Symbol:
Smarca4
Name:
SWI/SNF related BAF chromatin remodeling complex subunit ATPase 4 (Ensembl:SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4)
RGD ID:
621728
Description:
Enables chromatin binding activity. Involved in negative regulation of DNA-templated transcription; nucleosome disassembly; and spermatid development. Part of SWI/SNF complex. Used to study cocaine dependence. Human ortholog(s) of this gene implicated in Coffin-Siris syndrome 4; hepatocellular carcinoma; lung non-small cell carcinoma; and rhabdoid tumor predisposition syndrome 2. Orthologous to human SMARCA4 (SWI/SNF related BAF chromatin remodeling complex subunit ATPase 4); PARTICIPATES IN altered SWI/SNF family mediated chromatin remodeling pathway; cortisol signaling pathway; histone modification pathway; INTERACTS WITH 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ATP-dependent helicase SMARCA4; BAF190A; brg-1; BRG1-associated factor 190A; protein brahma homolog 1; SNF2-beta; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4; transcription activator BRG1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SMARCA4 (SWI/SNF related BAF chromatin remodeling complex subunit ATPase 4) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Smarca4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Smarca4 (SWI/SNF related BAF chromatin remodeling complex subunit ATPase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SMARCA4 (SWI/SNF related BAF chromatin remodeling complex subunit ATPase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Smarca4 (SWI/SNF related BAF chromatin remodeling complex subunit ATPase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SMARCA4 (SWI/SNF related BAF chromatin remodeling complex subunit ATPase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Smarca4 (SWI/SNF related BAF chromatin remodeling complex subunit ATPase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SMARCA2 (SWI/SNF related BAF chromatin remodeling complex subunit ATPase 2) HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
SMARCA4 (SWI/SNF related BAF chromatin remodeling complex subunit ATPase 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Smarca4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
smarca4a (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pqn-15
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
SNF2
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
brm
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
swsn-4
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
STH1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
smarca4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 28,438,370 - 28,535,071 (+) NCBI GRCr8 mRatBN7.2 8 20,167,717 - 20,258,975 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 20,167,717 - 20,258,975 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 24,200,412 - 24,292,032 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 22,495,960 - 22,587,578 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 20,397,343 - 20,488,586 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 22,648,323 - 22,739,468 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 22,648,323 - 22,739,468 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 22,702,277 - 22,793,519 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 20,720,915 - 20,812,157 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 20,787,909 - 20,796,297 (+) NCBI Celera 8 21,558,796 - 21,650,002 (+) NCBI Celera Cytogenetic Map 8 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Smarca4 Rat 1,2-dichloroethane increases expression ISO Smarca4 (Mus musculus) 6480464 ethylene dichloride results in increased expression of SMARCA4 mRNA CTD PMID:28960355 Smarca4 Rat 1,2-dimethylhydrazine increases expression ISO Smarca4 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of SMARCA4 mRNA CTD PMID:22206623 Smarca4 Rat 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine decreases expression EXP 6480464 chlorcyclizine results in decreased expression of SMARCA4 mRNA CTD PMID:21058326 Smarca4 Rat 17alpha-ethynylestradiol multiple interactions ISO Smarca4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SMARCA4 mRNA CTD PMID:17942748 Smarca4 Rat 17alpha-ethynylestradiol increases expression ISO Smarca4 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of SMARCA4 mRNA CTD PMID:17942748 Smarca4 Rat 17beta-estradiol decreases expression ISO SMARCA4 (Homo sapiens) 6480464 Estradiol results in decreased expression of SMARCA4 mRNA CTD PMID:16705744 and PMID:19167446 Smarca4 Rat 17beta-hydroxy-5alpha-androstan-3-one multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [Dihydrotestosterone co-treated with bicalutamide] promotes the reaction [AR protein binds to SMARCA4 protein] CTD PMID:18487222 Smarca4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 SMARCA4 protein affects the reaction [Tetrachlorodibenzodioxin results in increased expression of CYP1A1 mRNA] more ... CTD PMID:18842620 Smarca4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SMARCA4 mRNA CTD PMID:33387578 Smarca4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Smarca4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SMARCA4 mRNA CTD PMID:21570461 Smarca4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SMARCA4 mRNA CTD PMID:18796159 Smarca4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Smarca4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SMARCA4 mRNA CTD PMID:17942748 Smarca4 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Smarca4 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of SMARCA4 mRNA CTD PMID:20188158 Smarca4 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of SMARCA4 protein CTD PMID:34915118 Smarca4 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of SMARCA4 mRNA CTD PMID:31881176 Smarca4 Rat acrolein multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of SMARCA4 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of SMARCA4 mRNA CTD PMID:32699268 Smarca4 Rat aflatoxin B1 increases expression ISO Smarca4 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of SMARCA4 mRNA CTD PMID:19770486 Smarca4 Rat aflatoxin B1 increases methylation ISO SMARCA4 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of SMARCA4 intron CTD PMID:30157460 Smarca4 Rat aldehydo-D-glucose multiple interactions ISO Smarca4 (Mus musculus) 6480464 [MIR144 mRNA results in decreased expression of SMARCA4 protein] affects the susceptibility to [Oxygen deficiency co-treated with Glucose deficiency] more ... CTD PMID:29457851 Smarca4 Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of SMARCA4 mRNA CTD PMID:24977338 Smarca4 Rat all-trans-retinoic acid decreases expression ISO SMARCA4 (Homo sapiens) 6480464 Tretinoin results in decreased expression of SMARCA4 mRNA CTD PMID:33167477 Smarca4 Rat alpha-pinene multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of SMARCA4 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of SMARCA4 mRNA CTD PMID:32699268 Smarca4 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SMARCA4 mRNA CTD PMID:16483693 Smarca4 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of SMARCA4 mRNA CTD PMID:30779732 Smarca4 Rat antirheumatic drug decreases expression ISO SMARCA4 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of SMARCA4 mRNA CTD PMID:24449571 Smarca4 Rat Aroclor 1254 decreases expression ISO Smarca4 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of SMARCA4 mRNA CTD PMID:23650126 Smarca4 Rat arsane affects methylation ISO SMARCA4 (Homo sapiens) 6480464 Arsenic affects the methylation of SMARCA4 gene CTD PMID:25304211 Smarca4 Rat arsane multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SMARCA4 mRNA CTD PMID:39836092 Smarca4 Rat arsenic atom affects methylation ISO SMARCA4 (Homo sapiens) 6480464 Arsenic affects the methylation of SMARCA4 gene CTD PMID:25304211 Smarca4 Rat arsenic atom multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SMARCA4 mRNA CTD PMID:39836092 Smarca4 Rat arsenous acid increases expression ISO SMARCA4 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of SMARCA4 mRNA CTD PMID:20458559 Smarca4 Rat atrazine decreases expression ISO SMARCA4 (Homo sapiens) 6480464 Atrazine results in decreased expression of SMARCA4 mRNA CTD PMID:22378314 Smarca4 Rat benzo[a]pyrene increases expression ISO Smarca4 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SMARCA4 mRNA CTD PMID:22228805 Smarca4 Rat benzo[a]pyrene affects methylation ISO SMARCA4 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SMARCA4 intron CTD PMID:30157460 Smarca4 Rat benzo[e]pyrene increases methylation ISO SMARCA4 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of SMARCA4 intron CTD PMID:30157460 Smarca4 Rat Benzo[ghi]perylene increases expression ISO SMARCA4 (Homo sapiens) 6480464 1 and 12-benzoperylene results in increased expression of SMARCA4 mRNA CTD PMID:35182551 Smarca4 Rat beta-lapachone decreases expression ISO SMARCA4 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of SMARCA4 mRNA CTD PMID:38218311 Smarca4 Rat bicalutamide multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [Dihydrotestosterone co-treated with bicalutamide] promotes the reaction [AR protein binds to SMARCA4 protein] more ... CTD PMID:18487222 Smarca4 Rat bis(2-ethylhexyl) phthalate increases expression ISO Smarca4 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of SMARCA4 mRNA CTD PMID:34319233 Smarca4 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SMARCA4 mRNA CTD PMID:25181051 Smarca4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SMARCA4 mRNA CTD PMID:30816183 and PMID:33296240 Smarca4 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of SMARCA4 mRNA CTD PMID:19167457 Smarca4 Rat caffeine affects phosphorylation ISO SMARCA4 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of SMARCA4 protein CTD PMID:35688186 Smarca4 Rat carbon nanotube increases expression ISO Smarca4 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Smarca4 Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of SMARCA4 mRNA CTD PMID:23125180 Smarca4 Rat choline multiple interactions ISO Smarca4 (Mus musculus) 6480464 SMARCA4 gene mutant form results in decreased susceptibility to [Methionine deficiency co-treated with Choline deficiency] CTD PMID:29963902 Smarca4 Rat cisplatin multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of SMARCA4 mRNA CTD PMID:27392435 Smarca4 Rat cisplatin decreases expression ISO SMARCA4 (Homo sapiens) 6480464 Cisplatin results in decreased expression of SMARCA4 mRNA CTD PMID:27392435 and PMID:27594783 Smarca4 Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of SMARCA4 mRNA CTD PMID:17602206 Smarca4 Rat cobalt dichloride decreases expression ISO SMARCA4 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of SMARCA4 mRNA CTD PMID:19320972 Smarca4 Rat cobalt dichloride multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 cobaltous chloride promotes the reaction [[SMARCA4 protein binds to SMARCA2 protein] which binds to COL7A1 gene] more ... CTD PMID:30381462 Smarca4 Rat cocaine multiple interactions EXP 6480464 [Cocaine co-treated with Cocaine deficiency] promotes the reaction [RUNX2 protein binds to SMARCA4 promoter] more ... CTD PMID:27422367 and PMID:30158054 Smarca4 Rat cocaine increases expression EXP 6480464 Cocaine deficiency results in increased expression of SMARCA4 protein CTD PMID:27422367 Smarca4 Rat copper atom multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of SMARCA4 mRNA CTD PMID:31162603 Smarca4 Rat copper(0) multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of SMARCA4 mRNA CTD PMID:31162603 Smarca4 Rat copper(II) chloride increases expression ISO SMARCA4 (Homo sapiens) 6480464 cupric chloride results in increased expression of SMARCA4 mRNA CTD PMID:38568856 Smarca4 Rat coumarin affects phosphorylation ISO SMARCA4 (Homo sapiens) 6480464 coumarin affects the phosphorylation of SMARCA4 protein CTD PMID:35688186 Smarca4 Rat crocidolite asbestos decreases expression ISO SMARCA4 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of SMARCA4 mRNA CTD PMID:29523930 Smarca4 Rat cyclosporin A decreases expression ISO SMARCA4 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of SMARCA4 mRNA CTD PMID:22147139 Smarca4 Rat cyclosporin A increases expression ISO SMARCA4 (Homo sapiens) 6480464 Cyclosporine results in increased expression of SMARCA4 mRNA CTD PMID:25562108 Smarca4 Rat cyproconazole decreases expression ISO Smarca4 (Mus musculus) 6480464 cyproconazole results in decreased expression of SMARCA4 mRNA CTD PMID:22334560 Smarca4 Rat D-glucose multiple interactions ISO Smarca4 (Mus musculus) 6480464 [MIR144 mRNA results in decreased expression of SMARCA4 protein] affects the susceptibility to [Oxygen deficiency co-treated with Glucose deficiency] more ... CTD PMID:29457851 Smarca4 Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of SMARCA4 mRNA CTD PMID:23640034 Smarca4 Rat diarsenic trioxide increases expression ISO SMARCA4 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of SMARCA4 mRNA CTD PMID:20458559 Smarca4 Rat Dibutyl phosphate affects expression ISO SMARCA4 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SMARCA4 mRNA CTD PMID:37042841 Smarca4 Rat dibutyl phthalate decreases expression ISO Smarca4 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of SMARCA4 mRNA CTD PMID:17361019 and PMID:21266533 Smarca4 Rat dicrotophos increases expression ISO SMARCA4 (Homo sapiens) 6480464 dicrotophos results in increased expression of SMARCA4 mRNA CTD PMID:28302478 Smarca4 Rat dioxygen multiple interactions ISO Smarca4 (Mus musculus) 6480464 [MIR144 mRNA results in decreased expression of SMARCA4 protein] affects the susceptibility to [Oxygen deficiency co-treated with Glucose deficiency] more ... CTD PMID:29457851 Smarca4 Rat dioxygen multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 SMARCA4 protein promotes the reaction [Oxygen deficiency results in increased expression of COL7A1 mRNA] and SMARCA4 protein promotes the reaction [Oxygen deficiency results in increased expression of LAMC2 mRNA] CTD PMID:30381462 Smarca4 Rat dorsomorphin multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SMARCA4 mRNA CTD PMID:27188386 Smarca4 Rat elemental selenium increases expression ISO SMARCA4 (Homo sapiens) 6480464 Selenium results in increased expression of SMARCA4 mRNA CTD PMID:19244175 Smarca4 Rat epoxiconazole decreases expression ISO Smarca4 (Mus musculus) 6480464 epoxiconazole results in decreased expression of SMARCA4 mRNA CTD PMID:22334560 Smarca4 Rat ethanol multiple interactions ISO Smarca4 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of SMARCA4 mRNA CTD PMID:30319688 Smarca4 Rat ethyl methanesulfonate decreases expression ISO SMARCA4 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of SMARCA4 mRNA CTD PMID:23649840 Smarca4 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of SMARCA4 mRNA CTD PMID:30307764 Smarca4 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of SMARCA4 mRNA CTD PMID:24136188 Smarca4 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of SMARCA4 mRNA CTD PMID:20566332 and PMID:24136188 Smarca4 Rat FR900359 affects phosphorylation ISO SMARCA4 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of SMARCA4 protein CTD PMID:37730182 Smarca4 Rat fulvestrant decreases expression ISO SMARCA4 (Homo sapiens) 6480464 fulvestrant results in decreased expression of SMARCA4 protein CTD PMID:24169358 Smarca4 Rat gallic acid decreases expression ISO SMARCA4 (Homo sapiens) 6480464 Gallic Acid results in decreased expression of SMARCA4 mRNA CTD PMID:34408198 Smarca4 Rat genistein increases expression ISO SMARCA4 (Homo sapiens) 6480464 Genistein results in increased expression of SMARCA4 mRNA CTD PMID:16705744 Smarca4 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of SMARCA4 mRNA CTD PMID:22061828 Smarca4 Rat glucose multiple interactions ISO Smarca4 (Mus musculus) 6480464 [MIR144 mRNA results in decreased expression of SMARCA4 protein] affects the susceptibility to [Oxygen deficiency co-treated with Glucose deficiency] more ... CTD PMID:29457851 Smarca4 Rat graphene oxide increases expression ISO SMARCA4 (Homo sapiens) 6480464 graphene oxide results in increased expression of SMARCA4 mRNA CTD PMID:33219560 and PMID:33219585 Smarca4 Rat hexadecanoic acid increases phosphorylation ISO SMARCA4 (Homo sapiens) 6480464 Palmitic Acid results in increased phosphorylation of SMARCA4 protein CTD PMID:28073184 Smarca4 Rat hydrazine increases expression ISO Smarca4 (Mus musculus) 6480464 hydrazine results in increased expression of SMARCA4 mRNA CTD PMID:15282401 Smarca4 Rat ivermectin decreases expression ISO SMARCA4 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SMARCA4 protein CTD PMID:32959892 Smarca4 Rat L-methionine multiple interactions ISO Smarca4 (Mus musculus) 6480464 SMARCA4 gene mutant form results in decreased susceptibility to [Methionine deficiency co-treated with Choline deficiency] CTD PMID:29963902 Smarca4 Rat manganese atom multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of SMARCA4 mRNA CTD PMID:39836092 Smarca4 Rat manganese(0) multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of SMARCA4 mRNA CTD PMID:39836092 Smarca4 Rat manganese(II) chloride multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of SMARCA4 mRNA CTD PMID:39836092 Smarca4 Rat methapyrilene increases methylation ISO SMARCA4 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of SMARCA4 intron CTD PMID:30157460 Smarca4 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of SMARCA4 gene CTD PMID:35440735 Smarca4 Rat methyl methanesulfonate decreases expression ISO SMARCA4 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of SMARCA4 mRNA CTD PMID:23649840 Smarca4 Rat methylmercury chloride affects expression EXP 6480464 methylmercuric chloride affects the expression of SMARCA4 mRNA CTD PMID:20864626 Smarca4 Rat methylmercury chloride multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SMARCA4 mRNA CTD PMID:27188386 Smarca4 Rat methylmercury chloride increases expression ISO SMARCA4 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of SMARCA4 mRNA CTD PMID:23179753 and PMID:26272509 Smarca4 Rat methylseleninic acid decreases expression ISO SMARCA4 (Homo sapiens) 6480464 methylselenic acid results in decreased expression of SMARCA4 mRNA CTD PMID:18548127 Smarca4 Rat motexafin gadolinium decreases expression ISO SMARCA4 (Homo sapiens) 6480464 motexafin gadolinium results in decreased expression of SMARCA4 mRNA CTD PMID:16357179 Smarca4 Rat motexafin gadolinium multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [Zinc Acetate co-treated with motexafin gadolinium] results in decreased expression of SMARCA4 mRNA CTD PMID:16357179 Smarca4 Rat nitrates multiple interactions ISO Smarca4 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of SMARCA4 mRNA CTD PMID:35964746 Smarca4 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of SMARCA4 mRNA CTD PMID:25729387 Smarca4 Rat ozone multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of SMARCA4 mRNA more ... CTD PMID:32699268 Smarca4 Rat paracetamol decreases expression ISO SMARCA4 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of SMARCA4 mRNA CTD PMID:21420995 Smarca4 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of SMARCA4 mRNA CTD PMID:33387578 Smarca4 Rat paraquat multiple interactions ISO Smarca4 (Mus musculus) 6480464 [SIRT6 protein mutant form results in decreased activity of SIRT6 protein] inhibits the reaction [Paraquat promotes the reaction [SMARCA4 protein binds to HMOX1 enhancer]] more ... CTD PMID:31216030 Smarca4 Rat perfluorohexanesulfonic acid decreases expression ISO Smarca4 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of SMARCA4 mRNA CTD PMID:37995155 Smarca4 Rat perfluorooctanoic acid increases expression ISO Smarca4 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of SMARCA4 protein CTD PMID:37422089 Smarca4 Rat perfluorooctanoic acid decreases expression ISO Smarca4 (Mus musculus) 6480464 perfluorooctanoic acid results in decreased expression of SMARCA4 protein CTD PMID:36214631 Smarca4 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of SMARCA4 mRNA CTD PMID:12082028 Smarca4 Rat phenobarbital decreases expression ISO Smarca4 (Mus musculus) 6480464 Phenobarbital results in decreased expression of SMARCA4 mRNA CTD PMID:23091169 Smarca4 Rat poly(propylene imine) macromolecule decreases expression ISO SMARCA4 (Homo sapiens) 6480464 poly(propyleneimine) analog results in decreased expression of SMARCA4 mRNA CTD PMID:16308212 Smarca4 Rat promegestone multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 SMARCA4 protein affects the reaction [Promegestone results in increased expression of FOS mRNA] and SMARCA4 protein affects the reaction [Promegestone results in increased expression of MYC mRNA] CTD PMID:19609353 Smarca4 Rat propiconazole decreases expression ISO Smarca4 (Mus musculus) 6480464 propiconazole results in decreased expression of SMARCA4 mRNA CTD PMID:22334560 Smarca4 Rat quercetin increases phosphorylation ISO SMARCA4 (Homo sapiens) 6480464 Quercetin results in increased phosphorylation of SMARCA4 protein CTD PMID:35688186 Smarca4 Rat resveratrol decreases expression ISO Smarca4 (Mus musculus) 6480464 resveratrol results in decreased expression of SMARCA4 protein CTD PMID:25505154 Smarca4 Rat SB 431542 multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SMARCA4 mRNA CTD PMID:27188386 Smarca4 Rat selenium atom increases expression ISO SMARCA4 (Homo sapiens) 6480464 Selenium results in increased expression of SMARCA4 mRNA CTD PMID:19244175 Smarca4 Rat silicon dioxide increases expression ISO SMARCA4 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of SMARCA4 mRNA CTD PMID:25895662 Smarca4 Rat sodium arsenite multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SMARCA4 mRNA and SMARCA4 protein affects the reaction [sodium arsenite results in increased expression of HSF1 mRNA] CTD PMID:30309986 and PMID:39836092 Smarca4 Rat sodium arsenite increases expression ISO SMARCA4 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SMARCA4 mRNA CTD PMID:34032870 Smarca4 Rat temozolomide increases expression ISO SMARCA4 (Homo sapiens) 6480464 Temozolomide results in increased expression of SMARCA4 mRNA CTD PMID:31758290 Smarca4 Rat tetrachloromethane increases expression ISO Smarca4 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of SMARCA4 mRNA CTD PMID:31919559 Smarca4 Rat thapsigargin increases expression ISO Smarca4 (Mus musculus) 6480464 Thapsigargin results in increased expression of SMARCA4 protein CTD PMID:24648495 Smarca4 Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of SMARCA4 protein CTD PMID:35544339 Smarca4 Rat titanium dioxide increases expression ISO Smarca4 (Mus musculus) 6480464 titanium dioxide results in increased expression of SMARCA4 mRNA CTD PMID:29264374 Smarca4 Rat titanium dioxide decreases methylation ISO Smarca4 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SMARCA4 gene CTD PMID:35295148 Smarca4 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of SMARCA4 mRNA CTD PMID:25729387 Smarca4 Rat topotecan affects response to substance ISO SMARCA4 (Homo sapiens) 6480464 SMARCA4 protein affects the susceptibility to Topotecan CTD PMID:16217747 Smarca4 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of SMARCA4 mRNA CTD PMID:33387578 Smarca4 Rat triphenyl phosphate affects expression ISO SMARCA4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SMARCA4 mRNA CTD PMID:37042841 Smarca4 Rat tungsten decreases expression ISO Smarca4 (Mus musculus) 6480464 Tungsten results in decreased expression of SMARCA4 mRNA CTD PMID:30912803 Smarca4 Rat tunicamycin decreases expression ISO SMARCA4 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of SMARCA4 mRNA CTD PMID:22378314 Smarca4 Rat valproic acid increases methylation ISO SMARCA4 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of SMARCA4 gene CTD PMID:29154799 Smarca4 Rat valproic acid decreases expression ISO SMARCA4 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SMARCA4 mRNA CTD PMID:28001369 and PMID:29154799 Smarca4 Rat valproic acid affects expression ISO SMARCA4 (Homo sapiens) 6480464 Valproic Acid affects the expression of SMARCA4 mRNA CTD PMID:25979313 Smarca4 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of SMARCA4 mRNA CTD PMID:19015723 Smarca4 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of SMARCA4 mRNA CTD PMID:18042343 and PMID:23034163 Smarca4 Rat vorinostat decreases expression ISO SMARCA4 (Homo sapiens) 6480464 vorinostat results in decreased expression of SMARCA4 mRNA CTD PMID:27188386 Smarca4 Rat zinc acetate multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [Zinc Acetate co-treated with motexafin gadolinium] results in decreased expression of SMARCA4 mRNA CTD PMID:16357179 Smarca4 Rat zinc acetate decreases expression ISO SMARCA4 (Homo sapiens) 6480464 Zinc Acetate results in decreased expression of SMARCA4 mRNA CTD PMID:16357179 Smarca4 Rat zinc atom multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of SMARCA4 mRNA CTD PMID:18593933 Smarca4 Rat zinc(0) multiple interactions ISO SMARCA4 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of SMARCA4 mRNA CTD PMID:18593933
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) acetamide (EXP) acrolein (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (EXP,ISO) alpha-pinene (ISO) ammonium chloride (EXP) amphetamine (EXP) antirheumatic drug (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) Benzo[ghi]perylene (ISO) beta-lapachone (ISO) bicalutamide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) C60 fullerene (EXP) caffeine (ISO) carbon nanotube (ISO) chloroprene (EXP) choline (ISO) cisplatin (ISO) clofibric acid (EXP) cobalt dichloride (ISO) cocaine (EXP) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) coumarin (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) cyproconazole (ISO) D-glucose (ISO) decabromodiphenyl ether (EXP) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) dioxygen (ISO) dorsomorphin (ISO) elemental selenium (ISO) epoxiconazole (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) fenvalerate (EXP) finasteride (EXP) flutamide (EXP) FR900359 (ISO) fulvestrant (ISO) gallic acid (ISO) genistein (ISO) gentamycin (EXP) glucose (ISO) graphene oxide (ISO) hexadecanoic acid (ISO) hydrazine (ISO) ivermectin (ISO) L-methionine (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) methoxychlor (EXP) methyl methanesulfonate (ISO) methylmercury chloride (EXP,ISO) methylseleninic acid (ISO) motexafin gadolinium (ISO) nitrates (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) paraquat (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP,ISO) poly(propylene imine) macromolecule (ISO) promegestone (ISO) propiconazole (ISO) quercetin (ISO) resveratrol (ISO) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium arsenite (ISO) temozolomide (ISO) tetrachloromethane (ISO) thapsigargin (EXP,ISO) titanium dioxide (ISO) topotecan (EXP,ISO) trichloroethene (EXP) triphenyl phosphate (ISO) tungsten (ISO) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO) zinc acetate (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
aorta development (ISO) aortic smooth muscle cell differentiation (ISO) blastocyst growth (ISO) blastocyst hatching (ISO) blood vessel development (ISO) cell morphogenesis (ISO) chromatin organization (IEA) chromatin remodeling (IDA,IEA,ISO) coronary vasculature development (ISO) definitive erythrocyte differentiation (ISO) embryonic hindlimb morphogenesis (ISO) embryonic organ morphogenesis (ISO) epidermis morphogenesis (ISO) extracellular matrix organization (ISO) forebrain development (ISO) gene expression (ISO) glial cell fate determination (ISO) heart development (ISO) heart trabecula formation (ISO) hindbrain development (ISO) in utero embryonic development (ISO) keratinocyte differentiation (ISO) lens fiber cell development (ISO) liver development (ISO) negative regulation of androgen receptor signaling pathway (IEA,ISO) negative regulation of apoptotic process (ISO) negative regulation of cell growth (IEA,ISO) negative regulation of DNA-templated transcription (IEA,IMP,ISO) negative regulation of transcription by RNA polymerase II (ISO) nervous system development (IEA,ISO) neural retina development (IEA,ISO) neurogenesis (ISO) nucleosome disassembly (IDA,IEA,ISO) outflow tract morphogenesis (ISO) pharyngeal arch artery morphogenesis (ISO) positive regulation by host of viral transcription (IEA,ISO) positive regulation of cell differentiation (ISO) positive regulation of cell population proliferation (ISO) positive regulation of cold-induced thermogenesis (ISO) positive regulation of DNA-templated transcription (IEA,ISO) positive regulation of glucose mediated signaling pathway (IEA,ISO) positive regulation of miRNA transcription (IEA,ISO) positive regulation of signal transduction by p53 class mediator (ISO) positive regulation of transcription by RNA polymerase II (IBA,IEA,ISO,ISS) positive regulation of transcription of nucleolar large rRNA by RNA polymerase I (IEA,ISO) positive regulation of Wnt signaling pathway (IEA,ISO) primitive erythrocyte differentiation (ISO) regulation of cell migration (ISO) regulation of DNA-templated transcription (IEA) RNA polymerase I preinitiation complex assembly (IEA) spermatid development (IEP) stem cell population maintenance (ISO) transcription by RNA polymerase II (ISO) transcription initiation-coupled chromatin remodeling (ISO) vasculogenesis (ISO) ventricular septum development (ISO)
Cellular Component
chromatin (IBA,IEA,ISO) euchromatin (ISO) fibrillar center (IEA,ISO) male germ cell nucleus (ISO) nBAF complex (ISO,ISS) npBAF complex (IEA,ISO,ISS) nucleolus (IEA,ISO) nucleoplasm (IEA,ISO,TAS) nucleus (IBA,IEA,ISO) perichromatin fibrils (ISO) SWI/SNF complex (IDA,IEA,ISO)
Molecular Function
ATP binding (IEA) ATP hydrolysis activity (ISO) ATP-dependent activity, acting on DNA (IEA,ISO) ATP-dependent chromatin remodeler activity (ISO) chromatin binding (IBA,IDA,ISO) DNA binding (IBA) DNA polymerase binding (IEA,ISO) helicase activity (IEA) histone binding (IEA) hydrolase activity (IEA) lncRNA binding (ISO) nuclear androgen receptor binding (IEA,ISO) nucleosome array spacer activity (IBA) nucleotide binding (IEA) p53 binding (IEA,ISO) protein binding (IPI,ISO) protein-containing complex binding (IDA) RNA binding (IEA) RNA polymerase I core promoter sequence-specific DNA binding (IEA,ISO) RNA polymerase II cis-regulatory region sequence-specific DNA binding (ISO) RNA polymerase II transcription regulatory region sequence-specific DNA binding (ISO) Tat protein binding (IEA,ISO) transcription coactivator activity (IEA,ISO) transcription coregulator binding (IEA,ISO) transcription corepressor activity (IEA,ISO,ISS)
1.
REST repression of neuronal genes requires components of the hSWI.SNF complex.
Battaglioli E, etal., J Biol Chem. 2002 Oct 25;277(43):41038-45. Epub 2002 Aug 20.
2.
Insights into role of bromodomain, testis-specific (Brdt) in acetylated histone H4-dependent chromatin remodeling in mammalian spermiogenesis.
Dhar S, etal., J Biol Chem. 2012 Feb 24;287(9):6387-405. doi: 10.1074/jbc.M111.288167. Epub 2012 Jan 3.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
The role of Brg1, a catalytic subunit of mammalian chromatin-remodeling complexes, in T cell development.
Gebuhr TC, etal., J Exp Med 2003 Dec 15;198(12):1937-49.
5.
Wnt signaling: multiple pathways, multiple receptors, and multiple transcription factors.
Gordon MD and Nusse R, J Biol Chem. 2006 Aug 11;281(32):22429-33. Epub 2006 Jun 22.
6.
ATP-dependent chromatin remodeling: genetics, genomics and mechanisms.
Hargreaves DC and Crabtree GR, Cell Res. 2011 Mar;21(3):396-420. doi: 10.1038/cr.2011.32. Epub 2011 Mar 1.
7.
Mammalian chromatin remodeling complex SWI/SNF is essential for enhanced expression of the albumin gene during liver development.
Inayoshi Y, etal., J Biochem. 2006 Feb;139(2):177-88.
8.
Novel glucocorticoid receptor coactivator effector mechanisms.
Jenkins BD, etal., Trends Endocrinol Metab. 2001 Apr;12(3):122-6.
9.
Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma.
Kadoch C and Crabtree GR, Cell. 2013 Mar 28;153(1):71-85. doi: 10.1016/j.cell.2013.02.036.
10.
Genetic and epigenetic screening for gene alterations of the chromatin-remodeling factor, SMARCA4/BRG1, in lung tumors.
Medina PP, etal., Genes Chromosomes Cancer. 2004 Oct;41(2):170-7.
11.
SWI/SNF chromatin remodeling enzymes are associated with cardiac hypertrophy in a genetic rat model of hypertension.
Mehrotra A, etal., J Cell Physiol. 2013 Dec;228(12):2337-42. doi: 10.1002/jcp.24404.
12.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
13.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
15.
Glucocorticoid receptor-glucocorticoid response element binding stimulates nucleosome disruption by the SWI/SNF complex.
Ostlund Farrants AK, etal., Mol Cell Biol 1997 Feb;17(2):895-905.
16.
A calcium-dependent switch in a CREST-BRG1 complex regulates activity-dependent gene expression.
Qiu Z and Ghosh A, Neuron. 2008 Dec 10;60(5):775-87. doi: 10.1016/j.neuron.2008.09.040.
17.
GOA pipeline
RGD automated data pipeline
18.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
19.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
20.
The bromodomain: From epigenome reader to druggable target.
Sanchez R, etal., Biochim Biophys Acta. 2014 Aug;1839(8):676-685. doi: 10.1016/j.bbagrm.2014.03.011. Epub 2014 Mar 28.
21.
The spectrum of SWI/SNF mutations, ubiquitous in human cancers.
Shain AH and Pollack JR, PLoS One. 2013;8(1):e55119. doi: 10.1371/journal.pone.0055119. Epub 2013 Jan 23.
22.
Aberrant expression of SWI/SNF catalytic subunits BRG1/BRM is associated with tumor development and increased invasiveness in prostate cancers.
Sun A, etal., Prostate. 2007 Feb 1;67(2):203-13.
23.
Mutation analysis of the BRG1 gene in prostate cancer clinical samples.
Valdman A, etal., Int J Oncol. 2003 May;22(5):1003-7.
24.
Purification and biochemical heterogeneity of the mammalian SWI-SNF complex.
Wang W, etal., EMBO J. 1996 Oct 1;15(19):5370-82.
25.
BRG1 in the Nucleus Accumbens Regulates Cocaine-Seeking Behavior.
Wang ZJ, etal., Biol Psychiatry. 2016 Nov 1;80(9):652-660. doi: 10.1016/j.biopsych.2016.04.020. Epub 2016 May 6.
26.
Antioxidant N-acetylcysteine attenuates the reduction of Brg1 protein expression in the myocardium of type 1 diabetic rats.
Xu J, etal., J Diabetes Res. 2013;2013:716219. doi: 10.1155/2013/716219. Epub 2013 Jun 18.
27.
Olig2 targets chromatin remodelers to enhancers to initiate oligodendrocyte differentiation.
Yu Y, etal., Cell. 2013 Jan 17;152(1-2):248-61. doi: 10.1016/j.cell.2012.12.006.
28.
Genetic variant in SWI/SNF complexes influences hepatocellular carcinoma risk: a new clue for the contribution of chromatin remodeling in carcinogenesis.
Zhong R, etal., Sci Rep. 2014 Feb 21;4:4147. doi: 10.1038/srep04147.
Smarca4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 28,438,370 - 28,535,071 (+) NCBI GRCr8 mRatBN7.2 8 20,167,717 - 20,258,975 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 20,167,717 - 20,258,975 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 24,200,412 - 24,292,032 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 22,495,960 - 22,587,578 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 20,397,343 - 20,488,586 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 22,648,323 - 22,739,468 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 22,648,323 - 22,739,468 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 22,702,277 - 22,793,519 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 20,720,915 - 20,812,157 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 20,787,909 - 20,796,297 (+) NCBI Celera 8 21,558,796 - 21,650,002 (+) NCBI Celera Cytogenetic Map 8 q13 NCBI
SMARCA4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 10,961,030 - 11,062,273 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 10,960,932 - 11,079,426 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 11,071,706 - 11,172,949 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 10,932,606 - 11,033,953 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 10,932,605 - 11,033,953 NCBI Celera 19 10,966,440 - 11,067,798 (+) NCBI Celera Cytogenetic Map 19 p13.2 NCBI HuRef 19 10,649,456 - 10,749,943 (+) NCBI HuRef CHM1_1 19 11,072,949 - 11,174,225 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 11,088,037 - 11,189,277 (+) NCBI T2T-CHM13v2.0
Smarca4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 21,527,377 - 21,615,526 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 21,527,465 - 21,615,526 (+) Ensembl GRCm39 Ensembl GRCm38 9 21,616,106 - 21,704,230 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 21,616,169 - 21,704,230 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 21,420,613 - 21,508,674 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 21,366,571 - 21,453,769 (+) NCBI MGSCv36 mm8 Celera 9 18,885,790 - 18,973,851 (+) NCBI Celera Cytogenetic Map 9 A3 NCBI cM Map 9 7.84 NCBI
Smarca4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955495 2,021,566 - 2,105,397 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955495 2,021,671 - 2,105,155 (+) NCBI ChiLan1.0 ChiLan1.0
SMARCA4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 15,881,885 - 15,982,873 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 14,880,580 - 14,981,524 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 10,515,216 - 10,616,155 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 11,250,006 - 11,334,952 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 11,250,006 - 11,334,952 (+) Ensembl panpan1.1 panPan2
SMARCA4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 50,175,489 - 50,268,865 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 50,175,687 - 50,268,836 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 50,049,076 - 50,142,476 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 50,696,689 - 50,790,220 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 50,696,700 - 50,790,215 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 49,906,864 - 50,000,228 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 50,333,903 - 50,427,442 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 50,576,222 - 50,669,723 (-) NCBI UU_Cfam_GSD_1.0
Smarca4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 209,107,992 - 209,201,474 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936659 1,169,792 - 1,249,213 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936659 1,152,846 - 1,246,718 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SMARCA4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 69,662,238 - 69,810,295 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 69,717,175 - 69,810,301 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 70,151,823 - 70,182,978 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SMARCA4
Smarca4
.
Predicted Target Of
Count of predictions: 89 Count of miRNA genes: 71 Interacting mature miRNAs: 82 Transcripts: ENSRNOT00000013165 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 1357398 Slep3 Serum leptin concentration QTL 3 3.43 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 8 9712463 41866876 Rat 2317030 Wbc5 White blood cell count QTL 5 3.21 0.005 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 8 8736635 53736635 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 12880044 Am9 Aortic mass QTL 9 0.007 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 2097640 47097640 Rat 2317032 Ginf2 Gastrointestinal inflammation QTL 2 3.21 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 8 4705810 49705810 Rat 2301416 Bp315 Blood pressure QTL 315 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 7670578 52670578 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2317036 Livw3 Liver weight QTL 3 2.43 0.01 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 8 4705810 49705810 Rat 1598824 Memor4 Memory QTL 4 2.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 8 9712220 53356647 Rat 12880023 Bw184 Body weight QTL 184 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 2097640 47097640 Rat 9590084 Insglur5 Insulin/glucose ratio QTL 5 18.54 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 8 1 24597739 Rat 1354595 Despr4 Despair related QTL 4 2.16 0.0036 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 8 7688955 52688955 Rat 1354627 Despr14 Despair related QTL 14 0.0056 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 7688955 52688955 Rat 12880028 Cm103 Cardiac mass QTL 103 0.02 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 2097640 47097640 Rat 2317051 Aia18 Adjuvant induced arthritis QTL 18 2.42 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 8 8736635 53736635 Rat 2317882 Alcrsp24 Alcohol response QTL 24 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 8 1 25902202 Rat 2317048 Ginf1 Gastrointestinal inflammation QTL 1 3.52 0.005 cecum mucosa thickness (VT:0010234) enterocolitis severity score (CMO:0002138) 8 4705810 49705810 Rat 2302367 Slep5 Serum leptin concentration QTL 5 3.43 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 8 9712463 41866876 Rat 12880025 Cm102 Cardiac mass QTL 102 0.044 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 8 2097640 47097640 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat
AI111450
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 20,258,676 - 20,258,891 (+) MAPPER mRatBN7.2 Rnor_6.0 8 22,739,170 - 22,739,384 NCBI Rnor6.0 Rnor_5.0 8 22,793,221 - 22,793,435 UniSTS Rnor5.0 RGSC_v3.4 8 20,811,859 - 20,812,073 UniSTS RGSC3.4 Celera 8 21,649,704 - 21,649,918 UniSTS Cytogenetic Map 8 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013165 ⟹ ENSRNOP00000013166
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 20,167,717 - 20,258,975 (+) Ensembl Rnor_6.0 Ensembl 8 22,648,323 - 22,739,468 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000097065 ⟹ ENSRNOP00000081001
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 20,167,717 - 20,256,996 (+) Ensembl
RefSeq Acc Id:
NM_134368 ⟹ NP_599195
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 28,443,819 - 28,535,071 (+) NCBI mRatBN7.2 8 20,167,717 - 20,258,975 (+) NCBI Rnor_6.0 8 22,648,323 - 22,739,468 (+) NCBI Rnor_5.0 8 22,702,277 - 22,793,519 (+) NCBI RGSC_v3.4 8 20,720,915 - 20,812,157 (+) RGD Celera 8 21,558,796 - 21,650,002 (+) RGD
Sequence:
CGGAAGGGTGGGCTGGCGCGCGCACGAGGCCGGACGGGCAGCGGAAGCAGGGGAAGTGGACTGGGTAGAAAGGGAGGCGGGGGCGCGCATAGCGGGCGCGCGGGCTGCGTGTGTGCTGGGGGGGGCGG
hide sequence
RefSeq Acc Id:
XM_006242598 ⟹ XP_006242660
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 28,438,370 - 28,535,068 (+) NCBI mRatBN7.2 8 20,167,720 - 20,258,975 (+) NCBI Rnor_6.0 8 22,648,326 - 22,739,468 (+) NCBI Rnor_5.0 8 22,702,277 - 22,793,519 (+) NCBI
Sequence:
AAGGGTGGGCTGGCGCGCGCACGAGGCCGGACGGGCAGCGGAAGCAGGGGAAGTGGACTGGGTA
hide sequence
RefSeq Acc Id:
XM_006242599 ⟹ XP_006242661
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 28,438,370 - 28,535,068 (+) NCBI mRatBN7.2 8 20,167,720 - 20,258,975 (+) NCBI Rnor_6.0 8 22,648,326 - 22,739,468 (+) NCBI Rnor_5.0 8 22,702,277 - 22,793,519 (+) NCBI
Sequence:
AAGGGTGGGCTGGCGCGCGCACGAGGCCGGACGGGCAGCGGAAGCAGGGGAAGTGGACTGGGTAGAAAGGGAGGCGGGGGCGCGCATAGCGGGCGCGCGGGCTGCGTGTGTGCTGGGGGGGGCGGCCA
hide sequence
RefSeq Acc Id:
XM_006242601 ⟹ XP_006242663
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 28,438,370 - 28,535,068 (+) NCBI mRatBN7.2 8 20,167,720 - 20,258,975 (+) NCBI Rnor_6.0 8 22,648,326 - 22,739,468 (+) NCBI Rnor_5.0 8 22,702,277 - 22,793,519 (+) NCBI
Sequence:
AAGGGTGGGCTGGCGCGCGCACGAGGCCGGACGGGCAGCGGAAGCAGGGGAAGTGGACTGGGTA
hide sequence
RefSeq Acc Id:
XM_063264830 ⟹ XP_063120900
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 28,438,370 - 28,535,068 (+) NCBI
RefSeq Acc Id:
XM_063264831 ⟹ XP_063120901
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 28,444,515 - 28,535,068 (+) NCBI
RefSeq Acc Id:
XM_063264832 ⟹ XP_063120902
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 28,438,370 - 28,535,068 (+) NCBI
RefSeq Acc Id:
XM_063264833 ⟹ XP_063120903
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 28,438,370 - 28,535,068 (+) NCBI
RefSeq Acc Id:
XM_063264834 ⟹ XP_063120904
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 28,438,370 - 28,535,068 (+) NCBI
RefSeq Acc Id:
XM_063264835 ⟹ XP_063120905
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 28,444,252 - 28,535,068 (+) NCBI
RefSeq Acc Id:
XM_063264836 ⟹ XP_063120906
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 28,444,515 - 28,535,068 (+) NCBI
RefSeq Acc Id:
NP_599195 ⟸ NM_134368
- UniProtKB:
Q8K1P7 (UniProtKB/Swiss-Prot)
- Sequence:
MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPMPTQGPGGYPQDNMHQMHKPMESMHEKGMPDDPRYNQMKGMGMRSGAHTGMGPPPSPMDQHSQGYPSPLGGSE
hide sequence
RefSeq Acc Id:
XP_006242660 ⟸ XM_006242598
- Peptide Label:
isoform X3
- UniProtKB:
Q8K1P7 (UniProtKB/Swiss-Prot), G3V790 (UniProtKB/TrEMBL), A6JNT8 (UniProtKB/TrEMBL)
- Sequence:
MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPMPTQGPGGYPQDNMHQMHKPMESMHEKGMPDDPRYNQMKGMGMRSGAHTGMGPPPSPMDQHSQGYPSPLGGSE
hide sequence
RefSeq Acc Id:
XP_006242661 ⟸ XM_006242599
- Peptide Label:
isoform X4
- UniProtKB:
Q8K1P7 (UniProtKB/Swiss-Prot)
- Sequence:
MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPMPTQGPGGYPQDNMHQMHKPMESMHEKGMPDDPRYNQMKGMGMRSGAHTGMGPPPSPMDQHSQGYPSPLGGSE
hide sequence
RefSeq Acc Id:
XP_006242663 ⟸ XM_006242601
- Peptide Label:
isoform X7
- UniProtKB:
Q8K1P7 (UniProtKB/Swiss-Prot), A6JNT9 (UniProtKB/TrEMBL)
- Sequence:
MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPMPTQGPGGYPQDNMHQMHKPMESMHEKGMPDDPRYNQMKGMGMRSGAHTGMGPPPSPMDQHSQGYPSPLGGSE
hide sequence
Ensembl Acc Id:
ENSRNOP00000013166 ⟸ ENSRNOT00000013165
Ensembl Acc Id:
ENSRNOP00000081001 ⟸ ENSRNOT00000097065
RefSeq Acc Id:
XP_063120900 ⟸ XM_063264830
- Peptide Label:
isoform X1
- UniProtKB:
Q8K1P7 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063120902 ⟸ XM_063264832
- Peptide Label:
isoform X2
- UniProtKB:
Q8K1P7 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063120903 ⟸ XM_063264833
- Peptide Label:
isoform X5
- UniProtKB:
Q8K1P7 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063120904 ⟸ XM_063264834
- Peptide Label:
isoform X6
- UniProtKB:
Q8K1P7 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063120905 ⟸ XM_063264835
- Peptide Label:
isoform X1
- UniProtKB:
Q8K1P7 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063120906 ⟸ XM_063264836
- Peptide Label:
isoform X1
- UniProtKB:
Q8K1P7 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063120901 ⟸ XM_063264831
- Peptide Label:
isoform X1
- UniProtKB:
Q8K1P7 (UniProtKB/Swiss-Prot)
RGD ID: 13695785 Promoter ID: EPDNEW_R6310 Type: initiation region Name: Smarca4_1 Description: SWI/SNF related, matrix associated, actin dependent regulatorof chromatin, subfamily a, member 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 22,648,490 - 22,648,550 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-11-08
Smarca4
SWI/SNF related BAF chromatin remodeling complex subunit ATPase 4
Smarca4
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Smarca4
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Smarca4
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
Symbol and Name status set to provisional
70820 PROVISIONAL
