of PRKCH mRNA CTD PMID:31558096 Prkch Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of PRKCH mRNA CTD PMID:30047161 Prkch Rat sunitinib increases expression ISO PRKCH (Homo sapiens) 6480464 Sunitinib results in increased expression of PRKCH mRNA CTD PMID:31533062 Prkch Rat tert-butyl hydroperoxide increases expression ISO PRKCH (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of PRKCH mRNA CTD PMID:15336504 Prkch Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of PRKCH mRNA CTD PMID:12734012 Prkch Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PRKCH mRNA CTD PMID:17032414 Prkch Rat thapsigargin decreases expression ISO PRKCH (Homo sapiens) 6480464 Thapsigargin results in decreased expression of PRKCH mRNA CTD PMID:22378314 and PMID:29453283 Prkch Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PRKCH mRNA CTD PMID:34492290 Prkch Rat titanium dioxide increases methylation ISO Prkch (Mus musculus) 6480464 titanium dioxide results in increased methylation of PRKCH promoter CTD PMID:35295148 Prkch Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of PRKCH gene CTD PMID:27618143 Prkch Rat trichostatin A increases expression ISO PRKCH (Homo sapiens) 6480464 trichostatin A results in increased expression of PRKCH mRNA CTD PMID:24935251 and PMID:26272509 Prkch Rat trichostatin A multiple interactions ISO PRKCH (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PRKCH mRNA CTD PMID:27188386 Prkch Rat triclosan decreases expression ISO PRKCH (Homo sapiens) 6480464 Triclosan results in decreased expression of PRKCH mRNA CTD PMID:30510588 Prkch Rat triphenyl phosphate affects expression ISO PRKCH (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PRKCH mRNA CTD PMID:37042841 Prkch Rat tunicamycin decreases expression ISO PRKCH (Homo sapiens) 6480464 Tunicamycin results in decreased expression of PRKCH mRNA CTD PMID:22378314 and PMID:29453283 Prkch Rat valproic acid affects expression ISO PRKCH (Homo sapiens) 6480464 Valproic Acid affects the expression of PRKCH mRNA CTD PMID:25979313 Prkch Rat valproic acid increases methylation EXP 6480464 Valproic Acid results in increased methylation of PRKCH promoter CTD PMID:33150595 Prkch Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of PRKCH mRNA CTD PMID:33150595 Prkch Rat valproic acid multiple interactions ISO PRKCH (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PRKCH mRNA CTD PMID:27188386 Prkch Rat valproic acid increases expression ISO PRKCH (Homo sapiens) 6480464 Valproic Acid results in increased expression of PRKCH mRNA CTD PMID:23179753 more ... Prkch Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of PRKCH mRNA CTD PMID:19015723 Prkch Rat vinclozolin decreases methylation EXP 6480464 vinclozolin results in decreased methylation of PRKCH gene CTD PMID:31682807 Prkch Rat vorinostat multiple interactions ISO PRKCH (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PRKCH mRNA CTD PMID:27188386 Prkch Rat vorinostat increases expression ISO PRKCH (Homo sapiens) 6480464 vorinostat results in increased expression of PRKCH mRNA CTD PMID:26272509
Imported Annotations - PID (archival)
(+)-pilocarpine (EXP) (-)-epigallocatechin 3-gallate (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-nitropyrene (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-acetamidofluorene (EXP) 2-palmitoylglycerol (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) acetamide (EXP) acrylamide (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) benzene (ISO) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) captan (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (EXP,ISO) chromium(6+) (ISO) clotrimazole (EXP) cobalt dichloride (EXP,ISO) coumarin (ISO) coumestrol (ISO) curcumin (ISO) D-glucose (ISO) diarsenic trioxide (ISO) diazinon (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) entinostat (ISO) epoxiconazole (ISO) ethanol (ISO) folpet (ISO) FR900359 (ISO) fulvestrant (ISO) gallic acid (ISO) gamma-hexachlorocyclohexane (EXP) gentamycin (EXP) glucose (ISO) hydrogen cyanide (ISO) hydrogen peroxide (ISO) indometacin (ISO) lead diacetate (ISO) lipopolysaccharide (ISO) mercury dibromide (ISO) methapyrilene (ISO) methimazole (EXP) methoxyacetic acid (EXP) methoxychlor (EXP) N,N-diethyl-m-toluamide (EXP) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) orphenadrine (EXP) ozone (ISO) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) paracetamol (EXP,ISO) permethrin (EXP) phenobarbital (EXP) phenylmercury acetate (ISO) phlorizin (ISO) phorbol 13-acetate 12-myristate (ISO) potassium chromate (ISO) potassium cyanide (ISO) propanal (ISO) quercetin (ISO) SB 431542 (ISO) sirolimus (ISO) sodium arsenite (ISO) sodium dichromate (ISO) sulfadimethoxine (EXP) sunitinib (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP) thapsigargin (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (ISO) tunicamycin (ISO) valproic acid (EXP,ISO) vinclozolin (EXP) vorinostat (ISO)
Biological Process
cell differentiation (IEA) cellular response to amino acid starvation (ISO) intracellular signal transduction (IBA) negative regulation of glial cell apoptotic process (IEA,ISO,ISS) negative regulation of protein serine/threonine kinase activity (ISO) negative regulation of translation (ISO) phospholipase C/protein kinase C signal transduction (IMP) positive regulation of B cell receptor signaling pathway (IEA,ISO,ISS) positive regulation of glial cell proliferation (IEA,ISO,ISS) positive regulation of keratinocyte differentiation (IEA,ISO,ISS) positive regulation of macrophage derived foam cell differentiation (IEA,ISO,ISS) positive regulation of NF-kappaB transcription factor activity (ISO,ISS) positive regulation of translation in response to stress (ISO) protein phosphorylation (IDA,ISO) regulation of bicellular tight junction assembly (IEA,ISO,ISS)
1.
Protein kinase C translocation and PKC-dependent protein phosphorylation during myocardial ischemia.
Albert CJ and Ford DA, Am J Physiol. 1999 Feb;276(2 Pt 2):H642-50.
2.
Protein kinase C eta mediates lipopolysaccharide-induced nitric-oxide synthase expression in primary astrocytes.
Chen CC, etal., J Biol Chem. 1998 Jul 31;273(31):19424-30.
3.
Biochemical properties of rat protein kinase C-eta expressed in COS cells.
Dekker LV, etal., FEBS Lett 1992 Nov 9;312(2-3):195-9.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Selective changes in protein kinase C isoforms and phosphorylation of endogenous substrate proteins in rat cerebral cortex during pre- and postnatal ethanol exposure.
Mahadev K and Vemuri MC, Arch Biochem Biophys. 1998 Aug 15;356(2):249-57.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
Protein kinase C: poised to signal.
Newton AC Am J Physiol Endocrinol Metab. 2010 Mar;298(3):E395-402. Epub 2009 Nov 24.
10.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
11.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
12.
GOA pipeline
RGD automated data pipeline
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Prkch Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 98,027,830 - 98,226,486 (+) NCBI GRCr8 mRatBN7.2 6 92,292,000 - 92,490,663 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 92,292,000 - 92,490,654 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 92,681,221 - 92,880,182 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 92,980,754 - 93,179,715 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 92,408,607 - 92,607,569 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 96,479,243 - 96,677,368 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 96,479,430 - 96,676,225 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 105,910,127 - 106,109,230 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 96,069,354 - 96,281,790 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 96,072,809 - 96,285,242 (+) NCBI Celera 6 90,752,440 - 90,949,802 (+) NCBI Celera Cytogenetic Map 6 q24 NCBI
PRKCH Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 61,187,468 - 61,550,976 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 61,187,559 - 61,550,980 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 61,788,297 - 62,017,694 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 60,858,268 - 61,087,451 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 60,858,267 - 61,087,449 NCBI Celera 14 41,838,808 - 42,067,977 (+) NCBI Celera Cytogenetic Map 14 q23.1 NCBI HuRef 14 41,951,908 - 42,181,287 (+) NCBI HuRef CHM1_1 14 61,727,931 - 61,957,119 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 55,394,377 - 55,757,580 (+) NCBI T2T-CHM13v2.0
Prkch Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 73,631,570 - 73,824,959 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 73,631,570 - 73,824,959 (+) Ensembl GRCm39 Ensembl GRCm38 12 73,584,796 - 73,778,185 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 73,584,796 - 73,778,185 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 74,686,028 - 74,879,172 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 74,503,879 - 74,697,023 (+) NCBI MGSCv36 mm8 Celera 12 74,692,700 - 74,888,950 (+) NCBI Celera Cytogenetic Map 12 C3 NCBI cM Map 12 30.81 NCBI
Prkch Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955466 8,176,876 - 8,393,446 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955466 8,178,323 - 8,393,446 (-) NCBI ChiLan1.0 ChiLan1.0
PRKCH Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 62,452,380 - 62,681,297 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 61,668,915 - 61,897,810 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 41,882,022 - 42,151,305 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 60,179,081 - 60,408,251 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 60,179,081 - 60,408,251 (+) Ensembl panpan1.1 panPan2
PRKCH Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 36,185,430 - 36,452,893 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 36,219,212 - 36,451,777 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 35,972,166 - 36,205,993 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 36,452,192 - 36,686,164 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 36,452,206 - 36,686,159 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 36,062,559 - 36,296,413 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 36,139,874 - 36,373,616 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 36,501,849 - 36,735,387 (+) NCBI UU_Cfam_GSD_1.0
Prkch Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 68,553,449 - 68,765,498 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936495 5,426,243 - 5,638,245 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936495 5,426,243 - 5,638,250 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRKCH Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 190,206,124 - 190,439,426 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 190,205,041 - 190,439,433 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 211,586,916 - 211,817,814 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRKCH Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 38,489,535 - 38,726,028 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 38,488,970 - 38,724,879 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 26,748,407 - 26,979,557 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prkch
.
Predicted Target Of
Count of predictions: 311 Count of miRNA genes: 197 Interacting mature miRNAs: 235 Transcripts: ENSRNOT00000006729 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 634330 Pia16 Pristane induced arthritis QTL 16 3.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 6 45790088 104200226 Rat 1331789 Rf37 Renal function QTL 37 3.224 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 72202632 115200186 Rat 1331722 Thshl1 Thyroid stimulating hormone level QTL 1 11.7 0.0001 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 6 89762877 106752806 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 70176 Mcsm1 Mammary carcinoma susceptibility modifier QTL 1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 58632962 103632962 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 1558641 Cm47 Cardiac mass QTL 47 2.9 0.001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 6 57730540 104085867 Rat 724524 Uae2 Urinary albumin excretion QTL 2 2.7 0.0005 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 73463459 109394713 Rat 737827 Hcar11 Hepatocarcinoma resistance QTL 11 4.4 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 6 82523650 110548006 Rat 1641904 Alcrsp4 Alcohol response QTL 4 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 6 67262953 112262953 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 2293837 Kiddil1 Kidney dilation QTL 1 3.7 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 2293842 Kiddil3 Kidney dilation QTL 3 4.3 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 70196 BpQTLcluster7 Blood pressure QTL cluster 7 6.82 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 72202632 117202632 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 1576302 Schws4 Schwannoma susceptibility QTL 4 0.0078 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 83190345 106747639 Rat 1300075 Glom7 Glomerulus QTL 7 5.6 0.0000002 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 6 71201409 116201409 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 12801471 Schws9 Schwannoma susceptibility QTL 9 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 61747639 106747639 Rat 6893332 Cm74 Cardiac mass QTL 74 0.4 0.64 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 57730540 104085867 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat
D6Rat63
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 92,484,482 - 92,484,655 (+) MAPPER mRatBN7.2 Rnor_6.0 6 96,671,188 - 96,671,360 NCBI Rnor6.0 Rnor_5.0 6 106,103,055 - 106,103,227 UniSTS Rnor5.0 RGSC_v3.4 6 96,275,614 - 96,275,787 RGD RGSC3.4 RGSC_v3.4 6 96,275,615 - 96,275,787 UniSTS RGSC3.4 RGSC_v3.1 6 96,279,071 - 96,279,243 RGD Celera 6 90,943,627 - 90,943,799 UniSTS RH 3.4 Map 6 663.8 RGD RH 3.4 Map 6 663.8 UniSTS RH 2.0 Map 6 855.3 RGD SHRSP x BN Map 6 55.6199 RGD Cytogenetic Map 6 q24 UniSTS
D6Got119
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 92,455,312 - 92,455,496 (+) MAPPER mRatBN7.2 Rnor_6.0 6 96,642,029 - 96,642,212 NCBI Rnor6.0 Rnor_5.0 6 106,073,139 - 106,073,322 UniSTS Rnor5.0 RGSC_v3.4 6 96,245,470 - 96,245,654 RGD RGSC3.4 RGSC_v3.4 6 96,245,471 - 96,245,654 UniSTS RGSC3.4 RGSC_v3.1 6 96,248,927 - 96,249,110 RGD Celera 6 90,914,468 - 90,914,651 UniSTS RH 3.4 Map 6 656.1 UniSTS RH 3.4 Map 6 656.1 RGD RH 2.0 Map 6 868.6 RGD Cytogenetic Map 6 q24 UniSTS
BF387973
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 92,462,224 - 92,462,377 (+) MAPPER mRatBN7.2 Rnor_6.0 6 96,648,941 - 96,649,093 NCBI Rnor6.0 Rnor_5.0 6 106,080,051 - 106,080,203 UniSTS Rnor5.0 RGSC_v3.4 6 96,252,383 - 96,252,535 UniSTS RGSC3.4 Celera 6 90,921,330 - 90,921,482 UniSTS RH 3.4 Map 6 658.4 UniSTS Cytogenetic Map 6 q24 UniSTS
BF389700
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 92,294,043 - 92,294,204 (+) MAPPER mRatBN7.2 Rnor_6.0 6 96,481,287 - 96,481,447 NCBI Rnor6.0 Rnor_5.0 6 105,912,171 - 105,912,331 UniSTS Rnor5.0 RGSC_v3.4 6 96,071,398 - 96,071,558 UniSTS RGSC3.4 Celera 6 90,754,484 - 90,754,644 UniSTS RH 3.4 Map 6 657.5 UniSTS Cytogenetic Map 6 q24 UniSTS
AU047887
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 92,334,473 - 92,334,597 (+) MAPPER mRatBN7.2 Rnor_6.0 6 96,521,722 - 96,521,845 NCBI Rnor6.0 Rnor_5.0 6 105,952,591 - 105,952,714 UniSTS Rnor5.0 RGSC_v3.4 6 96,111,812 - 96,111,935 UniSTS RGSC3.4 Celera 6 90,795,150 - 90,795,273 UniSTS Cytogenetic Map 6 q24 UniSTS
RH135129
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 92,296,826 - 92,297,030 (+) MAPPER mRatBN7.2 Rnor_6.0 6 96,484,070 - 96,484,273 NCBI Rnor6.0 Rnor_5.0 6 105,914,954 - 105,915,157 UniSTS Rnor5.0 RGSC_v3.4 6 96,074,181 - 96,074,384 UniSTS RGSC3.4 Celera 6 90,757,267 - 90,757,470 UniSTS RH 3.4 Map 6 658.5 UniSTS Cytogenetic Map 6 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000006729 ⟹ ENSRNOP00000006729
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 92,292,000 - 92,490,654 (+) Ensembl Rnor_6.0 Ensembl 6 96,479,430 - 96,676,225 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000106502 ⟹ ENSRNOP00000095346
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 92,292,000 - 92,490,654 (+) Ensembl
RefSeq Acc Id:
NM_031085 ⟹ NP_112347
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 98,027,830 - 98,226,481 (+) NCBI mRatBN7.2 6 92,292,000 - 92,490,658 (+) NCBI Rnor_6.0 6 96,479,243 - 96,677,363 (+) NCBI Rnor_5.0 6 105,910,127 - 106,109,230 (+) NCBI RGSC_v3.4 6 96,069,354 - 96,281,790 (+) RGD Celera 6 90,752,440 - 90,949,802 (+) RGD
Sequence:
GGGAAGGAGGGGAGGGGAAGGTCCCTCGGAGGAGGCGGAATGGCCGGTCGCAGGGGGCTTGGGTGCTGCTTCTCCCGGGAGCTGCCTCCACGAGCGTGGCTGCGGAGAGGACTGCCTTGAGCCCGGGC
hide sequence
RefSeq Acc Id:
XM_039112995 ⟹ XP_038968923
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 98,032,734 - 98,226,486 (+) NCBI mRatBN7.2 6 92,296,908 - 92,490,663 (+) NCBI
RefSeq Acc Id:
NP_112347 ⟸ NM_031085
- UniProtKB:
Q64617 (UniProtKB/Swiss-Prot), A6HC64 (UniProtKB/TrEMBL), A0A8I6AMW9 (UniProtKB/TrEMBL)
- Sequence:
MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTKQKTNKPTYNEEFCTNVSDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTAGTSDTFEGWVDLEPEG
hide sequence
Ensembl Acc Id:
ENSRNOP00000006729 ⟸ ENSRNOT00000006729
RefSeq Acc Id:
XP_038968923 ⟸ XM_039112995
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000095346 ⟸ ENSRNOT00000106502
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Prkch
protein kinase C, eta
protein kinase C-eta
Name updated
1299863 APPROVED
2002-08-07
Prkch
protein kinase C-eta
Symbol and Name status set to provisional
70820 PROVISIONAL
