Symbol:
Dhcr7
Name:
7-dehydrocholesterol reductase
RGD ID:
621769
Description:
Enables 7-dehydrocholesterol reductase activity. Involved in cholesterol biosynthetic process and regulation of cholesterol biosynthetic process. Predicted to be located in endoplasmic reticulum and nuclear outer membrane. Predicted to be active in endoplasmic reticulum membrane. Human ortholog(s) of this gene implicated in Behcet's disease and Smith-Lemli-Opitz syndrome. Orthologous to human DHCR7 (7-dehydrocholesterol reductase); PARTICIPATES IN cholesterol biosynthetic pathway; steroid biosynthetic pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
7-DHC reductase; cholesterol-5,6-epoxide hydrolase subunit DHCR7; MGC93039; sterol Delta(7)-reductase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DHCR7 (7-dehydrocholesterol reductase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Dhcr7 (7-dehydrocholesterol reductase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Dhcr7 (7-dehydrocholesterol reductase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DHCR7 (7-dehydrocholesterol reductase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DHCR7 (7-dehydrocholesterol reductase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101971285 (7-dehydrocholesterol reductase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DHCR7 (7-dehydrocholesterol reductase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DHCR7 (7-dehydrocholesterol reductase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Dhcr7 (7-dehydrocholesterol reductase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
TTC19 (tetratricopeptide repeat domain 19) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
DHCR7 (7-dehydrocholesterol reductase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Dhcr7 (7-dehydrocholesterol reductase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
dhcr7 (7-dehydrocholesterol reductase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
LBR
Alliance
DIOPT (Ensembl Compara|InParanoid|SonicParanoid)
Caenorhabditis elegans (roundworm):
dhcr-7
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
dhcr7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 208,444,434 - 208,460,408 (+) NCBI GRCr8 mRatBN7.2 1 199,015,081 - 199,031,055 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 199,015,081 - 199,031,055 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 207,394,648 - 207,410,602 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 214,476,501 - 214,492,466 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 207,150,670 - 207,166,635 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 217,018,916 - 217,034,890 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 217,018,916 - 217,034,904 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 223,874,935 - 223,890,913 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 204,245,562 - 204,258,913 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 204,399,014 - 204,412,366 (+) NCBI Celera 1 196,577,886 - 196,593,821 (+) NCBI Celera Cytogenetic Map 1 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dhcr7 Rat (+)-catechin multiple interactions ISO DHCR7 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of DHCR7 mRNA CTD PMID:24763279 Dhcr7 Rat (-)-epigallocatechin 3-gallate increases expression ISO DHCR7 (Homo sapiens) 6480464 epigallocatechin gallate results in increased expression of DHCR7 mRNA CTD PMID:32512070 Dhcr7 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane affects expression EXP 6480464 o and p'-DDT affects the expression of DHCR7 mRNA CTD PMID:17984292 Dhcr7 Rat 1,2-dichloroethane decreases expression ISO Dhcr7 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of DHCR7 mRNA CTD PMID:28960355 Dhcr7 Rat 1,2-dimethylhydrazine decreases expression ISO Dhcr7 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of DHCR7 mRNA CTD PMID:22206623 Dhcr7 Rat 1-naphthyl isothiocyanate multiple interactions ISO DHCR7 (Homo sapiens) 6480464 [1-Naphthylisothiocyanate co-treated with Cholic Acids] affects the expression of DHCR7 mRNA CTD PMID:27344345 Dhcr7 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of DHCR7 mRNA CTD PMID:30723492 Dhcr7 Rat 17alpha-ethynylestradiol increases expression ISO Dhcr7 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of DHCR7 mRNA CTD PMID:17942748 Dhcr7 Rat 17alpha-ethynylestradiol multiple interactions ISO DHCR7 (Homo sapiens) 6480464 [Ethinyl Estradiol co-treated with Cholic Acids] affects the expression of DHCR7 mRNA CTD PMID:27344345 Dhcr7 Rat 17alpha-ethynylestradiol multiple interactions ISO Dhcr7 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DHCR7 mRNA CTD PMID:17942748 Dhcr7 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of DHCR7 mRNA CTD PMID:16174780 Dhcr7 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of DHCR7 mRNA CTD PMID:15901920 Dhcr7 Rat 17beta-estradiol increases expression ISO DHCR7 (Homo sapiens) 6480464 Estradiol results in increased expression of DHCR7 mRNA CTD PMID:19167446 and PMID:31614463 Dhcr7 Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of DHCR7 mRNA CTD PMID:32145629 Dhcr7 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Dhcr7 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Dhcr7 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO DHCR7 (Homo sapiens) 6480464 2 more ... CTD PMID:31173147 Dhcr7 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Dhcr7 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Dhcr7 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Dhcr7 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:17942748 and PMID:28433925 Dhcr7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Dhcr7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of DHCR7 mRNA CTD PMID:21570461 and PMID:26377647 Dhcr7 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of DHCR7 mRNA CTD PMID:21215274 more ... Dhcr7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of DHCR7 mRNA CTD PMID:22298810 Dhcr7 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:21724226 Dhcr7 Rat 2-amino-2-deoxy-D-glucopyranose increases expression ISO Dhcr7 (Mus musculus) 6480464 Glucosamine results in increased expression of DHCR7 mRNA CTD PMID:17178593 Dhcr7 Rat 2-butoxyethanol increases expression ISO Dhcr7 (Mus musculus) 6480464 n-butoxyethanol results in increased expression of DHCR7 mRNA CTD PMID:19812364 Dhcr7 Rat 2-ethoxyethanol increases expression EXP 6480464 2-ethoxyethanol results in increased expression of DHCR7 mRNA CTD PMID:19643169 Dhcr7 Rat 2-methoxyethanol increases expression EXP 6480464 methyl cellosolve results in increased expression of DHCR7 mRNA CTD PMID:19643169 Dhcr7 Rat 22-Hydroxycholesterol decreases expression ISO DHCR7 (Homo sapiens) 6480464 22-hydroxycholesterol results in decreased expression of DHCR7 mRNA CTD PMID:19426978 Dhcr7 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23196670 Dhcr7 Rat 3H-1,2-dithiole-3-thione decreases expression ISO Dhcr7 (Mus musculus) 6480464 1 and 2-dithiol-3-thione results in decreased expression of DHCR7 mRNA CTD PMID:15302862 Dhcr7 Rat 4,4'-sulfonyldiphenol increases expression ISO DHCR7 (Homo sapiens) 6480464 bisphenol S results in increased expression of DHCR7 mRNA CTD PMID:27685785 Dhcr7 Rat 4,4'-sulfonyldiphenol increases expression ISO Dhcr7 (Mus musculus) 6480464 bisphenol S results in increased expression of DHCR7 mRNA CTD PMID:34850234 Dhcr7 Rat 4,4'-sulfonyldiphenol decreases expression ISO Dhcr7 (Mus musculus) 6480464 bisphenol S results in decreased expression of DHCR7 mRNA CTD PMID:33297965 Dhcr7 Rat 4,4'-sulfonyldiphenol affects expression ISO Dhcr7 (Mus musculus) 6480464 bisphenol S affects the expression of DHCR7 mRNA CTD PMID:39298647 Dhcr7 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of DHCR7 mRNA CTD PMID:21346803 Dhcr7 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of DHCR7 mRNA CTD PMID:24780913 Dhcr7 Rat 7,12-dimethyltetraphene decreases expression ISO Dhcr7 (Mus musculus) 6480464 9 more ... CTD PMID:32553695 Dhcr7 Rat 8-Br-cAMP increases expression ISO DHCR7 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of DHCR7 mRNA CTD PMID:22079614 Dhcr7 Rat Acetyl tributyl citrate decreases expression ISO Dhcr7 (Mus musculus) 6480464 2-acetyltributylcitrate results in decreased expression of DHCR7 mRNA CTD PMID:37055963 Dhcr7 Rat acrylamide decreases expression ISO DHCR7 (Homo sapiens) 6480464 Acrylamide results in decreased expression of DHCR7 mRNA CTD PMID:32763439 Dhcr7 Rat aflatoxin B1 affects expression ISO DHCR7 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of DHCR7 protein CTD PMID:20106945 Dhcr7 Rat aflatoxin B1 decreases expression ISO DHCR7 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of DHCR7 mRNA CTD PMID:27153756 Dhcr7 Rat aflatoxin B1 decreases expression ISO Dhcr7 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of DHCR7 mRNA CTD PMID:19770486 Dhcr7 Rat aldehydo-D-glucosamine increases expression ISO Dhcr7 (Mus musculus) 6480464 Glucosamine results in increased expression of DHCR7 mRNA CTD PMID:17178593 Dhcr7 Rat all-trans-retinoic acid decreases expression ISO DHCR7 (Homo sapiens) 6480464 Tretinoin results in decreased expression of DHCR7 mRNA CTD PMID:23724009 Dhcr7 Rat all-trans-retinoic acid increases expression ISO DHCR7 (Homo sapiens) 6480464 Tretinoin results in increased expression of DHCR7 mRNA CTD PMID:33167477 Dhcr7 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of DHCR7 mRNA CTD PMID:35163327 Dhcr7 Rat amiodarone increases expression EXP 6480464 Amiodarone results in increased expression of DHCR7 mRNA CTD PMID:22291062 Dhcr7 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of DHCR7 mRNA CTD PMID:16483693 Dhcr7 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of DHCR7 mRNA CTD PMID:30779732 Dhcr7 Rat androgen antagonist multiple interactions EXP 6480464 [Pesticides co-treated with Phthalic Acids co-treated with Androgen Antagonists] results in decreased expression of DHCR7 mRNA CTD PMID:29945228 Dhcr7 Rat arachidonic acid decreases expression ISO DHCR7 (Homo sapiens) 6480464 Arachidonic Acid results in decreased expression of DHCR7 mRNA CTD PMID:16704987 Dhcr7 Rat aristolochic acid A decreases expression ISO DHCR7 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of DHCR7 mRNA CTD PMID:33212167 Dhcr7 Rat arsane affects methylation ISO DHCR7 (Homo sapiens) 6480464 Arsenic affects the methylation of DHCR7 gene CTD PMID:25304211 Dhcr7 Rat arsane multiple interactions ISO DHCR7 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of DHCR7 mRNA CTD PMID:39836092 Dhcr7 Rat arsenic atom affects methylation ISO DHCR7 (Homo sapiens) 6480464 Arsenic affects the methylation of DHCR7 gene CTD PMID:25304211 Dhcr7 Rat arsenic atom multiple interactions ISO DHCR7 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of DHCR7 mRNA CTD PMID:39836092 Dhcr7 Rat avobenzone increases expression ISO DHCR7 (Homo sapiens) 6480464 avobenzone results in increased expression of DHCR7 mRNA CTD PMID:31016361 Dhcr7 Rat Azaspiracid increases expression ISO DHCR7 (Homo sapiens) 6480464 azaspiracid results in increased expression of DHCR7 mRNA CTD PMID:28939011 Dhcr7 Rat benzalkonium chloride decreases activity ISO DHCR7 (Homo sapiens) 6480464 Benzalkonium Compounds results in decreased activity of DHCR7 protein CTD PMID:26919959 Dhcr7 Rat benzalkonium chloride increases expression ISO DHCR7 (Homo sapiens) 6480464 Benzalkonium Compounds results in increased expression of DHCR7 mRNA CTD PMID:26919959 Dhcr7 Rat benzalkonium chloride decreases activity ISO Dhcr7 (Mus musculus) 6480464 Benzalkonium Compounds results in decreased activity of DHCR7 protein CTD PMID:26919959 Dhcr7 Rat benzene affects expression EXP 6480464 Benzene affects the expression of DHCR7 mRNA CTD PMID:15878777 Dhcr7 Rat benzo[a]pyrene decreases expression ISO DHCR7 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of DHCR7 mRNA CTD PMID:20106945 more ... Dhcr7 Rat benzo[a]pyrene decreases expression ISO Dhcr7 (Mus musculus) 6480464 Benzo(a)pyrene metabolite results in decreased expression of DHCR7 mRNA CTD PMID:32553695 Dhcr7 Rat beta-D-glucosamine increases expression ISO Dhcr7 (Mus musculus) 6480464 Glucosamine results in increased expression of DHCR7 mRNA CTD PMID:17178593 Dhcr7 Rat beta-lapachone decreases expression ISO DHCR7 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of DHCR7 mRNA CTD PMID:38218311 Dhcr7 Rat beta-naphthoflavone multiple interactions ISO Dhcr7 (Mus musculus) 6480464 AHR protein affects the reaction [beta-Naphthoflavone results in decreased expression of DHCR7 mRNA] CTD PMID:22234961 Dhcr7 Rat beta-naphthoflavone decreases expression ISO Dhcr7 (Mus musculus) 6480464 beta-Naphthoflavone results in decreased expression of DHCR7 mRNA CTD PMID:22234961 Dhcr7 Rat bexarotene increases expression EXP 6480464 bexarotene results in increased expression of DHCR7 mRNA CTD PMID:16648578 Dhcr7 Rat bezafibrate affects expression EXP 6480464 Bezafibrate affects the expression of DHCR7 mRNA CTD PMID:17719200 Dhcr7 Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of DHCR7 mRNA CTD PMID:33983380 Dhcr7 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Dhcr7 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Dhcr7 Rat bisphenol A affects expression ISO Dhcr7 (Mus musculus) 6480464 bisphenol A affects the expression of DHCR7 mRNA CTD PMID:21636974 Dhcr7 Rat bisphenol A affects expression ISO DHCR7 (Homo sapiens) 6480464 bisphenol A affects the expression of DHCR7 protein CTD PMID:37567409 Dhcr7 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DHCR7 mRNA CTD PMID:31771501 Dhcr7 Rat bisphenol A increases expression ISO DHCR7 (Homo sapiens) 6480464 bisphenol A results in increased expression of DHCR7 mRNA and bisphenol A results in increased expression of DHCR7 protein CTD PMID:29275510 and PMID:34186270 Dhcr7 Rat bisphenol A multiple interactions ISO Dhcr7 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Dhcr7 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of DHCR7 gene CTD PMID:28505145 Dhcr7 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of DHCR7 mRNA CTD PMID:25181051 more ... Dhcr7 Rat bisphenol A increases expression ISO Dhcr7 (Mus musculus) 6480464 bisphenol A results in increased expression of DHCR7 mRNA CTD PMID:25270620 Dhcr7 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DHCR7 mRNA CTD PMID:15901920 Dhcr7 Rat bisphenol AF increases expression ISO DHCR7 (Homo sapiens) 6480464 bisphenol AF results in increased expression of DHCR7 protein CTD PMID:34186270 Dhcr7 Rat Bisphenol B increases expression ISO DHCR7 (Homo sapiens) 6480464 bisphenol B results in increased expression of DHCR7 protein CTD PMID:34186270 Dhcr7 Rat bisphenol F increases expression ISO DHCR7 (Homo sapiens) 6480464 bisphenol F results in increased expression of DHCR7 protein CTD PMID:34186270 Dhcr7 Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of DHCR7 mRNA CTD PMID:32479839 Dhcr7 Rat Butylbenzyl phthalate decreases expression EXP 6480464 butylbenzyl phthalate results in decreased expression of DHCR7 mRNA CTD PMID:33983380 Dhcr7 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of DHCR7 promoter CTD PMID:22457795 Dhcr7 Rat cadmium dichloride decreases expression ISO Dhcr7 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of DHCR7 mRNA CTD PMID:24982889 Dhcr7 Rat caffeine decreases expression EXP 6480464 Caffeine results in decreased expression of DHCR7 mRNA CTD PMID:25868845 Dhcr7 Rat calcitriol increases expression ISO DHCR7 (Homo sapiens) 6480464 Calcitriol results in increased expression of DHCR7 mRNA CTD PMID:26485663 Dhcr7 Rat carbon nanotube increases expression ISO DHCR7 (Homo sapiens) 6480464 Nanotubes and Carbon results in increased expression of DHCR7 mRNA CTD PMID:24389112 Dhcr7 Rat carbon nanotube increases expression ISO Dhcr7 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of DHCR7 mRNA CTD PMID:25554681 Dhcr7 Rat carbon nanotube decreases expression ISO Dhcr7 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Dhcr7 Rat cariprazine decreases activity ISO Dhcr7 (Mus musculus) 6480464 cariprazine results in decreased activity of DHCR7 protein CTD PMID:29698737 Dhcr7 Rat cerium trichloride affects expression ISO Dhcr7 (Mus musculus) 6480464 cerous chloride affects the expression of DHCR7 mRNA CTD PMID:23139204 Dhcr7 Rat chlorpyrifos increases expression ISO Dhcr7 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of DHCR7 mRNA CTD PMID:37019170 Dhcr7 Rat cholesta-5,7-dien-3beta-ol increases abundance ISO DHCR7 (Homo sapiens) 6480464 DHCR7 mutant form results in increased abundance of 7-dehydrocholesterol CTD PMID:16446309 Dhcr7 Rat cholesta-5,7-dien-3beta-ol multiple interactions ISO DHCR7 (Homo sapiens) 6480464 [BM 15766 results in decreased activity of DHCR7 protein] which results in increased abundance of 7-dehydrocholesterol CTD PMID:16365879 and PMID:16824767 Dhcr7 Rat cholesta-5,7-dien-3beta-ol increases reduction ISO DHCR7 (Homo sapiens) 6480464 DHCR7 results in increased reduction of 7-dehydrocholesterol CTD PMID:15896653 Dhcr7 Rat cholesta-5,7-dien-3beta-ol multiple interactions ISO Dhcr7 (Mus musculus) 6480464 Simvastatin inhibits the reaction [DHCR7 mutant form results in increased abundance of 7-dehydrocholesterol] CTD PMID:16446309 Dhcr7 Rat cholesta-5,7-dien-3beta-ol increases abundance ISO Dhcr7 (Mus musculus) 6480464 DHCR7 mutant form results in increased abundance of 7-dehydrocholesterol CTD PMID:16446309 Dhcr7 Rat cholesterol decreases abundance ISO DHCR7 (Homo sapiens) 6480464 DHCR7 mutant form results in decreased abundance of Cholesterol CTD PMID:16446309 Dhcr7 Rat cholesterol multiple interactions ISO DHCR7 (Homo sapiens) 6480464 Simvastatin promotes the reaction [DHCR7 results in increased chemical synthesis of Cholesterol] CTD PMID:15896653 Dhcr7 Rat cholesterol increases chemical synthesis ISO DHCR7 (Homo sapiens) 6480464 DHCR7 results in increased chemical synthesis of Cholesterol CTD PMID:15896653 Dhcr7 Rat cholesterol affects response to substance ISO DHCR7 (Homo sapiens) 6480464 DHCR7 mutant form affects the susceptibility to Cholesterol CTD PMID:19365639 Dhcr7 Rat choline multiple interactions ISO Dhcr7 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of DHCR7 mRNA CTD PMID:20938992 Dhcr7 Rat ciguatoxin CTX1B affects expression ISO Dhcr7 (Mus musculus) 6480464 Ciguatoxins affects the expression of DHCR7 mRNA CTD PMID:18353800 Dhcr7 Rat cisplatin decreases expression ISO DHCR7 (Homo sapiens) 6480464 Cisplatin results in decreased expression of DHCR7 mRNA CTD PMID:24280081 Dhcr7 Rat cisplatin affects expression ISO DHCR7 (Homo sapiens) 6480464 Cisplatin affects the expression of DHCR7 mRNA CTD PMID:27594783 Dhcr7 Rat cisplatin multiple interactions ISO DHCR7 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of DHCR7 mRNA and [Cisplatin co-treated with Paclitaxel] results in increased expression of DHCR7 mRNA CTD PMID:20705681 and PMID:27392435 Dhcr7 Rat cisplatin decreases expression ISO Dhcr7 (Mus musculus) 6480464 Cisplatin results in decreased expression of DHCR7 mRNA CTD PMID:24280081 Dhcr7 Rat clobetasol increases expression ISO Dhcr7 (Mus musculus) 6480464 Clobetasol results in increased expression of DHCR7 mRNA CTD PMID:27462272 Dhcr7 Rat clofibrate multiple interactions ISO Dhcr7 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of DHCR7 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of DHCR7 mRNA] CTD PMID:17585979 Dhcr7 Rat clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of DHCR7 mRNA CTD PMID:33983380 Dhcr7 Rat clozapine increases expression ISO DHCR7 (Homo sapiens) 6480464 Clozapine results in increased expression of DHCR7 mRNA CTD PMID:17052361 Dhcr7 Rat cobalt dichloride decreases expression ISO DHCR7 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of DHCR7 mRNA CTD PMID:19320972 Dhcr7 Rat copper atom multiple interactions ISO DHCR7 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of DHCR7 mRNA CTD PMID:20971185 Dhcr7 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of DHCR7 mRNA CTD PMID:22465980 Dhcr7 Rat copper(0) multiple interactions ISO DHCR7 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of DHCR7 mRNA CTD PMID:20971185 Dhcr7 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of DHCR7 mRNA CTD PMID:22465980 Dhcr7 Rat copper(II) chloride decreases expression ISO DHCR7 (Homo sapiens) 6480464 cupric chloride results in decreased expression of DHCR7 mRNA CTD PMID:34921933 and PMID:38568856 Dhcr7 Rat copper(II) sulfate decreases expression ISO DHCR7 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of DHCR7 mRNA CTD PMID:19549813 Dhcr7 Rat coumestrol multiple interactions ISO DHCR7 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of DHCR7 mRNA CTD PMID:19167446 Dhcr7 Rat coumestrol increases expression ISO DHCR7 (Homo sapiens) 6480464 Coumestrol results in increased expression of DHCR7 mRNA CTD PMID:19167446 Dhcr7 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of DHCR7 mRNA CTD PMID:27523638 Dhcr7 Rat curcumin affects expression ISO Dhcr7 (Mus musculus) 6480464 Curcumin affects the expression of DHCR7 mRNA CTD PMID:27208389 Dhcr7 Rat curcumin decreases expression EXP 6480464 Curcumin results in decreased expression of DHCR7 mRNA CTD PMID:27208389 Dhcr7 Rat cyclosporin A multiple interactions ISO DHCR7 (Homo sapiens) 6480464 [Cyclosporine co-treated with Cholic Acids] affects the expression of DHCR7 mRNA CTD PMID:27344345 Dhcr7 Rat cyclosporin A increases expression ISO DHCR7 (Homo sapiens) 6480464 Cyclosporine results in increased expression of DHCR7 mRNA CTD PMID:27989131 Dhcr7 Rat cyclosporin A decreases expression ISO DHCR7 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of DHCR7 mRNA CTD PMID:20106945 more ... Dhcr7 Rat DDE multiple interactions EXP 6480464 [Pesticides co-treated with Dichlorodiphenyl Dichloroethylene co-treated with Phthalic Acids] results in decreased expression of DHCR7 mRNA CTD PMID:34000504 Dhcr7 Rat DDE decreases expression ISO DHCR7 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of DHCR7 mRNA CTD PMID:38568856 Dhcr7 Rat Di-n-hexyl phthalate decreases expression EXP 6480464 di-n-hexyl phthalate results in decreased expression of DHCR7 mRNA CTD PMID:33983380 Dhcr7 Rat dibutyl phthalate increases expression ISO Dhcr7 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of DHCR7 mRNA CTD PMID:17361019 and PMID:21266533 Dhcr7 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of DHCR7 mRNA CTD PMID:21266533 more ... Dhcr7 Rat Dicyclohexyl phthalate decreases expression EXP 6480464 dicyclohexyl phthalate results in decreased expression of DHCR7 mRNA CTD PMID:33983380 Dhcr7 Rat diethyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with diisobutyl phthalate] results in decreased expression of DHCR7 mRNA CTD PMID:33983380 Dhcr7 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of DHCR7 mRNA CTD PMID:36653537 Dhcr7 Rat difenoconazole increases expression EXP 6480464 difenoconazole results in increased expression of DHCR7 mRNA CTD PMID:28263823 Dhcr7 Rat diheptyl phthalate decreases expression EXP 6480464 diheptyl phthalate results in decreased expression of DHCR7 mRNA CTD PMID:22112501 and PMID:33983380 Dhcr7 Rat diisobutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with diisobutyl phthalate] results in decreased expression of DHCR7 mRNA CTD PMID:33983380 Dhcr7 Rat diisobutyl phthalate decreases expression EXP 6480464 diisobutyl phthalate results in decreased expression of DHCR7 mRNA CTD PMID:33983380 Dhcr7 Rat diisononyl phthalate decreases expression EXP 6480464 diisononyl phthalate results in decreased expression of DHCR7 mRNA CTD PMID:22112501 and PMID:33983380 Dhcr7 Rat dimethylarsinic acid multiple interactions ISO Dhcr7 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of DHCR7 mRNA CTD PMID:34876320 Dhcr7 Rat dipentyl phthalate decreases expression EXP 6480464 di-n-pentyl phthalate results in decreased expression of DHCR7 mRNA CTD PMID:22112501 more ... Dhcr7 Rat dipentyl phthalate multiple interactions EXP 6480464 [Simvastatin co-treated with di-n-pentyl phthalate] results in decreased expression of DHCR7 mRNA CTD PMID:25055962 Dhcr7 Rat diquat decreases expression ISO Dhcr7 (Mus musculus) 6480464 Diquat results in decreased expression of DHCR7 protein CTD PMID:36851058 Dhcr7 Rat elemental selenium increases expression ISO DHCR7 (Homo sapiens) 6480464 Selenium results in increased expression of DHCR7 mRNA CTD PMID:19244175 Dhcr7 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of DHCR7 mRNA CTD PMID:29391264 Dhcr7 Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of DHCR7 mRNA CTD PMID:29391264 Dhcr7 Rat epoxiconazole decreases expression ISO Dhcr7 (Mus musculus) 6480464 epoxiconazole results in decreased expression of DHCR7 mRNA CTD PMID:35436446 Dhcr7 Rat epoxiconazole increases expression ISO DHCR7 (Homo sapiens) 6480464 epoxiconazole results in increased expression of DHCR7 mRNA CTD PMID:34182286 Dhcr7 Rat ethanol multiple interactions EXP 6480464 [Fish Oils co-treated with Ethanol] results in increased expression of DHCR7 mRNA CTD PMID:17347304 Dhcr7 Rat ethanol affects splicing ISO Dhcr7 (Mus musculus) 6480464 Ethanol affects the splicing of DHCR7 mRNA CTD PMID:30319688 Dhcr7 Rat ethanol increases expression ISO Dhcr7 (Mus musculus) 6480464 Ethanol results in increased expression of DHCR7 mRNA CTD PMID:19167417 Dhcr7 Rat ethyl methanesulfonate decreases expression ISO DHCR7 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of DHCR7 mRNA CTD PMID:23649840 Dhcr7 Rat Febrifugine decreases expression ISO DHCR7 (Homo sapiens) 6480464 febrifugine results in decreased expression of DHCR7 mRNA and febrifugine results in decreased expression of DHCR7 protein CTD PMID:38431229 Dhcr7 Rat fenarimol increases expression EXP 6480464 fenarimol results in increased expression of DHCR7 mRNA CTD PMID:28970091 Dhcr7 Rat fenthion increases expression ISO Dhcr7 (Mus musculus) 6480464 Fenthion results in increased expression of DHCR7 mRNA CTD PMID:34813904 Dhcr7 Rat fluoranthene multiple interactions ISO Dhcr7 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of DHCR7 mRNA CTD PMID:28329830 Dhcr7 Rat fluoranthene decreases expression ISO Dhcr7 (Mus musculus) 6480464 fluoranthene results in decreased expression of DHCR7 mRNA CTD PMID:28329830 Dhcr7 Rat fluoxetine increases expression ISO DHCR7 (Homo sapiens) 6480464 Fluoxetine results in increased expression of DHCR7 mRNA CTD PMID:37386098 Dhcr7 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of DHCR7 mRNA CTD PMID:19299419 and PMID:24136188 Dhcr7 Rat folic acid multiple interactions ISO Dhcr7 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of DHCR7 mRNA CTD PMID:20938992 Dhcr7 Rat folic acid decreases expression ISO Dhcr7 (Mus musculus) 6480464 Folic Acid results in decreased expression of DHCR7 mRNA CTD PMID:25629700 Dhcr7 Rat formaldehyde decreases expression ISO DHCR7 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of DHCR7 mRNA CTD PMID:23649840 Dhcr7 Rat FR900359 increases phosphorylation ISO DHCR7 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of DHCR7 protein CTD PMID:37730182 Dhcr7 Rat galaxolide decreases expression EXP 6480464 galaxolide results in decreased expression of DHCR7 mRNA CTD PMID:37797914 Dhcr7 Rat Ganoderic acid A decreases expression ISO DHCR7 (Homo sapiens) 6480464 ganoderic acid A results in decreased expression of DHCR7 mRNA CTD PMID:29852127 Dhcr7 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of DHCR7 mRNA CTD PMID:33387578 Dhcr7 Rat hydrogen peroxide multiple interactions ISO DHCR7 (Homo sapiens) 6480464 [isoquercitrin co-treated with Hydrogen Peroxide] results in increased expression of DHCR7 mRNA CTD PMID:18032389 Dhcr7 Rat hydroxychloroquine affects expression ISO DHCR7 (Homo sapiens) 6480464 Hydroxychloroquine affects the expression of DHCR7 mRNA CTD PMID:28975700 Dhcr7 Rat hydroxychloroquine multiple interactions ISO DHCR7 (Homo sapiens) 6480464 Hydroxychloroquine affects the reaction [Simvastatin affects the expression of DHCR7 mRNA] CTD PMID:28975700 Dhcr7 Rat isotretinoin decreases expression ISO DHCR7 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of DHCR7 mRNA CTD PMID:20436886 Dhcr7 Rat ivermectin decreases expression ISO DHCR7 (Homo sapiens) 6480464 Ivermectin results in decreased expression of DHCR7 protein CTD PMID:32959892 Dhcr7 Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of DHCR7 mRNA CTD PMID:28263823 and PMID:36653537 Dhcr7 Rat ketoconazole increases expression ISO DHCR7 (Homo sapiens) 6480464 Ketoconazole results in increased expression of DHCR7 mRNA CTD PMID:36621641 Dhcr7 Rat L-methionine multiple interactions ISO Dhcr7 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of DHCR7 mRNA CTD PMID:20938992 Dhcr7 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of DHCR7 mRNA CTD PMID:24136188 Dhcr7 Rat leflunomide decreases expression ISO DHCR7 (Homo sapiens) 6480464 leflunomide results in decreased expression of DHCR7 mRNA CTD PMID:28988120 Dhcr7 Rat linalool increases expression ISO DHCR7 (Homo sapiens) 6480464 linalool results in increased expression of DHCR7 mRNA CTD PMID:24752549 Dhcr7 Rat methidathion increases expression ISO Dhcr7 (Mus musculus) 6480464 methidathion results in increased expression of DHCR7 mRNA CTD PMID:34813904 Dhcr7 Rat methyl methanesulfonate decreases expression ISO DHCR7 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of DHCR7 mRNA CTD PMID:23649840 Dhcr7 Rat methylarsonic acid multiple interactions ISO Dhcr7 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of DHCR7 mRNA CTD PMID:34876320 Dhcr7 Rat miconazole increases expression ISO Dhcr7 (Mus musculus) 6480464 Miconazole results in increased expression of DHCR7 mRNA CTD PMID:27462272 Dhcr7 Rat mono(2-ethylhexyl) phthalate affects expression EXP 6480464 mono-(2-ethylhexyl)phthalate affects the expression of DHCR7 and mono-(2-ethylhexyl)phthalate affects the expression of DHCR7 mRNA CTD PMID:16809437 and PMID:19560483 Dhcr7 Rat mono(2-ethylhexyl) phthalate decreases expression ISO Dhcr7 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of DHCR7 mRNA CTD PMID:22401849 Dhcr7 Rat mono(2-ethylhexyl) phthalate decreases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of DHCR7 mRNA CTD PMID:16809437 Dhcr7 Rat motexafin gadolinium decreases expression ISO DHCR7 (Homo sapiens) 6480464 motexafin gadolinium results in decreased expression of DHCR7 mRNA CTD PMID:16357179 Dhcr7 Rat N-methyl-4-phenylpyridinium decreases expression ISO Dhcr7 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of DHCR7 mRNA CTD PMID:22776087 Dhcr7 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of DHCR7 mRNA CTD PMID:28801915 Dhcr7 Rat N-nitrosodiethylamine increases expression ISO Dhcr7 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of DHCR7 mRNA CTD PMID:24535843 Dhcr7 Rat N-nitrosodimethylamine decreases expression ISO DHCR7 (Homo sapiens) 6480464 Dimethylnitrosamine results in decreased expression of DHCR7 mRNA CTD PMID:17547211 Dhcr7 Rat naphthalenes decreases expression EXP 6480464 Naphthalenes results in decreased expression of DHCR7 protein CTD PMID:17337753 Dhcr7 Rat nickel atom decreases expression ISO DHCR7 (Homo sapiens) 6480464 Nickel results in decreased expression of DHCR7 mRNA CTD PMID:24768652 Dhcr7 Rat nitroglycerin decreases expression EXP 6480464 Nitroglycerin results in decreased expression of DHCR7 mRNA CTD PMID:12102619 Dhcr7 Rat obeticholic acid increases expression ISO DHCR7 (Homo sapiens) 6480464 obeticholic acid results in increased expression of DHCR7 mRNA CTD PMID:27939613 Dhcr7 Rat ochratoxin A decreases expression ISO DHCR7 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of DHCR7 mRNA CTD PMID:19287073 Dhcr7 Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of DHCR7 mRNA CTD PMID:16716893 Dhcr7 Rat ozone multiple interactions ISO Dhcr7 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of DHCR7 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of DHCR7 mRNA CTD PMID:34911549 Dhcr7 Rat paclitaxel multiple interactions ISO DHCR7 (Homo sapiens) 6480464 [Cisplatin co-treated with Paclitaxel] results in increased expression of DHCR7 mRNA CTD PMID:20705681 Dhcr7 Rat paracetamol multiple interactions ISO Dhcr7 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of DHCR7 mRNA more ... CTD PMID:17585979 and PMID:29246445 Dhcr7 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of DHCR7 mRNA CTD PMID:33387578 Dhcr7 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of DHCR7 mRNA CTD PMID:32479839 Dhcr7 Rat paracetamol increases expression ISO Dhcr7 (Mus musculus) 6480464 Acetaminophen results in increased expression of DHCR7 mRNA CTD PMID:29246445 Dhcr7 Rat paracetamol decreases expression ISO DHCR7 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of DHCR7 mRNA CTD PMID:22230336 and PMID:29067470 Dhcr7 Rat paracetamol affects expression ISO Dhcr7 (Mus musculus) 6480464 Acetaminophen affects the expression of DHCR7 mRNA CTD PMID:17562736 Dhcr7 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of DHCR7 mRNA CTD PMID:16328009 Dhcr7 Rat perfluorohexanesulfonic acid increases expression ISO Dhcr7 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of DHCR7 mRNA CTD PMID:37995155 Dhcr7 Rat perfluorononanoic acid decreases expression ISO DHCR7 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of DHCR7 mRNA CTD PMID:32588087 Dhcr7 Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of DHCR7 mRNA CTD PMID:19162173 Dhcr7 Rat perfluorooctane-1-sulfonic acid decreases expression ISO DHCR7 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of DHCR7 mRNA CTD PMID:36864359 and PMID:38199259 Dhcr7 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of DHCR7 mRNA CTD PMID:19162173 Dhcr7 Rat perfluorooctanoic acid decreases expression ISO DHCR7 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of DHCR7 mRNA CTD PMID:38199259 Dhcr7 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of DHCR7 mRNA CTD PMID:35163327 Dhcr7 Rat perfluorooctanoic acid increases expression ISO DHCR7 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of DHCR7 mRNA CTD PMID:25868421 Dhcr7 Rat phenethyl isothiocyanate decreases expression ISO DHCR7 (Homo sapiens) 6480464 phenethyl isothiocyanate results in decreased expression of DHCR7 mRNA CTD PMID:26678675 Dhcr7 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of DHCR7 mRNA CTD PMID:19162173 Dhcr7 Rat phenobarbital increases expression ISO Dhcr7 (Mus musculus) 6480464 Phenobarbital results in increased expression of DHCR7 mRNA CTD PMID:25270620 Dhcr7 Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of DHCR7 mRNA CTD PMID:18158353 Dhcr7 Rat phenylpropanolamine increases expression ISO DHCR7 (Homo sapiens) 6480464 Phenylpropanolamine results in increased expression of DHCR7 mRNA CTD PMID:27756839 Dhcr7 Rat picrotoxin decreases expression EXP 6480464 Picrotoxin results in decreased expression of DHCR7 mRNA CTD PMID:15170462 Dhcr7 Rat pirinixic acid multiple interactions ISO DHCR7 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of DHCR7 mRNA CTD PMID:19710929 Dhcr7 Rat pirinixic acid increases expression ISO Dhcr7 (Mus musculus) 6480464 pirinixic acid results in increased expression of DHCR7 mRNA CTD PMID:11798191 and PMID:17426115 Dhcr7 Rat pirinixic acid decreases expression ISO Dhcr7 (Mus musculus) 6480464 pirinixic acid results in decreased expression of DHCR7 mRNA CTD PMID:18445702 Dhcr7 Rat potassium dichromate increases expression ISO DHCR7 (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of DHCR7 mRNA and Potassium Dichromate results in increased expression of DHCR7 protein CTD PMID:23718831 Dhcr7 Rat progesterone increases expression ISO DHCR7 (Homo sapiens) 6480464 Progesterone results in increased expression of DHCR7 mRNA CTD PMID:18070364 Dhcr7 Rat propiconazole increases expression ISO Dhcr7 (Mus musculus) 6480464 propiconazole results in increased expression of DHCR7 mRNA CTD PMID:17178688 and PMID:21278054 Dhcr7 Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of DHCR7 mRNA CTD PMID:28970091 Dhcr7 Rat quercetin decreases expression ISO DHCR7 (Homo sapiens) 6480464 Quercetin results in decreased expression of DHCR7 mRNA CTD PMID:21632981 Dhcr7 Rat quercetin 3-O-beta-D-glucofuranoside multiple interactions ISO DHCR7 (Homo sapiens) 6480464 [isoquercitrin co-treated with Hydrogen Peroxide] results in increased expression of DHCR7 mRNA CTD PMID:18032389 Dhcr7 Rat quercetin 3-O-beta-D-glucopyranoside multiple interactions ISO DHCR7 (Homo sapiens) 6480464 [isoquercitrin co-treated with Hydrogen Peroxide] results in increased expression of DHCR7 mRNA CTD PMID:18032389 Dhcr7 Rat resveratrol multiple interactions ISO DHCR7 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of DHCR7 mRNA CTD PMID:19167446 Dhcr7 Rat resveratrol increases expression ISO Dhcr7 (Mus musculus) 6480464 resveratrol results in increased expression of DHCR7 protein CTD PMID:25505154 Dhcr7 Rat ritonavir affects expression EXP 6480464 Ritonavir affects the expression of DHCR7 mRNA CTD PMID:17719200 Dhcr7 Rat rotenone increases expression ISO DHCR7 (Homo sapiens) 6480464 Rotenone results in increased expression of DHCR7 mRNA CTD PMID:29955902 Dhcr7 Rat selenium atom increases expression ISO DHCR7 (Homo sapiens) 6480464 Selenium results in increased expression of DHCR7 mRNA CTD PMID:19244175 Dhcr7 Rat simvastatin multiple interactions EXP 6480464 [Simvastatin co-treated with di-n-pentyl phthalate] results in decreased expression of DHCR7 mRNA CTD PMID:25055962 Dhcr7 Rat simvastatin affects expression ISO DHCR7 (Homo sapiens) 6480464 Simvastatin affects the expression of DHCR7 mRNA CTD PMID:28975700 Dhcr7 Rat simvastatin multiple interactions ISO Dhcr7 (Mus musculus) 6480464 Simvastatin inhibits the reaction [DHCR7 mutant form results in increased abundance of 7-dehydrocholesterol] CTD PMID:16446309 Dhcr7 Rat simvastatin multiple interactions ISO DHCR7 (Homo sapiens) 6480464 Hydroxychloroquine affects the reaction [Simvastatin affects the expression of DHCR7 mRNA] and Simvastatin promotes the reaction [DHCR7 results in increased chemical synthesis of Cholesterol] CTD PMID:15896653 and PMID:28975700 Dhcr7 Rat simvastatin affects response to substance ISO DHCR7 (Homo sapiens) 6480464 DHCR7 mutant form affects the susceptibility to Simvastatin CTD PMID:19365639 Dhcr7 Rat sodium arsenate multiple interactions ISO Dhcr7 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of DHCR7 mRNA CTD PMID:34876320 Dhcr7 Rat sodium arsenite increases expression ISO DHCR7 (Homo sapiens) 6480464 sodium arsenite results in increased expression of DHCR7 mRNA CTD PMID:25524072 Dhcr7 Rat sodium arsenite multiple interactions ISO Dhcr7 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of DHCR7 mRNA CTD PMID:34876320 Dhcr7 Rat sodium arsenite multiple interactions ISO DHCR7 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of DHCR7 mRNA CTD PMID:39836092 Dhcr7 Rat sodium arsenite decreases expression ISO DHCR7 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of DHCR7 mRNA CTD PMID:38568856 Dhcr7 Rat sodium dichromate decreases expression ISO Dhcr7 (Mus musculus) 6480464 sodium bichromate results in decreased expression of DHCR7 mRNA CTD PMID:31558096 Dhcr7 Rat sodium dodecyl sulfate decreases expression EXP 6480464 Sodium Dodecyl Sulfate results in decreased expression of DHCR7 mRNA CTD PMID:12815608 Dhcr7 Rat sulindac sulfide decreases expression ISO DHCR7 (Homo sapiens) 6480464 sulindac sulfide results in decreased expression of DHCR7 mRNA CTD PMID:16184548 Dhcr7 Rat sunitinib increases expression ISO DHCR7 (Homo sapiens) 6480464 Sunitinib results in increased expression of DHCR7 mRNA CTD PMID:31533062 Dhcr7 Rat temozolomide decreases expression ISO DHCR7 (Homo sapiens) 6480464 Temozolomide results in decreased expression of DHCR7 mRNA CTD PMID:31758290 Dhcr7 Rat tetrachloromethane decreases expression ISO Dhcr7 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of DHCR7 mRNA CTD PMID:27339419 and PMID:31919559 Dhcr7 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of DHCR7 mRNA CTD PMID:31150632 Dhcr7 Rat tetrachloromethane increases expression ISO Dhcr7 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of DHCR7 mRNA CTD PMID:24381012 Dhcr7 Rat thapsigargin decreases expression ISO DHCR7 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of DHCR7 mRNA CTD PMID:22378314 Dhcr7 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of DHCR7 protein CTD PMID:35544339 Dhcr7 Rat Theaflavin 3,3'-digallate multiple interactions ISO Dhcr7 (Mus musculus) 6480464 theaflavin-3 and 3'-digallate inhibits the reaction [LEP gene mutant form affects the expression of DHCR7 mRNA] CTD PMID:36105184 Dhcr7 Rat thimerosal decreases expression ISO DHCR7 (Homo sapiens) 6480464 Thimerosal results in decreased expression of DHCR7 mRNA CTD PMID:27188386 Dhcr7 Rat thiram decreases expression ISO DHCR7 (Homo sapiens) 6480464 Thiram results in decreased expression of DHCR7 mRNA CTD PMID:38568856 Dhcr7 Rat titanium dioxide increases expression ISO Dhcr7 (Mus musculus) 6480464 titanium dioxide results in increased expression of DHCR7 mRNA CTD PMID:23131501 and PMID:23557971 Dhcr7 Rat titanium dioxide decreases methylation ISO Dhcr7 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of DHCR7 gene CTD PMID:35295148 Dhcr7 Rat tolcapone affects binding EXP 6480464 tolcapone binds to DHCR7 protein CTD PMID:19783845 Dhcr7 Rat triacsin C decreases expression ISO DHCR7 (Homo sapiens) 6480464 triacsin C results in decreased expression of DHCR7 mRNA CTD PMID:16704987 Dhcr7 Rat triadimefon increases expression ISO Dhcr7 (Mus musculus) 6480464 triadimefon results in increased expression of DHCR7 mRNA CTD PMID:17178688 Dhcr7 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of DHCR7 mRNA CTD PMID:33387578 Dhcr7 Rat trimellitic anhydride increases expression ISO Dhcr7 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of DHCR7 mRNA CTD PMID:19042947 Dhcr7 Rat Triptolide decreases expression ISO Dhcr7 (Mus musculus) 6480464 triptolide results in decreased expression of DHCR7 mRNA CTD PMID:32835833 Dhcr7 Rat tunicamycin decreases expression ISO DHCR7 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of DHCR7 mRNA CTD PMID:22378314 Dhcr7 Rat valproic acid affects expression ISO Dhcr7 (Mus musculus) 6480464 Valproic Acid affects the expression of DHCR7 mRNA CTD PMID:17292431 Dhcr7 Rat valproic acid decreases expression ISO DHCR7 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of DHCR7 mRNA CTD PMID:23179753 and PMID:27188386 Dhcr7 Rat valproic acid affects expression ISO DHCR7 (Homo sapiens) 6480464 Valproic Acid affects the expression of DHCR7 mRNA CTD PMID:25979313 Dhcr7 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of DHCR7 mRNA CTD PMID:22570695 Dhcr7 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of DHCR7 mRNA CTD PMID:23034163 and PMID:33983380 Dhcr7 Rat vitamin E affects expression EXP 6480464 Vitamin E affects the expression of DHCR7 mRNA CTD PMID:15370891 Dhcr7 Rat vorinostat decreases expression ISO DHCR7 (Homo sapiens) 6480464 vorinostat results in decreased expression of DHCR7 mRNA CTD PMID:27188386 Dhcr7 Rat Yessotoxin increases expression ISO DHCR7 (Homo sapiens) 6480464 yessotoxin analog results in increased expression of DHCR7 mRNA CTD PMID:30679557 Dhcr7 Rat zinc acetate decreases expression ISO DHCR7 (Homo sapiens) 6480464 Zinc Acetate results in decreased expression of DHCR7 mRNA CTD PMID:16357179 Dhcr7 Rat zinc oxide multiple interactions ISO Dhcr7 (Mus musculus) 6480464 Zinc Oxide affects the splicing of and results in increased expression of DHCR7 mRNA CTD PMID:30500950 Dhcr7 Rat zoledronic acid increases expression ISO DHCR7 (Homo sapiens) 6480464 zoledronic acid results in increased expression of DHCR7 mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
(+)-catechin (ISO) (-)-epigallocatechin 3-gallate (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP,ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-amino-2-deoxy-D-glucopyranose (ISO) 2-butoxyethanol (ISO) 2-ethoxyethanol (EXP) 2-methoxyethanol (EXP) 22-Hydroxycholesterol (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3H-1,2-dithiole-3-thione (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) 8-Br-cAMP (ISO) Acetyl tributyl citrate (ISO) acrylamide (ISO) aflatoxin B1 (ISO) aldehydo-D-glucosamine (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amiodarone (EXP) ammonium chloride (EXP) amphetamine (EXP) androgen antagonist (EXP) arachidonic acid (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) avobenzone (ISO) Azaspiracid (ISO) benzalkonium chloride (ISO) benzene (EXP) benzo[a]pyrene (ISO) beta-D-glucosamine (ISO) beta-lapachone (ISO) beta-naphthoflavone (ISO) bexarotene (EXP) bezafibrate (EXP) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bromobenzene (EXP) Butylbenzyl phthalate (EXP) cadmium dichloride (EXP,ISO) caffeine (EXP) calcitriol (ISO) carbon nanotube (ISO) cariprazine (ISO) cerium trichloride (ISO) chlorpyrifos (ISO) cholesta-5,7-dien-3beta-ol (ISO) cholesterol (ISO) choline (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) clobetasol (ISO) clofibrate (EXP,ISO) clozapine (ISO) cobalt dichloride (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) coumestrol (ISO) Cuprizon (EXP) curcumin (EXP,ISO) cyclosporin A (ISO) DDE (EXP,ISO) Di-n-hexyl phthalate (EXP) dibutyl phthalate (EXP,ISO) Dicyclohexyl phthalate (EXP) diethyl phthalate (EXP) diethylstilbestrol (EXP) difenoconazole (EXP) diheptyl phthalate (EXP) diisobutyl phthalate (EXP) diisononyl phthalate (EXP) dimethylarsinic acid (ISO) dipentyl phthalate (EXP) diquat (ISO) elemental selenium (ISO) endosulfan (EXP) epoxiconazole (ISO) ethanol (EXP,ISO) ethyl methanesulfonate (ISO) Febrifugine (ISO) fenarimol (EXP) fenthion (ISO) fluoranthene (ISO) fluoxetine (ISO) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) galaxolide (EXP) Ganoderic acid A (ISO) gentamycin (EXP) hydrogen peroxide (ISO) hydroxychloroquine (ISO) isotretinoin (ISO) ivermectin (ISO) ketoconazole (EXP,ISO) L-methionine (ISO) leflunomide (EXP,ISO) linalool (ISO) methidathion (ISO) methyl methanesulfonate (ISO) methylarsonic acid (ISO) miconazole (ISO) mono(2-ethylhexyl) phthalate (EXP,ISO) motexafin gadolinium (ISO) N-methyl-4-phenylpyridinium (EXP,ISO) N-nitrosodiethylamine (ISO) N-nitrosodimethylamine (ISO) naphthalenes (EXP) nickel atom (ISO) nitroglycerin (EXP) obeticholic acid (ISO) ochratoxin A (ISO) ozone (EXP,ISO) paclitaxel (ISO) paracetamol (EXP,ISO) paraquat (EXP) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (EXP,ISO) phenethyl isothiocyanate (ISO) phenobarbital (EXP,ISO) phenylephrine (EXP) phenylpropanolamine (ISO) picrotoxin (EXP) pirinixic acid (ISO) potassium dichromate (ISO) progesterone (ISO) propiconazole (EXP,ISO) quercetin (ISO) quercetin 3-O-beta-D-glucofuranoside (ISO) quercetin 3-O-beta-D-glucopyranoside (ISO) resveratrol (ISO) ritonavir (EXP) rotenone (ISO) selenium atom (ISO) simvastatin (EXP,ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium dichromate (ISO) sodium dodecyl sulfate (EXP) sulindac sulfide (ISO) sunitinib (ISO) temozolomide (ISO) tetrachloromethane (EXP,ISO) thapsigargin (EXP,ISO) Theaflavin 3,3'-digallate (ISO) thimerosal (ISO) thiram (ISO) titanium dioxide (ISO) tolcapone (EXP) triacsin C (ISO) triadimefon (ISO) trichloroethene (EXP) trimellitic anhydride (ISO) Triptolide (ISO) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (EXP) vorinostat (ISO) Yessotoxin (ISO) zinc acetate (ISO) zinc oxide (ISO) zoledronic acid (ISO)
1.
Cholesterol biosynthesis from lanosterol. Molecular cloning, tissue distribution, expression, chromosomal localization, and regulation of rat 7-dehydrocholesterol reductase, a Smith-Lemli-Opitz syndrome-related protein.
Bae SH, etal., J Biol Chem 1999 May 21;274(21):14624-31.
2.
Polymorphisms in genetics of vitamin D metabolism confer susceptibility to ocular Behçet disease in a Chinese Han population.
Fang J, etal., Am J Ophthalmol. 2014 Feb;157(2):488-494.e6. doi: 10.1016/j.ajo.2013.10.010. Epub 2013 Nov 1.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Disorders of cholesterol biosynthesis: prototypic metabolic malformation syndromes.
Herman GE Hum Mol Genet. 2003 Apr 1;12 Spec No 1:R75-88.
6.
The human lamin B receptor/sterol reductase multigene family.
Holmer L, etal., Genomics 1998 Dec 15;54(3):469-76.
7.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
8.
Association of circulating 25-hydroxyvitamin D levels with hypertension and blood pressure values in Korean adults: A Mendelian randomization study on a subset of the Korea National Health and Nutrition Survey 2011-2012 population.
Kwak SY, etal., Nutr Res Pract. 2019 Dec;13(6):498-508. doi: 10.4162/nrp.2019.13.6.498. Epub 2019 Aug 13.
9.
Structure and alternative splicing of the rat 7-dehydrocholesterol reductase gene.
Lee JN, etal., Biochim Biophys Acta 2002 Jun 7;1576(1-2):148-56.
10.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
11.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.
Evidence for requirement of NADPH-cytochrome P450 oxidoreductase in the microsomal NADPH-sterol Delta7-reductase system.
Nishino H and Ishibashi T, Arch Biochem Biophys. 2000 Feb 15;374(2):293-8.
13.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
14.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
15.
GOA pipeline
RGD automated data pipeline
16.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
17.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
18.
Regulation of rat hepatic 3beta-hydroxysterol delta7-reductase: substrate specificity, competitive and non-competitive inhibition, and phosphorylation/dephosphorylation.
Shefer S, etal., J Lipid Res. 1998 Dec;39(12):2471-6.
19.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
20.
Biochemical, phenotypic and neurophysiological characterization of a genetic mouse model of RSH/Smith--Lemli--Opitz syndrome.
Wassif CA, etal., Hum Mol Genet 2001 Mar 15;10(6):555-64.
21.
Defects of cholesterol biosynthesis.
Waterham HR FEBS Lett. 2006 Oct 9;580(23):5442-9. Epub 2006 Jul 20.
22.
Smith-Lemli-Opitz syndrome is caused by mutations in the 7-dehydrocholesterol reductase gene.
Waterham HR, etal., Am J Hum Genet. 1998 Aug;63(2):329-38.
Dhcr7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 208,444,434 - 208,460,408 (+) NCBI GRCr8 mRatBN7.2 1 199,015,081 - 199,031,055 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 199,015,081 - 199,031,055 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 207,394,648 - 207,410,602 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 214,476,501 - 214,492,466 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 207,150,670 - 207,166,635 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 217,018,916 - 217,034,890 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 217,018,916 - 217,034,904 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 223,874,935 - 223,890,913 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 204,245,562 - 204,258,913 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 204,399,014 - 204,412,366 (+) NCBI Celera 1 196,577,886 - 196,593,821 (+) NCBI Celera Cytogenetic Map 1 q42 NCBI
DHCR7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 71,427,287 - 71,449,043 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 71,428,193 - 71,452,868 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 71,138,333 - 71,160,089 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 70,823,105 - 70,837,125 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 70,823,110 - 70,837,047 NCBI Celera 11 68,438,984 - 68,453,003 (-) NCBI Celera Cytogenetic Map 11 q13.4 NCBI HuRef 11 67,439,049 - 67,453,070 (-) NCBI HuRef CHM1_1 11 71,029,428 - 71,043,448 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 71,354,234 - 71,375,999 (-) NCBI T2T-CHM13v2.0
Dhcr7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 143,376,827 - 143,402,147 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 143,376,882 - 143,402,147 (+) Ensembl GRCm39 Ensembl GRCm38 7 143,823,167 - 143,848,410 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 143,823,145 - 143,848,410 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 151,009,072 - 151,034,315 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 143,632,557 - 143,657,800 (+) NCBI MGSCv36 mm8 Celera 7 143,579,742 - 143,604,212 (+) NCBI Celera Cytogenetic Map 7 F5 NCBI cM Map 7 88.33 NCBI
Dhcr7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955422 15,119,173 - 15,136,771 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955422 15,119,155 - 15,136,771 (+) NCBI ChiLan1.0 ChiLan1.0
DHCR7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 72,320,577 - 72,334,547 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 73,363,320 - 73,376,738 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 66,450,230 - 66,464,214 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 69,721,741 - 69,735,715 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 69,721,741 - 69,735,715 (-) Ensembl panpan1.1 panPan2
DHCR7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 47,257,750 - 47,277,436 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 47,261,730 - 47,274,236 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 45,862,457 - 45,882,527 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 47,935,184 - 47,955,313 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 47,938,180 - 47,955,305 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 47,376,200 - 47,396,229 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 46,962,021 - 46,982,089 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 47,708,851 - 47,728,938 (+) NCBI UU_Cfam_GSD_1.0
LOC101971285
DHCR7 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 2,377,416 - 2,391,447 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 2,377,352 - 2,391,846 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 851,404 - 864,968 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DHCR7 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 3,243,263 - 3,257,332 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 3,243,313 - 3,257,487 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 100,430,412 - 100,444,448 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dhcr7
.
Predicted Target Of
Count of predictions: 118 Count of miRNA genes: 89 Interacting mature miRNAs: 106 Transcripts: ENSRNOT00000028195 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1359018 Hrtrt20 Heart rate QTL 20 3.08 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 185356336 202902618 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 631260 Tcas2 Tongue tumor susceptibility QTL 2 4.93 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 192485903 199050587 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 1331790 Bp201 Blood pressure QTL 201 3.127 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 198211513 225126682 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 6480783 Insul19 Insulin level QTL 19 4.33 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 197489281 200611765 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 6480780 Insul18 Insulin level QTL 18 4.11 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 189607473 200611765 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat
RH128054
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 199,030,690 - 199,030,900 (+) MAPPER mRatBN7.2 Rnor_6.0 1 217,034,526 - 217,034,735 NCBI Rnor6.0 Rnor_5.0 1 223,890,549 - 223,890,758 UniSTS Rnor5.0 RGSC_v3.4 1 204,258,549 - 204,258,758 UniSTS RGSC3.4 Celera 1 196,593,457 - 196,593,666 UniSTS Cytogenetic Map 1 q41 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000028195 ⟹ ENSRNOP00000028194
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 199,015,081 - 199,031,055 (+) Ensembl Rnor_6.0 Ensembl 1 217,018,916 - 217,034,890 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000078979 ⟹ ENSRNOP00000071939
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 199,017,279 - 199,031,055 (+) Ensembl Rnor_6.0 Ensembl 1 217,019,051 - 217,034,904 (+) Ensembl
RefSeq Acc Id:
NM_022389 ⟹ NP_071784
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 208,444,434 - 208,460,408 (+) NCBI mRatBN7.2 1 199,015,081 - 199,031,055 (+) NCBI Rnor_6.0 1 217,018,916 - 217,034,890 (+) NCBI Rnor_5.0 1 223,874,935 - 223,890,913 (+) NCBI RGSC_v3.4 1 204,245,562 - 204,258,913 (+) RGD Celera 1 196,577,886 - 196,593,821 (+) RGD
Sequence:
GCCGCCGCCGACTGGCGGGCCCGGTGGGCTCCGAGTCAGCTCACTGCCTTCACCAATCACAGGGCGCGGCTCACGAAATCCACTTCGGATTGGTAGTCTGTGACCTCACGTCACCTGGGGGCGGTGCT
hide sequence
RefSeq Acc Id:
XM_006230893 ⟹ XP_006230955
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 208,444,546 - 208,460,408 (+) NCBI mRatBN7.2 1 199,015,133 - 199,031,055 (+) NCBI Rnor_6.0 1 217,019,017 - 217,034,890 (+) NCBI Rnor_5.0 1 223,874,935 - 223,890,913 (+) NCBI
Sequence:
GACCTCACGTCACCTGGGGGCGGTGCTTCAGGCAGACACTTAGGGCGCTGCTGGAGCTCGTGAA
hide sequence
RefSeq Acc Id:
XM_006230894 ⟹ XP_006230956
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 208,444,566 - 208,460,408 (+) NCBI mRatBN7.2 1 199,015,234 - 199,031,055 (+) NCBI Rnor_6.0 1 217,019,041 - 217,034,890 (+) NCBI Rnor_5.0 1 223,874,935 - 223,890,913 (+) NCBI
Sequence:
GCTTCAGGCAGACACTTAGGGCGCTGCTGGAGCTCGTGAATCAACCGCCCGGATCCCGCACGCA
hide sequence
RefSeq Acc Id:
XM_039089500 ⟹ XP_038945428
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 208,444,564 - 208,460,408 (+) NCBI mRatBN7.2 1 199,015,188 - 199,031,055 (+) NCBI
RefSeq Acc Id:
XM_063272737 ⟹ XP_063128807
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 208,444,505 - 208,460,408 (+) NCBI
RefSeq Acc Id:
XM_063272738 ⟹ XP_063128808
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 208,444,953 - 208,460,408 (+) NCBI
RefSeq Acc Id:
XM_063272739 ⟹ XP_063128809
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 208,444,951 - 208,460,408 (+) NCBI
RefSeq Acc Id:
NP_071784 ⟸ NM_022389
- UniProtKB:
Q9Z2Z8 (UniProtKB/Swiss-Prot), A6HYE0 (UniProtKB/TrEMBL), A0A8L2R4U0 (UniProtKB/TrEMBL)
- Sequence:
MASKSQHNASKAKNHNVKAESQGQWGRAWEVDWFSLVSVIFLLLFAPFIVYYFIMACDQYSCSLTAPILDVATGRASLADIWAKTPPVTAKAAQLYALWVSFQVLLYSWLPDFCHRFLPGYVGGVQEG
hide sequence
RefSeq Acc Id:
XP_006230955 ⟸ XM_006230893
- Peptide Label:
isoform X1
- UniProtKB:
Q9Z2Z8 (UniProtKB/Swiss-Prot), A6HYE0 (UniProtKB/TrEMBL), A0A8L2R4U0 (UniProtKB/TrEMBL)
- Sequence:
MASKSQHNASKAKNHNVKAESQGQWGRAWEVDWFSLVSVIFLLLFAPFIVYYFIMACDQYSCSLTAPILDVATGRASLADIWAKTPPVTAKAAQLYALWVSFQVLLYSWLPDFCHRFLPGYVGGVQEG
hide sequence
RefSeq Acc Id:
XP_006230956 ⟸ XM_006230894
- Peptide Label:
isoform X1
- UniProtKB:
Q9Z2Z8 (UniProtKB/Swiss-Prot), A6HYE0 (UniProtKB/TrEMBL), A0A8L2R4U0 (UniProtKB/TrEMBL)
- Sequence:
MASKSQHNASKAKNHNVKAESQGQWGRAWEVDWFSLVSVIFLLLFAPFIVYYFIMACDQYSCSLTAPILDVATGRASLADIWAKTPPVTAKAAQLYALWVSFQVLLYSWLPDFCHRFLPGYVGGVQEG
hide sequence
Ensembl Acc Id:
ENSRNOP00000028194 ⟸ ENSRNOT00000028195
Ensembl Acc Id:
ENSRNOP00000071939 ⟸ ENSRNOT00000078979
RefSeq Acc Id:
XP_038945428 ⟸ XM_039089500
- Peptide Label:
isoform X1
- UniProtKB:
Q9Z2Z8 (UniProtKB/Swiss-Prot), A6HYE0 (UniProtKB/TrEMBL), A0A8L2R4U0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128807 ⟸ XM_063272737
- Peptide Label:
isoform X1
- UniProtKB:
Q9Z2Z8 (UniProtKB/Swiss-Prot), A6HYE0 (UniProtKB/TrEMBL), A0A8L2R4U0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128809 ⟸ XM_063272739
- Peptide Label:
isoform X1
- UniProtKB:
Q9Z2Z8 (UniProtKB/Swiss-Prot), A6HYE0 (UniProtKB/TrEMBL), A0A8L2R4U0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128808 ⟸ XM_063272738
- Peptide Label:
isoform X1
- UniProtKB:
Q9Z2Z8 (UniProtKB/Swiss-Prot), A6HYE0 (UniProtKB/TrEMBL), A0A8L2R4U0 (UniProtKB/TrEMBL)
RGD ID: 13690582 Promoter ID: EPDNEW_R1105 Type: initiation region Name: Dhcr7_1 Description: 7-dehydrocholesterol reductase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 217,019,083 - 217,019,143 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Dhcr7
7-dehydrocholesterol reductase
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Dhcr7
7-dehydrocholesterol reductase
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_disease
human homolog involved in Smith-Lemli-Opitz syndrome
632010
gene_expression
expressed in liver, kidney and brain
632010
gene_protein
471 amino acid; 54 kDa
632010
