Symbol:
Ugdh
Name:
UDP-glucose 6-dehydrogenase
RGD ID:
621879
Description:
Enables UDP-glucose 6-dehydrogenase activity. Predicted to be involved in several processes, including UDP-glucuronate biosynthetic process; heparan sulfate proteoglycan biosynthetic process; and protein hexamerization. Predicted to be located in nucleoplasm. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in developmental and epileptic encephalopathy 84. Orthologous to human UGDH (UDP-glucose 6-dehydrogenase); PARTICIPATES IN congenital sucrase-isomaltase deficiency pathway; galactokinase deficiency pathway; GALE deficiency pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
UDP-Glc dehydrogenase; UDP-GlcDH; UDP-glucose dehydrogeanse; UDP-glucose dehydrogenase; UDPGDH
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
UGDH (UDP-glucose 6-dehydrogenase)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Ugdh (UDP-glucose dehydrogenase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ugdh (UDP-glucose 6-dehydrogenase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
UGDH (UDP-glucose 6-dehydrogenase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
UGDH (UDP-glucose 6-dehydrogenase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ugdh (UDP-glucose 6-dehydrogenase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
UGDH (UDP-glucose 6-dehydrogenase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
UGDH (UDP-glucose 6-dehydrogenase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ugdh (UDP-glucose 6-dehydrogenase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ACBD6 (acyl-CoA binding domain containing 6)
HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
UGDH (UDP-glucose 6-dehydrogenase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ugdh (UDP-glucose dehydrogenase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ugdh (UDP-glucose 6-dehydrogenase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
sqv-4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
sgl
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ugdh
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 43,202,480 - 43,226,002 (+) NCBI GRCr8 mRatBN7.2 14 42,848,704 - 42,872,351 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 42,848,854 - 42,872,354 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 43,202,670 - 43,226,148 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 44,502,588 - 44,526,066 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 42,982,708 - 43,006,181 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 44,479,614 - 44,502,845 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 44,479,614 - 44,502,845 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 44,299,226 - 44,322,226 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 45,542,781 - 45,570,961 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 45,545,171 - 45,573,352 (+) NCBI Celera 14 41,999,555 - 42,023,022 (+) NCBI Celera Cytogenetic Map 14 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ugdh Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of UGDH mRNA] CTD PMID:31150632 Ugdh Rat (-)-epigallocatechin 3-gallate increases expression ISO RGD:734073 6480464 epigallocatechin gallate results in increased expression of UGDH mRNA CTD PMID:16084531 Ugdh Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:734074 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of UGDH mRNA CTD PMID:36331819 Ugdh Rat 1,2-dimethylhydrazine decreases expression ISO RGD:734074 6480464 1,2-Dimethylhydrazine results in decreased expression of UGDH mRNA CTD PMID:22206623 Ugdh Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:734074 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of UGDH mRNA CTD PMID:22206623 Ugdh Rat 1-benzofuran affects expression ISO RGD:734074 6480464 benzofuran affects the expression of UGDH mRNA CTD PMID:17114358 Ugdh Rat 17alpha-ethynylestradiol increases expression ISO RGD:734074 6480464 Ethinyl Estradiol results in increased expression of UGDH mRNA CTD PMID:17942748 Ugdh Rat 17beta-estradiol multiple interactions ISO RGD:734073 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of UGDH mRNA; [Estradiol co-treated with TGFB1 more ... CTD PMID:19619570|PMID:30165855 Ugdh Rat 17beta-estradiol increases expression ISO RGD:734074 6480464 Estradiol results in increased expression of UGDH mRNA CTD PMID:39298647 Ugdh Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of UGDH mRNA CTD PMID:32145629 Ugdh Rat 17beta-estradiol increases expression ISO RGD:734073 6480464 Estradiol results in increased expression of UGDH mRNA CTD PMID:19619570|PMID:21185374 Ugdh Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO RGD:734073 6480464 Dihydrotestosterone results in increased expression of UGDH mRNA CTD PMID:29581250 Ugdh Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:734074 6480464 [2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylnitrosamine] results in increased expression of UGDH protein CTD PMID:23457121 Ugdh Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases expression ISO RGD:734074 6480464 2,4,5,2',4',5'-hexachlorobiphenyl results in increased expression of UGDH mRNA CTD PMID:20005886|PMID:21851831 Ugdh Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO RGD:734074 6480464 [Flame Retardants results in increased abundance of 2,2',4,4'-tetrabromodiphenyl ether] which results in decreased expression of more ... CTD PMID:38995820 Ugdh Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:734073 6480464 Tetrachlorodibenzodioxin results in decreased expression of UGDH mRNA CTD PMID:19619570 Ugdh Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of UGDH mRNA CTD PMID:33387578 Ugdh Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of UGDH mRNA CTD PMID:34747641 Ugdh Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:734074 6480464 Tetrachlorodibenzodioxin results in increased expression of UGDH mRNA CTD PMID:15328365|PMID:15800033|PMID:16611356|PMID:16960034|PMID:17949056|PMID:18796159|PMID:19474220|PMID:19770486|PMID:20005886|PMID:21851831|PMID:21889950|PMID:23864506|PMID:25975270|PMID:26290441|PMID:27562557|PMID:31511937 Ugdh Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:734074 6480464 Tetrachlorodibenzodioxin affects the expression of UGDH mRNA CTD PMID:18343893|PMID:20702594|PMID:26377647 Ugdh Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of UGDH mRNA CTD PMID:16960034|PMID:20558275 Ugdh Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:734074 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of UGDH mRNA; [TIPARP gene more ... CTD PMID:16214954|PMID:19474220|PMID:25975270 Ugdh Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:734073 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of UGDH mRNA CTD PMID:19619570 Ugdh Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO RGD:734074 6480464 2,3,7,8-tetrachlorodibenzofuran affects the expression of UGDH mRNA CTD PMID:18343893|PMID:20702594 Ugdh Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:734074 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of UGDH mRNA CTD PMID:38648751 Ugdh Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of UGDH mRNA CTD PMID:21346803 Ugdh Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of UGDH mRNA CTD PMID:21346803 Ugdh Rat 2-hydroxyethyl methacrylate increases expression ISO RGD:734073 6480464 hydroxyethyl methacrylate results in increased expression of UGDH mRNA CTD PMID:30497689 Ugdh Rat 2-methylcholine affects expression ISO RGD:734073 6480464 beta-methylcholine affects the expression of UGDH mRNA CTD PMID:21179406 Ugdh Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions ISO RGD:734074 6480464 [3,4,5,3',4'-pentachlorobiphenyl co-treated with Diethylnitrosamine] results in increased expression of UGDH protein CTD PMID:23457121 Ugdh Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin analog results in decreased expression of UGDH protein CTD PMID:26597043 Ugdh Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of UGDH protein CTD PMID:34915118 Ugdh Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1,2-dithiol-3-thione results in increased expression of UGDH mRNA CTD PMID:19162173 Ugdh Rat 4,4'-diaminodiphenylmethane decreases expression ISO RGD:734074 6480464 4,4'-diaminodiphenylmethane results in decreased expression of UGDH mRNA CTD PMID:18648102 Ugdh Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:734074 6480464 bisphenol S results in increased expression of UGDH mRNA CTD PMID:39298647 Ugdh Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:734073 6480464 bisphenol S results in increased expression of UGDH protein CTD PMID:34186270 Ugdh Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2,6-dinitrotoluene affects the expression of UGDH mRNA CTD PMID:21346803 Ugdh Rat 5-fluorouracil affects response to substance ISO RGD:734073 6480464 UGDH protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Ugdh Rat 9-cis-retinoic acid multiple interactions ISO RGD:734073 6480464 [pirinixic acid co-treated with Alitretinoin co-treated with PPARA protein co-treated with RXRA protein] results in more ... CTD PMID:16292757 Ugdh Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of UGDH mRNA CTD PMID:31881176 Ugdh Rat acrylamide increases expression ISO RGD:734073 6480464 Acrylamide results in increased expression of UGDH mRNA CTD PMID:32763439 Ugdh Rat actinomycin D multiple interactions ISO RGD:734073 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of UGDH protein CTD PMID:38460933 Ugdh Rat aldrin increases expression ISO RGD:734074 6480464 Aldrin results in increased expression of UGDH mRNA CTD PMID:18579281 Ugdh Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of UGDH mRNA CTD PMID:38685447 Ugdh Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of UGDH mRNA CTD PMID:16483693 Ugdh Rat aristolochic acid A increases expression ISO RGD:734073 6480464 aristolochic acid I results in increased expression of UGDH protein CTD PMID:33212167 Ugdh Rat arsane multiple interactions ISO RGD:734074 6480464 [APOE protein affects the susceptibility to Arsenic] which affects the expression of UGDH mRNA CTD PMID:22719926 Ugdh Rat arsenic atom multiple interactions ISO RGD:734074 6480464 [APOE protein affects the susceptibility to Arsenic] which affects the expression of UGDH mRNA CTD PMID:22719926 Ugdh Rat arsenous acid decreases expression ISO RGD:734073 6480464 Arsenic Trioxide results in decreased expression of UGDH protein CTD PMID:25258189 Ugdh Rat arsenous acid increases expression ISO RGD:734073 6480464 Arsenic Trioxide results in increased expression of UGDH mRNA CTD PMID:20458559 Ugdh Rat Azoxymethane multiple interactions ISO RGD:734074 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of UGDH more ... CTD PMID:29950665 Ugdh Rat benzatropine decreases expression ISO RGD:734073 6480464 Benztropine results in decreased expression of UGDH protein CTD PMID:34122009 Ugdh Rat benzo[a]pyrene increases expression ISO RGD:734074 6480464 Benzo(a)pyrene results in increased expression of UGDH mRNA CTD PMID:19770486|PMID:21715664|PMID:32417428 Ugdh Rat benzo[a]pyrene increases methylation ISO RGD:734073 6480464 Benzo(a)pyrene results in increased methylation of UGDH 5' UTR CTD PMID:27901495 Ugdh Rat benzo[a]pyrene multiple interactions ISO RGD:734073 6480464 [Soot co-treated with Benzo(a)pyrene] results in increased expression of UGDH protein modified form CTD PMID:24464499 Ugdh Rat benzo[a]pyrene affects expression ISO RGD:734073 6480464 Benzo(a)pyrene affects the expression of UGDH mRNA CTD PMID:21714911 Ugdh Rat beta-lapachone increases expression ISO RGD:734073 6480464 beta-lapachone results in increased expression of UGDH mRNA CTD PMID:38218311 Ugdh Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:734074 6480464 Diethylhexyl Phthalate results in increased expression of UGDH mRNA CTD PMID:19850644 Ugdh Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:734074 6480464 Diethylhexyl Phthalate results in decreased expression of UGDH mRNA CTD PMID:34319233 Ugdh Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:734074 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of UGDH mRNA] CTD PMID:19850644 Ugdh Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of UGDH mRNA CTD PMID:25181051 Ugdh Rat bisphenol A decreases expression ISO RGD:734073 6480464 bisphenol A results in decreased expression of UGDH protein CTD PMID:34186270 Ugdh Rat bisphenol A increases expression ISO RGD:734074 6480464 bisphenol A results in increased expression of UGDH mRNA CTD PMID:33221593 Ugdh Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of UGDH mRNA CTD PMID:32145629 Ugdh Rat bisphenol A affects expression ISO RGD:734073 6480464 bisphenol A affects the expression of UGDH mRNA CTD PMID:30903817 Ugdh Rat bisphenol AF increases expression ISO RGD:734073 6480464 bisphenol AF results in increased expression of UGDH protein CTD PMID:34186270 Ugdh Rat Bisphenol B increases expression ISO RGD:734073 6480464 bisphenol B results in increased expression of UGDH protein CTD PMID:34186270 Ugdh Rat bisphenol F increases expression ISO RGD:734073 6480464 bisphenol F results in increased expression of UGDH protein CTD PMID:34186270 Ugdh Rat bromobenzene affects binding EXP 6480464 bromobenzene metabolite binds to UGDH protein CTD PMID:17305373 Ugdh Rat butanal decreases expression ISO RGD:734073 6480464 butyraldehyde results in decreased expression of UGDH mRNA CTD PMID:26079696 Ugdh Rat cadmium atom increases expression ISO RGD:734074 6480464 Cadmium results in increased expression of UGDH mRNA CTD PMID:24067728 Ugdh Rat cadmium dichloride increases expression ISO RGD:734073 6480464 Cadmium Chloride results in increased expression of UGDH mRNA CTD PMID:38568856 Ugdh Rat cadmium sulfate multiple interactions ISO RGD:734073 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of more ... CTD PMID:18654764 Ugdh Rat caffeine affects phosphorylation ISO RGD:734073 6480464 Caffeine affects the phosphorylation of UGDH protein CTD PMID:35688186 Ugdh Rat captan increases expression ISO RGD:734074 6480464 Captan results in increased expression of UGDH mRNA CTD PMID:31558096 Ugdh Rat carbamazepine decreases expression EXP 6480464 Carbamazepine results in decreased expression of UGDH mRNA CTD PMID:17381134 Ugdh Rat carbamazepine increases expression EXP 6480464 Carbamazepine results in increased expression of UGDH mRNA CTD PMID:17381134 Ugdh Rat carbon nanotube decreases expression ISO RGD:734074 6480464 Nanotubes, Carbon analog results in decreased expression of UGDH mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25620056 Ugdh Rat carbon nanotube increases expression ISO RGD:734074 6480464 Nanotubes, Carbon analog results in increased expression of UGDH mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Ugdh Rat celastrol increases expression ISO RGD:734073 6480464 celastrol results in increased expression of UGDH mRNA CTD PMID:17010675 Ugdh Rat chromium(6+) multiple interactions ISO RGD:734073 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression more ... CTD PMID:38479592 Ugdh Rat cisplatin increases expression ISO RGD:734073 6480464 Cisplatin results in increased expression of UGDH mRNA; Cisplatin results in increased expression of UGDH more ... CTD PMID:16803524|PMID:19561079 Ugdh Rat cobalt dichloride multiple interactions ISO RGD:734073 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of more ... CTD PMID:18654764 Ugdh Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of UGDH mRNA; cobaltous chloride results in increased expression more ... CTD PMID:24386269 Ugdh Rat cobalt dichloride increases expression ISO RGD:734073 6480464 cobaltous chloride results in increased expression of UGDH mRNA CTD PMID:22941251 Ugdh Rat cobalt dichloride decreases expression ISO RGD:734073 6480464 cobaltous chloride results in decreased expression of UGDH mRNA CTD PMID:19376846 Ugdh Rat copper atom affects binding ISO RGD:734073 6480464 UGDH protein binds to Copper CTD PMID:15359738 Ugdh Rat copper(0) affects binding ISO RGD:734073 6480464 UGDH protein binds to Copper CTD PMID:15359738 Ugdh Rat copper(II) chloride increases expression ISO RGD:734073 6480464 cupric chloride results in increased expression of UGDH mRNA CTD PMID:38568856 Ugdh Rat coumarin increases expression EXP 6480464 coumarin results in increased expression of UGDH mRNA CTD PMID:18480146 Ugdh Rat coumestrol decreases expression ISO RGD:734073 6480464 Coumestrol results in decreased expression of UGDH mRNA CTD PMID:19167446 Ugdh Rat crocidolite asbestos decreases expression ISO RGD:734074 6480464 Asbestos, Crocidolite results in decreased expression of UGDH mRNA CTD PMID:29279043 Ugdh Rat cyclosporin A decreases expression ISO RGD:734073 6480464 Cyclosporine results in decreased expression of UGDH mRNA CTD PMID:20106945 Ugdh Rat DDE decreases expression ISO RGD:734073 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of UGDH mRNA CTD PMID:38568856 Ugdh Rat deguelin decreases expression ISO RGD:734073 6480464 deguelin results in decreased expression of UGDH mRNA CTD PMID:33512557 Ugdh Rat dextran sulfate multiple interactions ISO RGD:734074 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of UGDH more ... CTD PMID:29950665 Ugdh Rat diarsenic trioxide increases expression ISO RGD:734073 6480464 Arsenic Trioxide results in increased expression of UGDH mRNA CTD PMID:20458559 Ugdh Rat diarsenic trioxide decreases expression ISO RGD:734073 6480464 Arsenic Trioxide results in decreased expression of UGDH protein CTD PMID:25258189 Ugdh Rat Dibutyl phosphate affects expression ISO RGD:734073 6480464 di-n-butylphosphoric acid affects the expression of UGDH mRNA CTD PMID:37042841 Ugdh Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of UGDH mRNA CTD PMID:21266533 Ugdh Rat dichloroacetic acid increases expression ISO RGD:734074 6480464 Dichloroacetic Acid results in increased expression of UGDH mRNA CTD PMID:28962523 Ugdh Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression more ... CTD PMID:33729688 Ugdh Rat diquat increases expression ISO RGD:734074 6480464 Diquat results in increased expression of UGDH mRNA CTD PMID:36851058 Ugdh Rat diuron increases expression EXP 6480464 Diuron results in increased expression of UGDH mRNA CTD PMID:21551480 Ugdh Rat dorsomorphin multiple interactions ISO RGD:734073 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Ugdh Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of UGDH mRNA CTD PMID:29391264 Ugdh Rat epoxiconazole decreases expression ISO RGD:734074 6480464 epoxiconazole results in decreased expression of UGDH mRNA CTD PMID:35436446 Ugdh Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of UGDH mRNA CTD PMID:17920746 Ugdh Rat ethanol affects expression ISO RGD:734074 6480464 Ethanol affects the expression of UGDH mRNA CTD PMID:30319688 Ugdh Rat ethanol affects splicing ISO RGD:734074 6480464 Ethanol affects the splicing of UGDH mRNA CTD PMID:30319688 Ugdh Rat eugenol increases expression ISO RGD:734073 6480464 Eugenol results in increased expression of UGDH mRNA CTD PMID:16292757 Ugdh Rat felbamate decreases expression EXP 6480464 felbamate results in decreased expression of UGDH mRNA CTD PMID:17381134 Ugdh Rat felbamate increases expression EXP 6480464 felbamate results in increased expression of UGDH mRNA CTD PMID:17381134 Ugdh Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of UGDH mRNA CTD PMID:24136188 Ugdh Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of UGDH mRNA CTD PMID:24136188 Ugdh Rat folic acid decreases expression ISO RGD:734074 6480464 Folic Acid results in decreased expression of UGDH mRNA CTD PMID:25629700 Ugdh Rat folic acid multiple interactions ISO RGD:734074 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of UGDH mRNA CTD PMID:22206623 Ugdh Rat folpet increases expression ISO RGD:734074 6480464 folpet results in increased expression of UGDH mRNA CTD PMID:31558096 Ugdh Rat fumonisin B1 increases expression ISO RGD:734074 6480464 fumonisin B1 results in increased expression of UGDH mRNA CTD PMID:16221962 Ugdh Rat furan increases expression ISO RGD:734074 6480464 furan results in increased expression of UGDH mRNA CTD PMID:24183702 Ugdh Rat furan increases expression EXP 6480464 furan results in increased expression of UGDH mRNA CTD PMID:26194646 Ugdh Rat gabapentin decreases expression EXP 6480464 gabapentin results in decreased expression of UGDH mRNA CTD PMID:17381134 Ugdh Rat gedunin increases expression ISO RGD:734073 6480464 gedunin results in increased expression of UGDH mRNA CTD PMID:17010675 Ugdh Rat genistein increases expression ISO RGD:734073 6480464 Genistein results in increased expression of UGDH mRNA CTD PMID:15378649|PMID:16865672 Ugdh Rat genistein multiple interactions ISO RGD:734073 6480464 ESR2 promotes the reaction [Genistein results in decreased expression of UGDH protein] CTD PMID:20884965 Ugdh Rat genistein decreases expression ISO RGD:734073 6480464 Genistein results in decreased expression of UGDH protein CTD PMID:20884965 Ugdh Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of UGDH mRNA CTD PMID:22061828 Ugdh Rat glyphosate increases expression ISO RGD:734074 6480464 Glyphosate results in increased expression of UGDH protein CTD PMID:37208198 Ugdh Rat griseofulvin affects expression ISO RGD:734074 6480464 Griseofulvin affects the expression of UGDH mRNA CTD PMID:12735108 Ugdh Rat inulin multiple interactions ISO RGD:734074 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of UGDH mRNA CTD PMID:36331819 Ugdh Rat isoflavones increases expression ISO RGD:734073 6480464 Isoflavones results in increased expression of UGDH mRNA CTD PMID:17374662 Ugdh Rat isoprenaline increases expression ISO RGD:734074 6480464 Isoproterenol results in increased expression of UGDH mRNA CTD PMID:21335049 Ugdh Rat ivermectin decreases expression ISO RGD:734073 6480464 Ivermectin results in decreased expression of UGDH protein CTD PMID:32959892 Ugdh Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of UGDH mRNA CTD PMID:20080153 Ugdh Rat lead diacetate increases expression ISO RGD:734073 6480464 lead acetate results in increased expression of UGDH mRNA CTD PMID:38568856 Ugdh Rat lead(II) chloride multiple interactions ISO RGD:734073 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of more ... CTD PMID:18654764 Ugdh Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of UGDH mRNA CTD PMID:24136188 Ugdh Rat mercury dichloride increases expression EXP 6480464 Mercuric Chloride results in increased expression of UGDH mRNA CTD PMID:16507785 Ugdh Rat methylisothiazolinone increases expression ISO RGD:734073 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of UGDH mRNA CTD PMID:31629900 Ugdh Rat methylseleninic acid affects expression ISO RGD:734073 6480464 methylselenic acid affects the expression of UGDH mRNA CTD PMID:14617803 Ugdh Rat microcystin-LR increases expression ISO RGD:734074 6480464 cyanoginosin LR results in increased expression of UGDH mRNA CTD PMID:17654400 Ugdh Rat N(4)-hydroxycytidine decreases expression ISO RGD:734074 6480464 N(4)-hydroxycytidine results in decreased expression of UGDH mRNA CTD PMID:37748715 Ugdh Rat N-acetyl-L-cysteine increases expression ISO RGD:734073 6480464 Acetylcysteine results in increased expression of UGDH mRNA CTD PMID:16084531 Ugdh Rat N-ethyl-N-nitrosourea increases mutagenesis ISO RGD:734074 6480464 Ethylnitrosourea results in increased mutagenesis of UGDH gene CTD PMID:15755804 Ugdh Rat N-methyl-4-phenylpyridinium decreases expression ISO RGD:734073 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of UGDH mRNA CTD PMID:24810058 Ugdh Rat N-methylformamide affects expression ISO RGD:734074 6480464 methylformamide affects the expression of UGDH mRNA; methylformamide analog affects the expression of UGDH mRNA CTD PMID:17040096 Ugdh Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of UGDH mRNA CTD PMID:19638242 Ugdh Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of UGDH mRNA CTD PMID:28943392 Ugdh Rat N-nitrosodiethylamine multiple interactions ISO RGD:734074 6480464 [2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylnitrosamine] results in increased expression of UGDH protein; [3,4,5,3',4'-pentachlorobiphenyl co-treated with Diethylnitrosamine] more ... CTD PMID:23457121 Ugdh Rat naphthalene-1,5-diamine affects expression ISO RGD:734074 6480464 1,5-naphthalenediamine affects the expression of UGDH mRNA CTD PMID:17114358 Ugdh Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of UGDH mRNA CTD PMID:24136188 Ugdh Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of UGDH mRNA CTD PMID:24136188 Ugdh Rat Nutlin-3 multiple interactions ISO RGD:734073 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of UGDH protein CTD PMID:38460933 Ugdh Rat ochratoxin A decreases expression ISO RGD:734073 6480464 ochratoxin A results in decreased expression of UGDH mRNA CTD PMID:32905824 Ugdh Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of UGDH mRNA CTD PMID:25729387 Ugdh Rat paracetamol affects expression ISO RGD:734074 6480464 Acetaminophen affects the expression of UGDH mRNA CTD PMID:17562736 Ugdh Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of UGDH mRNA CTD PMID:33387578 Ugdh Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of UGDH mRNA CTD PMID:30723492 Ugdh Rat paracetamol decreases expression ISO RGD:734073 6480464 Acetaminophen results in decreased expression of UGDH mRNA CTD PMID:21420995|PMID:29067470 Ugdh Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of UGDH mRNA CTD PMID:32680482 Ugdh Rat pentachlorophenol increases expression ISO RGD:734074 6480464 Pentachlorophenol results in increased expression of UGDH mRNA CTD PMID:23892564 Ugdh Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:734074 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of UGDH mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Ugdh Rat perfluorooctanoic acid decreases expression ISO RGD:734073 6480464 perfluorooctanoic acid results in decreased expression of UGDH protein CTD PMID:22609092 Ugdh Rat perfluorooctanoic acid increases expression ISO RGD:734073 6480464 perfluorooctanoic acid results in increased expression of UGDH protein CTD PMID:26879310 Ugdh Rat permethrin increases expression ISO RGD:734074 6480464 Permethrin results in increased expression of UGDH mRNA CTD PMID:30629241 Ugdh Rat phenformin decreases expression EXP 6480464 Phenformin results in decreased expression of UGDH protein CTD PMID:4270849 Ugdh Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of UGDH mRNA; Phenobarbital results in increased expression of UGDH more ... CTD PMID:17381134|PMID:19162173|PMID:24090815 Ugdh Rat phenobarbital increases expression ISO RGD:734074 6480464 Phenobarbital results in increased expression of UGDH mRNA; Phenobarbital results in increased expression of UGDH more ... CTD PMID:28541575 Ugdh Rat phenobarbital affects expression ISO RGD:734074 6480464 Phenobarbital affects the expression of UGDH mRNA CTD PMID:23091169 Ugdh Rat phenytoin decreases expression EXP 6480464 Phenytoin results in decreased expression of UGDH mRNA CTD PMID:17381134 Ugdh Rat piperine decreases expression ISO RGD:734073 6480464 piperine results in decreased expression of UGDH mRNA CTD PMID:16292757 Ugdh Rat pirinixic acid multiple interactions ISO RGD:734073 6480464 [pirinixic acid co-treated with alitretinoin co-treated with PPARA protein co-treated with RXRA protein] results in more ... CTD PMID:16292757 Ugdh Rat pirinixic acid increases expression ISO RGD:734074 6480464 pirinixic acid results in increased expression of UGDH mRNA CTD PMID:15375163|PMID:16221962|PMID:20813756|PMID:23811191 Ugdh Rat pirinixic acid decreases expression ISO RGD:734074 6480464 pirinixic acid results in decreased expression of UGDH mRNA CTD PMID:18445702 Ugdh Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of UGDH mRNA CTD PMID:19162173 Ugdh Rat propiconazole increases expression ISO RGD:734074 6480464 propiconazole results in increased expression of UGDH mRNA CTD PMID:21278054 Ugdh Rat pyrogallol increases expression ISO RGD:734074 6480464 Pyrogallol results in increased expression of UGDH mRNA CTD PMID:20362636 Ugdh Rat quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of UGDH protein CTD PMID:18095365 Ugdh Rat rifampicin multiple interactions ISO RGD:734073 6480464 [Rifampin co-treated with PPARA protein co-treated with RXRA protein] results in decreased expression of UGDH more ... CTD PMID:16292757 Ugdh Rat rifampicin increases expression ISO RGD:734073 6480464 Rifampin results in increased expression of UGDH mRNA CTD PMID:16292757 Ugdh Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of UGDH mRNA CTD PMID:28374803 Ugdh Rat rotenone decreases expression ISO RGD:734073 6480464 Rotenone results in decreased expression of UGDH mRNA CTD PMID:33512557 Ugdh Rat SB 431542 multiple interactions ISO RGD:734073 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of UGDH more ... CTD PMID:27188386|PMID:37664457 Ugdh Rat silicon dioxide affects secretion ISO RGD:734073 6480464 Silicon Dioxide analog affects the secretion of UGDH protein CTD PMID:25895662 Ugdh Rat sodium arsenite decreases expression ISO RGD:734073 6480464 sodium arsenite results in decreased expression of UGDH mRNA CTD PMID:28595984|PMID:34032870 Ugdh Rat sodium arsenite increases expression ISO RGD:734073 6480464 sodium arsenite results in increased expression of UGDH mRNA CTD PMID:38568856 Ugdh Rat sodium arsenite affects expression ISO RGD:734073 6480464 sodium arsenite affects the expression of UGDH mRNA CTD PMID:29319823 Ugdh Rat sodium dichromate increases expression ISO RGD:734074 6480464 sodium bichromate results in increased expression of UGDH mRNA CTD PMID:31558096 Ugdh Rat sulforaphane increases expression ISO RGD:734073 6480464 sulforaphane results in increased expression of UGDH mRNA CTD PMID:31838189 Ugdh Rat tanespimycin increases expression ISO RGD:734073 6480464 tanespimycin analog results in increased expression of UGDH protein; tanespimycin results in increased expression of more ... CTD PMID:31370342 Ugdh Rat tert-butyl ethyl ether increases expression EXP 6480464 ethyl tert-butyl ether results in increased expression of UGDH protein CTD PMID:24090815 Ugdh Rat tetrachloromethane increases expression ISO RGD:734074 6480464 Carbon Tetrachloride results in increased expression of UGDH mRNA CTD PMID:27339419|PMID:31919559 Ugdh Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of UGDH mRNA] CTD PMID:31150632 Ugdh Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of UGDH mRNA CTD PMID:31150632 Ugdh Rat thiabendazole increases expression EXP 6480464 Thiabendazole results in increased expression of UGDH mRNA CTD PMID:18539377 Ugdh Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of UGDH mRNA CTD PMID:23411599 Ugdh Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of UGDH mRNA CTD PMID:28943392 Ugdh Rat thiram increases expression ISO RGD:734073 6480464 Thiram results in increased expression of UGDH mRNA CTD PMID:38568856 Ugdh Rat titanium dioxide multiple interactions ISO RGD:734074 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of UGDH more ... CTD PMID:29950665 Ugdh Rat titanium dioxide decreases methylation ISO RGD:734074 6480464 titanium dioxide results in decreased methylation of UGDH gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Ugdh Rat tolbutamide decreases expression EXP 6480464 Tolbutamide results in decreased expression of UGDH protein CTD PMID:4270849 Ugdh Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of UGDH mRNA CTD PMID:25729387 Ugdh Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of UGDH mRNA CTD PMID:25729387 Ugdh Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of UGDH mRNA CTD PMID:33387578 Ugdh Rat triphenyl phosphate affects expression ISO RGD:734073 6480464 triphenyl phosphate affects the expression of UGDH mRNA CTD PMID:37042841 Ugdh Rat troglitazone increases expression ISO RGD:734074 6480464 troglitazone results in increased expression of UGDH mRNA CTD PMID:28973697 Ugdh Rat tunicamycin increases expression ISO RGD:734073 6480464 Tunicamycin results in increased expression of UGDH mRNA CTD PMID:22378314|PMID:29453283 Ugdh Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of UGDH mRNA CTD PMID:24136188 Ugdh Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of UGDH mRNA CTD PMID:17381134 Ugdh Rat valproic acid affects expression ISO RGD:734073 6480464 Valproic Acid affects the expression of UGDH mRNA CTD PMID:25979313 Ugdh Rat valproic acid decreases methylation ISO RGD:734073 6480464 Valproic Acid results in decreased methylation of UGDH gene CTD PMID:29154799 Ugdh Rat valproic acid decreases expression ISO RGD:734073 6480464 Valproic Acid results in decreased expression of UGDH mRNA CTD PMID:23179753|PMID:26272509|PMID:28001369 Ugdh Rat valproic acid multiple interactions ISO RGD:734073 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-benzofuran (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-hydroxyethyl methacrylate (ISO) 2-methylcholine (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3-chloropropane-1,2-diol (EXP) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 5-fluorouracil (ISO) 9-cis-retinoic acid (ISO) acetamide (EXP) acrylamide (ISO) actinomycin D (ISO) aldrin (ISO) amitrole (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) Azoxymethane (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bromobenzene (EXP) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) cadmium sulfate (ISO) caffeine (ISO) captan (ISO) carbamazepine (EXP) carbon nanotube (ISO) celastrol (ISO) chromium(6+) (ISO) cisplatin (ISO) cobalt dichloride (EXP,ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) coumarin (EXP) coumestrol (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) DDE (ISO) deguelin (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dichloroacetic acid (ISO) dioxygen (EXP) diquat (ISO) diuron (EXP) dorsomorphin (ISO) endosulfan (EXP) epoxiconazole (ISO) ethanol (EXP,ISO) eugenol (ISO) felbamate (EXP) finasteride (EXP) flutamide (EXP) folic acid (ISO) folpet (ISO) fumonisin B1 (ISO) furan (EXP,ISO) gabapentin (EXP) gedunin (ISO) genistein (ISO) gentamycin (EXP) glyphosate (ISO) griseofulvin (ISO) inulin (ISO) isoflavones (ISO) isoprenaline (ISO) ivermectin (ISO) ketamine (EXP) lead diacetate (ISO) lead(II) chloride (ISO) leflunomide (EXP) mercury dichloride (EXP) methylisothiazolinone (ISO) methylseleninic acid (ISO) microcystin-LR (ISO) N(4)-hydroxycytidine (ISO) N-acetyl-L-cysteine (ISO) N-ethyl-N-nitrosourea (ISO) N-methyl-4-phenylpyridinium (ISO) N-methylformamide (ISO) N-nitrosodiethylamine (EXP,ISO) naphthalene-1,5-diamine (ISO) nefazodone (EXP) nimesulide (EXP) Nutlin-3 (ISO) ochratoxin A (ISO) oxaliplatin (EXP) paracetamol (EXP,ISO) paraquat (EXP) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) permethrin (ISO) phenformin (EXP) phenobarbital (EXP,ISO) phenytoin (EXP) piperine (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (EXP) propiconazole (ISO) pyrogallol (ISO) quercetin (EXP) rifampicin (ISO) rotenone (EXP,ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium dichromate (ISO) sulforaphane (ISO) tanespimycin (ISO) tert-butyl ethyl ether (EXP) tetrachloromethane (EXP,ISO) thiabendazole (EXP) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) tolbutamide (EXP) topotecan (EXP) trichloroethene (EXP) triphenyl phosphate (ISO) troglitazone (ISO) tunicamycin (ISO) valdecoxib (EXP) valproic acid (EXP,ISO)
Biological Process
chondroitin sulfate proteoglycan biosynthetic process (IEA,ISO,ISS) gastrulation with mouth forming second (IEA,ISO,ISS) glycosaminoglycan biosynthetic process (IBA) heparan sulfate proteoglycan biosynthetic process (IEA,ISO,ISS) neuron development (IEA,ISO,ISS) protein hexamerization (IEA,ISO,ISS) UDP-glucuronate biosynthetic process (IEA,ISO,ISS)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
8.
GOA pipeline
RGD automated data pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Characterization of human UDP-glucose dehydrogenase. CYS-276 is required for the second of two successive oxidations.
Sommer BJ, etal., J Biol Chem 2004 May 28;279(22):23590-6. Epub 2004 Mar 24.
12.
Molecular cloning and characterization of the human and mouse UDP-glucose dehydrogenase genes.
Spicer AP, etal., J Biol Chem 1998 Sep 25;273(39):25117-24.
13.
Enhancement of UDP-glucuronyltransferase, UDP-glucose dehydrogenase, and glutathione S-transferase activities in rat liver by dietary administration of eugenol.
Yokota H, etal., Biochem Pharmacol 1988 Mar 1;37(5):799-802.
Ugdh (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 43,202,480 - 43,226,002 (+) NCBI GRCr8 mRatBN7.2 14 42,848,704 - 42,872,351 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 42,848,854 - 42,872,354 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 43,202,670 - 43,226,148 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 44,502,588 - 44,526,066 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 42,982,708 - 43,006,181 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 44,479,614 - 44,502,845 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 44,479,614 - 44,502,845 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 44,299,226 - 44,322,226 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 45,542,781 - 45,570,961 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 45,545,171 - 45,573,352 (+) NCBI Celera 14 41,999,555 - 42,023,022 (+) NCBI Celera Cytogenetic Map 14 p11 NCBI
UGDH (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 39,498,755 - 39,527,439 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 39,498,755 - 39,528,311 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 39,500,375 - 39,529,059 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 39,176,770 - 39,205,606 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 39,322,945 - 39,351,539 NCBI Celera 4 39,938,164 - 39,967,004 (-) NCBI Celera Cytogenetic Map 4 p14 NCBI HuRef 4 38,825,375 - 38,854,230 (-) NCBI HuRef CHM1_1 4 39,499,802 - 39,528,655 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 39,468,409 - 39,497,229 (-) NCBI T2T-CHM13v2.0
Ugdh (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 65,570,550 - 65,593,185 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 65,570,564 - 65,593,292 (-) Ensembl GRCm39 Ensembl GRCm38 5 65,413,207 - 65,435,842 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 65,413,221 - 65,435,949 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 65,804,460 - 65,827,081 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 65,692,356 - 65,714,977 (-) NCBI MGSCv36 mm8 Celera 5 62,689,905 - 62,712,959 (-) NCBI Celera Cytogenetic Map 5 C3.1 NCBI cM Map 5 33.67 NCBI
Ugdh (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955443 7,868,893 - 7,882,129 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955443 7,868,893 - 7,882,136 (+) NCBI ChiLan1.0 ChiLan1.0
UGDH (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 39,688,142 - 39,716,993 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 39,880,751 - 39,909,008 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 33,827,532 - 33,856,204 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 39,679,915 - 39,708,215 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 39,681,300 - 39,708,215 (-) Ensembl panpan1.1 panPan2
UGDH (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 72,935,532 - 72,964,151 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 72,839,920 - 72,963,208 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 75,481,824 - 75,511,112 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 73,708,348 - 73,737,653 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 73,553,586 - 73,737,645 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 72,974,965 - 73,004,279 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 73,121,242 - 73,150,553 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 73,507,747 - 73,537,066 (+) NCBI UU_Cfam_GSD_1.0
Ugdh (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405285 39,179,915 - 39,207,994 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936482 7,089,621 - 7,118,284 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936482 7,090,241 - 7,118,315 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
UGDH (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 30,725,288 - 30,759,326 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 30,725,281 - 30,759,359 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 32,340,313 - 32,374,310 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
UGDH (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 27 10,781,324 - 10,810,595 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 27 10,781,502 - 10,810,817 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 57,174,192 - 57,202,679 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ugdh (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 501 Count of miRNA genes: 247 Interacting mature miRNAs: 296 Transcripts: ENSRNOT00000003691 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313089 Bss81 Bone structure and strength QTL 81 3.4 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 14 37669719 82669719 Rat 1581500 Renag1 Renal agenesis QTL 1 kidney development trait (VT:0000527) percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940) 14 8170668 68298175 Rat 10755459 Coatc15 Coat color QTL 15 0.01681 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 14 19836944 64836944 Rat 70214 Niddm28 Non-insulin dependent diabetes mellitus QTL 28 4.06 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 39998251 75582726 Rat 1300154 Bp189 Blood pressure QTL 189 3.04 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 14 30883777 68757901 Rat 70187 Pancm5 Pancreatic morphology QTL 5 16.7 pancreas mass (VT:0010144) pancreas weight to body weight ratio (CMO:0000630) 14 30320092 80829842 Rat 631523 Pia13 Pristane induced arthritis QTL 13 3.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 40793460 98037301 Rat 1358296 Ael3 Aortic elastin QTL 3 3.7 0.00051 aorta elastin amount (VT:0003905) aortic elastin 14 8267090 53267090 Rat 2313100 Bss82 Bone structure and strength QTL 82 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 14 37669719 82669719 Rat 7387267 Uae42 Urinary albumin excretion QTL 42 0.61 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 14 22167967 67167967 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 2313397 Coatc1 Coat color QTL1 coat/hair pigmentation trait (VT:0010463) coat/hair color measurement (CMO:0001808) 14 18541332 63541332 Rat 2313048 Bss84 Bone structure and strength QTL 84 3.1 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 14 37669719 82669719 Rat 1300136 Rf22 Renal function QTL 22 3.9 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 14 42262529 95023211 Rat 2302045 Pia39 Pristane induced arthritis QTL 39 4.9 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G2a level (CMO:0002116) 14 8267090 53267090 Rat 738037 Hcas6 Hepatocarcinoma susceptibility QTL 6 2.93 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 14 39057237 83368335 Rat 2313084 Bss83 Bone structure and strength QTL 83 2.9 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 14 37669719 82669719 Rat
D14Got48
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 42,854,995 - 42,855,275 (+) MAPPER mRatBN7.2 Rnor_6.0 14 44,485,742 - 44,486,023 NCBI Rnor6.0 Rnor_5.0 14 44,305,152 - 44,305,433 UniSTS Rnor5.0 RGSC_v3.4 14 45,549,232 - 45,549,514 RGD RGSC3.4 RGSC_v3.4 14 45,549,233 - 45,549,514 UniSTS RGSC3.4 RGSC_v3.1 14 45,551,623 - 45,551,905 RGD Celera 14 42,005,664 - 42,005,946 UniSTS Cytogenetic Map 14 p11 UniSTS
RH134455
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 42,871,941 - 42,872,157 (+) MAPPER mRatBN7.2 Rnor_6.0 14 44,502,436 - 44,502,651 NCBI Rnor6.0 Rnor_5.0 14 44,321,817 - 44,322,032 UniSTS Rnor5.0 RGSC_v3.4 14 45,570,552 - 45,570,767 UniSTS RGSC3.4 Celera 14 42,022,613 - 42,022,828 UniSTS Cytogenetic Map 14 p11 UniSTS
RH143560
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 42,848,781 - 42,848,924 (+) MAPPER mRatBN7.2 Rnor_6.0 14 44,479,540 - 44,479,682 NCBI Rnor6.0 Rnor_5.0 14 44,299,152 - 44,299,294 UniSTS Rnor5.0 RGSC_v3.4 14 45,542,707 - 45,542,849 UniSTS RGSC3.4 Celera 14 41,999,481 - 41,999,623 UniSTS Cytogenetic Map 14 p11 UniSTS
BF403257
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 42,849,132 - 42,849,288 (+) MAPPER mRatBN7.2 Rnor_6.0 14 44,479,891 - 44,480,046 NCBI Rnor6.0 Rnor_5.0 14 44,299,503 - 44,299,658 UniSTS Rnor5.0 RGSC_v3.4 14 45,543,058 - 45,543,213 UniSTS RGSC3.4 Celera 14 41,999,832 - 41,999,987 UniSTS Cytogenetic Map 14 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003691 ⟹ ENSRNOP00000003691
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 42,848,854 - 42,872,354 (+) Ensembl Rnor_6.0 Ensembl 14 44,479,614 - 44,502,845 (+) Ensembl
RefSeq Acc Id:
NM_031325 ⟹ NP_112615
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 43,202,518 - 43,226,002 (+) NCBI mRatBN7.2 14 42,848,856 - 42,872,351 (+) NCBI Rnor_6.0 14 44,479,614 - 44,502,845 (+) NCBI Rnor_5.0 14 44,299,226 - 44,322,226 (+) NCBI RGSC_v3.4 14 45,542,781 - 45,570,961 (+) RGD Celera 14 41,999,555 - 42,023,022 (+) RGD
Sequence:
GGAGCGGCGGGCGGAGAGGTGTGTGGAGCTTGTGGCTTGGGAGGAAGGCGCTGTCCGAGAGAACGTGATCTGCGCGGCCGCTGTGTCCTGGCCTTGGAAGTGGTTCAGTCATGGTTGAGATCAAGAAG ATCTGTTGCATTGGTGCGGGCTACGTCGGCGGACCCACATGCAGTGTCATTGCTCGCATGTGCCCTGAAATCAGGGTAACGGTTGTGGATGTCAATGAGGCCAGGATCAATGCATGGAATTCTCCAAC GCTTCCTATTTATGAGCCTGGACTAAAAGAAGTAGTCGAATCCTGTCGAGGGAAAAACCTCTTTTTTTCTACCAATATTGATGATGCCATCAGAGAAGCCGATCTAGTGTTTATTTCTGTGAACACAC CAACAAAAACATATGGAATGGGAAAAGGCCGGGCGGCAGATCTGAAGTATATCGAAGCTTGTGCTCGCCGCATTGTGCAGAACTCAAATGGGTACAAAATTGTGACTGAGAAAAGCACAGTCCCTGTG CGGGCAGCGGAAAGCATCCGCCGCATATTTGATGCCAACACAAAGCCCAACTTGAATCTACAGGTTCTGTCCAATCCTGAGTTCTTGGCAGAGGGAACAGCCATCAAGGACCTAAAGAACCCAGACAG AGTCCTGATTGGAGGGGATGAGACCCCAGAGGGCCAGAGAGCTGTTCAGGCACTCTGTGCTGTGTACGAGCACTGGGTTCCCAAGGAAAAGATCCTCACCACCAACACTTGGTCCTCAGAGCTTTCCA AACTGGCAGCCAATGCTTTTCTTGCCCAGAGGATCAGCAGCATTAACTCCATAAGTGCTCTGTGTGAAAGCACAGGCGCCGATGTGGAAGAGGTGGCAACGGCTATCGGGATGGACCAAAGAATTGGA AATAAGTTTCTAAAAGCCAGCGTTGGTTTTGGTGGGGGCTGCTTCCAAAAAGATGTTCTGAATTTGGTTTATCTCTGTGAGGCTCTGAATCTGCCCGAAGTAGCTCGTTACTGGCAGCAGGTCATAGA CATGAATGACTACCAGAGGAGGAGGTTTGCATCACGGATCATAGACAGCCTGTTTAATACAGTGACTGATAAGAAGATAGCTATCTTGGGGTTTGCGTTCAAAAAGGATACTGGTGATACCAGGGAGT CCTCCAGTATCTACATTAGCAAATACCTGATGGACGAGGGTGCGCACCTCCACATCTACGACCCCAAAGTACCCAGGGAGCAGATAGTGGTGGATCTTTCTCATCCAGGCGTCTCAGCGGATGACCAA GTGTCCAGACTGGTGACCATTTCCAAGGATCCATATGAAGCATGTGATGGCGCCCATGCCCTCGTTATCTGCACAGAGTGGGACATGTTTAAGGAACTGGATTATGAACGGATTCATAAAAGAATGCT GAAGCCAGCCTTCATATTTGATGGCCGGCGTGTCCTGGATGGGCTCCACAATGAGCTACAGACCATTGGCTTCCAGATTGAAACAATTGGCAAAAAGGTATCTTCCAAGAGAATTCCATACACTCCTG GTGAAATTCCAAAGTTTAGTCTTCAGGATCCACCTAACAAGAAGCCCAAAGTCTAGACGTCGCCCTTTTGCCTGTGATGATTTGGTACTGCAGGGTAGCCAGCGTCTGTCTGATACTAAGTGGTAAAT GAACTACGTGTTTTTATGGAAACAAAAATATTTTTGTAATCATCAAATTTATACTAGCTATCTGGGTGTTAGCATATCTAGTAATTATGAGTCTAGAATAATTTTTATATATTTTTATATTATTGTAC TCTCAGTTACTGAATGGATGGAAAACAATCATGTTGGTTTAAATGTCAGTTTTTATAAATAAAAATGAAACCTTGAATTTTTTAGCATTACAGGTTGTTACAGACTGCACTGTAATAACACAAGGGAA AGGCAGTCTCATTTCCCTACCTGTTGTCTCTGCTTATCACTAAATGGGACTTCGAAGCCGTGAAATCACTGTGCTAGGATGGCTGATGAAGGTCTCTGGACTTTTGTTTTAATGAGATTATGTCATTA GTGGTTTTAGTTGTCTTTGTGTCTCCCAAAACCACTCTGTCTTTCTCTCCATGCGTAACTCGGGCAGTGCTTTCTTTTTTGAAAATTCAGCCTGAGGAGGAAATCAGTCTATGGTCTAGTTCGTCCTG CCTCTTAGCTTCTGTACCTGCTTGTCACATTTGCACCTATGAGTCAAGATATGTTTGTTACCTTTATTTTGATTTATTTCTATTACAATTCAATTTTTTTCCTTTAATTAAGAAAACCAATAAAGTCT CATGTGTAAACTGG
hide sequence
RefSeq Acc Id:
XR_005493021
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 43,202,480 - 43,221,026 (+) NCBI mRatBN7.2 14 42,848,704 - 42,867,375 (+) NCBI
RefSeq Acc Id:
NP_112615 ⟸ NM_031325
- UniProtKB:
O70199 (UniProtKB/Swiss-Prot), A6JDD9 (UniProtKB/TrEMBL)
- Sequence:
MVEIKKICCIGAGYVGGPTCSVIARMCPEIRVTVVDVNEARINAWNSPTLPIYEPGLKEVVESCRGKNLFFSTNIDDAIREADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTE KSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPKEKILTTNTWSSELSKLAANAFLAQRISSINSISALCESTGADVEEVATAIG MDQRIGNKFLKASVGFGGGCFQKDVLNLVYLCEALNLPEVARYWQQVIDMNDYQRRRFASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSSIYISKYLMDEGAHLHIYDPKVPREQIVVDLSHPG VSADDQVSRLVTISKDPYEACDGAHALVICTEWDMFKELDYERIHKRMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGKKVSSKRIPYTPGEIPKFSLQDPPNKKPKV
hide sequence
Ensembl Acc Id:
ENSRNOP00000003691 ⟸ ENSRNOT00000003691
RGD ID: 13699314
Promoter ID: EPDNEW_R9839
Type: multiple initiation site
Name: Ugdh_1
Description: UDP-glucose 6-dehydrogenase
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 44,479,615 - 44,479,675 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-08-01
Ugdh
UDP-glucose 6-dehydrogenase
Ugdh
UDP-glucose dehydrogenase
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2004-09-10
Ugdh
UDP-glucose dehydrogenase
UDP-glucose dehydrogeanse
Name updated
1299863
APPROVED
2002-08-07
Ugdh
UDP-glucose dehydrogeanse
Symbol and Name status set to provisional
70820
PROVISIONAL