Symbol:
Vcp
Name:
valosin-containing protein
RGD ID:
621595
Description:
Enables ATP hydrolysis activity; adenyl ribonucleotide binding activity; and identical protein binding activity. Involved in several processes, including endoplasmic reticulum to Golgi vesicle-mediated transport; positive regulation of ubiquitin-dependent protein catabolic process; and retrograde protein transport, ER to cytosol. Located in cytosol. Part of VCP-NPL4-UFD1 AAA ATPase complex and VCP-NSFL1C complex. Is active in glutamatergic synapse. Human ortholog(s) of this gene implicated in several diseases, including Charcot-Marie-Tooth disease type 2Y; Paget's disease of bone; frontotemporal dementia and/or amyotrophic lateral sclerosis 6; inclusion body myopathy with early-onset Paget disease of bone with or without frontotemporal dementia 1; and inclusion body myositis. Orthologous to human VCP (valosin containing protein); PARTICIPATES IN ataxia telangiectasia-mutated (ATM) signaling pathway; Endoplasmic Reticulum-associated degradation pathway; INTERACTS WITH 1,2,4-trimethylbenzene; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
15S Mg(2+)-ATPase p97 subunit; TER ATPase; transitional endoplasmic reticulum ATPase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
VCP (valosin containing protein)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Vcp (valosin containing protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Vcp (valosin containing protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
VCP (valosin containing protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
VCP (valosin containing protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Vcp (valosin containing protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
VCP (valosin containing protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
VCP (valosin containing protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Vcp (valosin containing protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SBK2 (SH3 domain binding kinase family member 2)
HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
VCP (valosin containing protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Vcp (valosin containing protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
vcp (valosin containing protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
CDC48
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
TER94
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
TER94
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
cdc-48.1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
cdc-48.2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
vcp
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
Vcpem1Ionsz
Genetic Models:
SD-Vcpem1Ionsz
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 62,005,984 - 62,025,387 (-) NCBI GRCr8 mRatBN7.2 5 57,210,167 - 57,229,571 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 57,210,168 - 57,229,571 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 59,183,339 - 59,202,747 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 61,002,153 - 61,021,561 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 60,987,322 - 61,006,704 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 58,426,548 - 58,445,953 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 58,426,549 - 58,445,953 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 62,951,999 - 62,971,402 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 59,472,100 - 59,491,508 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 59,472,279 - 59,491,687 (-) NCBI Celera 5 55,799,589 - 55,818,873 (-) NCBI Celera Cytogenetic Map 5 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Vcp Rat acromesomelic dysplasia, Maroteaux type ISO RGD:731621 8554872 ClinVar Annotator: match by term: Acromesomelic dysplasia 1, Maroteaux type ClinVar PMID:28492532 Vcp Rat Alzheimer's disease ISO RGD:731621 8554872 ClinVar Annotator: match by term: Alzheimer disease ClinVar PMID:30279455 Vcp Rat amyotrophic lateral sclerosis ISO RGD:731621 8554872 ClinVar Annotator: match by term: Charcot disease ClinVar PMID:15034582|PMID:18845250|PMID:20604808|PMID:22270372|PMID:22909335|PMID:23333620|PMID:25617006|PMID:25741868|PMID:28492532|PMID:33144514 Vcp Rat amyotrophic lateral sclerosis type 1 ISO RGD:731621 8554872 ClinVar Annotator: match by term: Amyotrophic Lateral Sclerosis, Dominant | ClinVar Annotator: match by term: more ... ClinVar PMID:11438206|PMID:16643430|PMID:24728327|PMID:25741868|PMID:26740942|PMID:28492532 Vcp Rat amyotrophic lateral sclerosis type 6 ISO RGD:731621 8554872 ClinVar Annotator: match by term: Amyotrophic lateral sclerosis type 6 ClinVar PMID:30103325 Vcp Rat anauxetic dysplasia ISO RGD:731621 8554872 ClinVar Annotator: match by term: Anauxetic dysplasia ClinVar PMID:28492532 Vcp Rat autosomal recessive distal hereditary motor neuronopathy 2 ISO RGD:731621 8554872 ClinVar Annotator: match by term: Autosomal recessive distal spinal muscular atrophy 2 ClinVar PMID:28492532 Vcp Rat Charcot-Marie-Tooth disease type 2Y ISO RGD:731621 8554872 ClinVar Annotator: match by term: Charcot-Marie-Tooth disease type 2Y | ClinVar Annotator: match by term: more ... ClinVar PMID:15034582|PMID:19237541|PMID:19364651|PMID:21145000|PMID:21684747|PMID:21984748|PMID:22270372|PMID:22900631|PMID:23000505|PMID:23333620|PMID:23498975|PMID:24196964|PMID:25125609|PMID:25741868|PMID:25878907|PMID:26105173|PMID:26467025|PMID:27226613|PMID:27708273|PMID:27768726|PMID:28256728|PMID:28360103|PMID:28492532|PMID:28542158|PMID:28692196|PMID:29127544|PMID:30279455|PMID:32481679|PMID:35896379|PMID:39825153 Vcp Rat congenital myopathy 6 ISO RGD:731621 8554872 ClinVar Annotator: match by term: Inclusion Body Myopathy, Dominant ClinVar PMID:11438206|PMID:16643430|PMID:24728327|PMID:25741868|PMID:26740942|PMID:28492532 Vcp Rat Developmental Disabilities ISO RGD:731621 8554872 ClinVar Annotator: match by term: Global developmental delay ClinVar PMID:25741868 Vcp Rat distal arthrogryposis type 1A ISO RGD:731621 8554872 ClinVar Annotator: match by term: Arthrogryposis, distal, type 1A ClinVar PMID:28492532 Vcp Rat Fanconi anemia ISO RGD:731621 8554872 ClinVar Annotator: match by term: Fanconi anemia ClinVar PMID:11438206|PMID:16643430|PMID:24728327|PMID:25741868|PMID:26740942|PMID:28492532 Vcp Rat Fanconi anemia complementation group G ISO RGD:731621 8554872 ClinVar Annotator: match by term: Fanconi anemia complementation group G ClinVar PMID:11438206|PMID:16643430|PMID:24728327|PMID:25741868|PMID:26740942|PMID:28492532 Vcp Rat frontotemporal dementia and/or amyotrophic lateral sclerosis 6 ISO RGD:731621 8554872 ClinVar Annotator: match by term: Amyotrophic lateral sclerosis 14, with or without frontotemporal dementia | more ... ClinVar PMID:12446676|PMID:15034582|PMID:16199547|PMID:16247064|PMID:16321991|PMID:16790606|PMID:16984901|PMID:17329348|PMID:17576681|PMID:17622780|PMID:17763460|PMID:17889967|PMID:17935506|PMID:18341608|PMID:18845250|PMID:19208399|PMID:19225410|PMID:19237541|PMID:19364651|PMID:19506019|PMID:19704082|PMID:20008565|PMID:20104022|PMID:20512113|PMID:20604808|PMID:20957154|PMID:21145000|PMID:21249466|PMID:21320982|PMID:21387114|PMID:21816654|PMID:21822278|PMID:21880997|PMID:21920633|PMID:21984748|PMID:22078486|PMID:22137929|PMID:22270372|PMID:22572540|PMID:22686199|PMID:22898872|PMID:22900631|PMID:22909335|PMID:23000505|PMID:23029473|PMID:23056506|PMID:23152587|PMID:23169451|PMID:23333620|PMID:23498975|PMID:23868359|PMID:24123792|PMID:24196964|PMID:24829604|PMID:24838343|PMID:25125609|PMID:25326637|PMID:25388089|PMID:25457024|PMID:25492614|PMID:25617006|PMID:25618255|PMID:25741868|PMID:25775548|PMID:25878907|PMID:26105173|PMID:26467025|PMID:26511028|PMID:26549226|PMID:26555887|PMID:26627873|PMID:26809617|PMID:26853221|PMID:27165006|PMID:27209344|PMID:27226613|PMID:27538664|PMID:27708273|PMID:27768726|PMID:27790088|PMID:28130640|PMID:28360103|PMID:28430856|PMID:28492532|PMID:28542158|PMID:28692196|PMID:28709720|PMID:28738334|PMID:29033165|PMID:29127544|PMID:29754758|PMID:29770363|PMID:29899994|PMID:30005904|PMID:30103325|PMID:30103957|PMID:30270202|PMID:30279455|PMID:30293881|PMID:30488450|PMID:30955949|PMID:31687228|PMID:31848255|PMID:31862442|PMID:31866807|PMID:31914217|PMID:32028661|PMID:32036797|PMID:32317127|PMID:32481679|PMID:32528171|PMID:32579787|PMID:32671691|PMID:33004675|PMID:33144514|PMID:33415820|PMID:34020145|PMID:34275688|PMID:34573259|PMID:35197922|PMID:35216053|PMID:35741724|PMID:35741838|PMID:35896379|PMID:36644447|PMID:36861178|PMID:36980948|PMID:37002192|PMID:37091525|PMID:37588275|PMID:37883978|PMID:39825153|PMID:7182974|PMID:9536098 Vcp Rat galactosemia ISO RGD:731621 8554872 ClinVar Annotator: match by term: Deficiency of UDPglucose-hexose-1-phosphate uridylyltransferase ClinVar PMID:28492532 Vcp Rat genetic disease ISO RGD:731621 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:15034582|PMID:16321991|PMID:16790606|PMID:16984901|PMID:17329348|PMID:17576681|PMID:17935506|PMID:18341608|PMID:18845250|PMID:19237541|PMID:20008565|PMID:20104022|PMID:20512113|PMID:20604808|PMID:20957154|PMID:21145000|PMID:21387114|PMID:21822278|PMID:21880997|PMID:21920633|PMID:22078486|PMID:22137929|PMID:22270372|PMID:22686199|PMID:22898872|PMID:22909335|PMID:23029473|PMID:23152587|PMID:23169451|PMID:23333620|PMID:23498975|PMID:24196964|PMID:24838343|PMID:25125609|PMID:25388089|PMID:25617006|PMID:25618255|PMID:25741868|PMID:25775548|PMID:26467025|PMID:26853221|PMID:27790088|PMID:28130640|PMID:28430856|PMID:28492532|PMID:28542158|PMID:30270202|PMID:30293881|PMID:31687228|PMID:33144514|PMID:35197922|PMID:35741724|PMID:37091525|PMID:9536098 Vcp Rat hyperphosphatasia with impaired intellectual development syndrome 2 ISO RGD:731621 8554872 ClinVar Annotator: match by term: GLYCOSYLPHOSPHATIDYLINOSITOL BIOSYNTHESIS DEFECT 6 ClinVar PMID:22683086|PMID:24417746|PMID:28492532 Vcp Rat inclusion body myopathy with early-onset Paget disease of bone with or without frontotemporal dementia 1 ISO RGD:731621 8554872 ClinVar Annotator: match by term: Inclusion body myopathy with early-onset Paget disease with or without more ... ClinVar PMID:15034582|PMID:16247064|PMID:16321991|PMID:16790606|PMID:16984901|PMID:17329348|PMID:17763460|PMID:18341608|PMID:18845250|PMID:19225410|PMID:19237541|PMID:19364651|PMID:19506019|PMID:19704082|PMID:20008565|PMID:20104022|PMID:20512113|PMID:20604808|PMID:20957154|PMID:21145000|PMID:21320982|PMID:21387114|PMID:21822278|PMID:21920633|PMID:21984748|PMID:22078486|PMID:22137929|PMID:22270372|PMID:22686199|PMID:22898872|PMID:22900631|PMID:22909335|PMID:23029473|PMID:23056506|PMID:23169451|PMID:23333620|PMID:23498975|PMID:24196964|PMID:24829604|PMID:25125609|PMID:25326637|PMID:25388089|PMID:25492614|PMID:25617006|PMID:25618255|PMID:25741868|PMID:25775548|PMID:26105173|PMID:26467025|PMID:26549226|PMID:26555887|PMID:27226613|PMID:27538664|PMID:27708273|PMID:27768726|PMID:27790088|PMID:28130640|PMID:28360103|PMID:28492532|PMID:28542158|PMID:28692196|PMID:29770363|PMID:30005904|PMID:30279455|PMID:30293881|PMID:31687228|PMID:31848255|PMID:31862442|PMID:32317127|PMID:32528171|PMID:33144514|PMID:34020145|PMID:34573259|PMID:36644447|PMID:36980948|PMID:37588275|PMID:39825153|PMID:7182974 Vcp Rat inclusion body myopathy with Paget disease of bone and frontotemporal dementia ISO RGD:731621 8554872 ClinVar Annotator: match by term: Inclusion body myopathy with Paget disease of bone and frontotemporal more ... ClinVar PMID:15034582|PMID:16247064|PMID:16321991|PMID:16790606|PMID:16984901|PMID:17329348|PMID:17576681|PMID:17763460|PMID:18341608|PMID:18845250|PMID:19225410|PMID:19237541|PMID:19364651|PMID:19506019|PMID:19704082|PMID:20008565|PMID:20104022|PMID:20512113|PMID:20604808|PMID:20957154|PMID:21145000|PMID:21320982|PMID:21387114|PMID:21822278|PMID:21920633|PMID:21984748|PMID:22078486|PMID:22137929|PMID:22270372|PMID:22686199|PMID:22898872|PMID:22900631|PMID:22909335|PMID:23029473|PMID:23056506|PMID:23152587|PMID:23169451|PMID:23333620|PMID:23498975|PMID:24196964|PMID:24829604|PMID:25125609|PMID:25326637|PMID:25388089|PMID:25457024|PMID:25492614|PMID:25617006|PMID:25618255|PMID:25741868|PMID:25775548|PMID:26105173|PMID:26467025|PMID:26549226|PMID:26555887|PMID:27226613|PMID:27538664|PMID:27708273|PMID:27768726|PMID:27790088|PMID:28130640|PMID:28360103|PMID:28430856|PMID:28492532|PMID:28542158|PMID:28692196|PMID:28738334|PMID:29754758|PMID:29770363|PMID:30005904|PMID:30270202|PMID:30279455|PMID:30293881|PMID:31687228|PMID:31848255|PMID:31862442|PMID:32028661|PMID:32317127|PMID:32528171|PMID:33144514|PMID:33415820|PMID:34020145|PMID:34573259|PMID:35197922|PMID:35741724|PMID:36644447|PMID:36980948|PMID:37091525|PMID:37588275|PMID:39825153|PMID:7182974|PMID:9536098 Vcp Rat intellectual disability ISO RGD:731621 8554872 ClinVar Annotator: match by term: Intellectual disability | ClinVar Annotator: match by term: intellectual disabilities ClinVar PMID:21387114|PMID:21920633|PMID:25617006|PMID:25741868|PMID:26467025|PMID:28492532 Vcp Rat Lewy body dementia ISO RGD:731621 8554872 ClinVar Annotator: match by term: Lewy body dementia ClinVar PMID:28492532|PMID:35741838|PMID:35896379 Vcp Rat Muscle Weakness ISO RGD:731621 8554872 ClinVar Annotator: match by term: Progressive muscle weakness ClinVar PMID:25741868 Vcp Rat paraplegia ISO RGD:731621 8554872 ClinVar Annotator: match by term: Spastic paraplegia ClinVar PMID:15034582|PMID:18845250|PMID:20604808|PMID:22270372|PMID:22909335|PMID:23332916|PMID:23332917|PMID:23333620|PMID:25617006|PMID:25741868|PMID:28492532|PMID:33144514 Vcp Rat primary ciliary dyskinesia ISO RGD:731621 8554872 ClinVar Annotator: match by term: Primary ciliary dyskinesia ClinVar PMID:28492532
Only show annotations with direct experimental evidence (0 objects hidden)
Vcp Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:731622 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of VCP mRNA CTD PMID:36331819 Vcp Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of VCP protein CTD PMID:17337753 Vcp Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:731622 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of VCP mRNA] CTD PMID:22206623 Vcp Rat 1,2-dimethylhydrazine increases expression ISO RGD:731622 6480464 1,2-Dimethylhydrazine results in increased expression of VCP mRNA CTD PMID:22206623 Vcp Rat 1-chloro-2,4-dinitrobenzene affects binding ISO RGD:731621 6480464 Dinitrochlorobenzene binds to VCP protein CTD PMID:32991956 Vcp Rat 17alpha-ethynylestradiol increases expression ISO RGD:731622 6480464 Ethinyl Estradiol results in increased expression of VCP mRNA CTD PMID:17555576|PMID:17942748 Vcp Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:731622 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of VCP mRNA CTD PMID:17942748 Vcp Rat 17beta-estradiol decreases expression ISO RGD:731621 6480464 Estradiol results in decreased expression of VCP mRNA CTD PMID:23373633 Vcp Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of VCP protein CTD PMID:32145629 Vcp Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions ISO RGD:731621 6480464 Metribolone promotes the reaction [NDRG1 protein binds to VCP protein] CTD PMID:17220478 Vcp Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO RGD:731621 6480464 Metribolone results in increased expression of VCP protein CTD PMID:17152098 Vcp Rat 1H-pyrazole increases expression ISO RGD:731622 6480464 pyrazole results in increased expression of VCP mRNA CTD PMID:17945193 Vcp Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:731622 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of VCP mRNA CTD PMID:17942748 Vcp Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:731622 6480464 Tetrachlorodibenzodioxin affects the expression of VCP mRNA CTD PMID:21570461 Vcp Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of VCP mRNA; Tetrachlorodibenzodioxin results in increased expression of VCP more ... CTD PMID:19201780|PMID:34747641 Vcp Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of VCP protein CTD PMID:16548065 Vcp Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO RGD:731622 6480464 2,2',4,4',5-brominated diphenyl ether results in decreased expression of VCP protein CTD PMID:18550172 Vcp Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression EXP 6480464 2,2',4,4',5-brominated diphenyl ether results in increased expression of VCP protein CTD PMID:19954255 Vcp Rat 2,5-hexanedione decreases expression EXP 6480464 2,5-hexanedione results in decreased expression of VCP protein CTD PMID:15928459 Vcp Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of VCP mRNA CTD PMID:21346803 Vcp Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:731622 6480464 bisphenol S results in increased expression of VCP mRNA CTD PMID:39298647 Vcp Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:731621 6480464 bisphenol S results in increased expression of VCP protein CTD PMID:34186270 Vcp Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:731622 6480464 Fenretinide results in increased expression of VCP mRNA CTD PMID:28973697 Vcp Rat 4-phenylbutyric acid multiple interactions EXP 6480464 4-phenylbutyric acid inhibits the reaction [Streptozocin results in increased expression of VCP protein] CTD PMID:30980806 Vcp Rat 7,12-dimethyltetraphene multiple interactions EXP 6480464 [9,10-Dimethyl-1,2-benzanthracene co-treated with Isoflavones] results in increased expression of VCP protein CTD PMID:22248470 Vcp Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9,10-Dimethyl-1,2-benzanthracene results in increased expression of VCP protein CTD PMID:22248470 Vcp Rat aflatoxin B1 increases methylation ISO RGD:731621 6480464 Aflatoxin B1 results in increased methylation of VCP intron CTD PMID:30157460 Vcp Rat aristolochic acid A decreases expression ISO RGD:731621 6480464 aristolochic acid I results in decreased expression of VCP mRNA CTD PMID:33212167 Vcp Rat Aroclor 1254 increases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of VCP protein CTD PMID:21791222 Vcp Rat arsane increases ubiquitination ISO RGD:731621 6480464 Arsenic results in increased ubiquitination of VCP protein CTD PMID:35994080 Vcp Rat arsane multiple interactions ISO RGD:731621 6480464 Arsenic promotes the reaction [VCP protein binds to PML protein]; ML-792 inhibits the reaction [Arsenic more ... CTD PMID:36880596 Vcp Rat arsane multiple interactions ISO RGD:731622 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased secretion of VCP more ... CTD PMID:37527016 Vcp Rat arsenic atom increases ubiquitination ISO RGD:731621 6480464 Arsenic results in increased ubiquitination of VCP protein CTD PMID:35994080 Vcp Rat arsenic atom multiple interactions ISO RGD:731621 6480464 Arsenic promotes the reaction [VCP protein binds to PML protein]; ML-792 inhibits the reaction [Arsenic more ... CTD PMID:36880596 Vcp Rat arsenic atom multiple interactions ISO RGD:731622 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased secretion of VCP more ... CTD PMID:37527016 Vcp Rat arsenous acid multiple interactions ISO RGD:731621 6480464 Arsenic Trioxide promotes the reaction [CREBBP protein results in increased expression of VCP mRNA] CTD PMID:18822310 Vcp Rat atrazine decreases expression ISO RGD:731621 6480464 Atrazine results in decreased expression of VCP mRNA CTD PMID:22378314 Vcp Rat benzo[a]pyrene increases expression ISO RGD:731622 6480464 Benzo(a)pyrene results in increased expression of VCP mRNA CTD PMID:21715664 Vcp Rat benzo[a]pyrene multiple interactions ISO RGD:731621 6480464 [Soot co-treated with Benzo(a)pyrene] results in decreased expression of VCP protein modified form CTD PMID:24464499 Vcp Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:731622 6480464 Diethylhexyl Phthalate results in increased expression of VCP mRNA CTD PMID:34319233 Vcp Rat bisphenol A increases expression ISO RGD:731622 6480464 bisphenol A results in increased expression of VCP mRNA; bisphenol A results in increased expression more ... CTD PMID:21932408|PMID:28279065 Vcp Rat bisphenol A decreases expression ISO RGD:731622 6480464 bisphenol A results in decreased expression of VCP protein CTD PMID:35999755 Vcp Rat bisphenol A decreases expression ISO RGD:731621 6480464 bisphenol A results in decreased expression of VCP protein CTD PMID:34186270 Vcp Rat bisphenol A increases expression ISO RGD:731621 6480464 bisphenol A results in increased expression of VCP protein CTD PMID:33670352 Vcp Rat bisphenol A decreases methylation ISO RGD:731621 6480464 bisphenol A results in decreased methylation of VCP promoter CTD PMID:30352284 Vcp Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of VCP mRNA; bisphenol A results in increased expression more ... CTD PMID:25181051|PMID:32145629 Vcp Rat bisphenol AF increases expression ISO RGD:731621 6480464 bisphenol AF results in increased expression of VCP protein CTD PMID:34186270 Vcp Rat Bisphenol B increases expression ISO RGD:731621 6480464 bisphenol B results in increased expression of VCP protein CTD PMID:34186270 Vcp Rat bisphenol F increases expression ISO RGD:731621 6480464 bisphenol F results in increased expression of VCP protein CTD PMID:34186270 Vcp Rat bisphenol F increases expression ISO RGD:731622 6480464 bisphenol F results in increased expression of VCP mRNA CTD PMID:38685157 Vcp Rat bortezomib increases expression ISO RGD:731621 6480464 Bortezomib results in increased expression of VCP mRNA CTD PMID:20977926 Vcp Rat cadmium atom multiple interactions ISO RGD:731621 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of VCP more ... CTD PMID:33040242 Vcp Rat cadmium dichloride affects localization ISO RGD:731621 6480464 Cadmium Chloride affects the localization of VCP protein CTD PMID:18261755 Vcp Rat cadmium dichloride multiple interactions ISO RGD:731621 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of VCP more ... CTD PMID:33040242 Vcp Rat cadmium dichloride decreases expression ISO RGD:731621 6480464 Cadmium Chloride results in decreased expression of VCP protein CTD PMID:24419708 Vcp Rat cadmium dichloride affects localization EXP 6480464 Cadmium Chloride affects the localization of VCP protein CTD PMID:18261755 Vcp Rat cadmium dichloride affects localization ISO RGD:731622 6480464 Cadmium Chloride affects the localization of VCP protein CTD PMID:18261755 Vcp Rat caffeine decreases expression ISO RGD:731621 6480464 Caffeine results in decreased expression of VCP protein CTD PMID:31195006 Vcp Rat caffeine increases phosphorylation ISO RGD:731621 6480464 Caffeine results in increased phosphorylation of VCP protein CTD PMID:35688186 Vcp Rat calcidiol decreases expression EXP 6480464 Calcifediol deficiency results in decreased expression of VCP mRNA CTD PMID:17293106 Vcp Rat CB-5083 decreases activity ISO RGD:731621 6480464 CB-5083 results in decreased activity of VCP protein CTD PMID:30545937 Vcp Rat ceruletide decreases expression EXP 6480464 Ceruletide results in decreased expression of VCP protein CTD PMID:18024178 Vcp Rat chenodeoxycholic acid multiple interactions ISO RGD:731621 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650 Vcp Rat chloropicrin increases expression ISO RGD:731621 6480464 chloropicrin results in increased expression of VCP mRNA CTD PMID:26352163 Vcp Rat chloroquine multiple interactions ISO RGD:731621 6480464 Chloroquine promotes the reaction [VCP protein mutant form results in increased expression of TARDBP protein] CTD PMID:25884947 Vcp Rat chloroquine multiple interactions ISO RGD:731622 6480464 Chloroquine inhibits the reaction [VCP protein mutant form results in decreased expression of MAP1LC3B protein]; more ... CTD PMID:25884947 Vcp Rat chlorpyrifos decreases expression ISO RGD:731622 6480464 Chlorpyrifos results in decreased expression of VCP mRNA CTD PMID:37019170 Vcp Rat chromium trinitrate decreases expression ISO RGD:731622 6480464 chromium nitrate results in decreased expression of VCP protein CTD PMID:22144121 Vcp Rat copper(II) sulfate increases expression ISO RGD:731621 6480464 Copper Sulfate results in increased expression of VCP mRNA CTD PMID:19549813 Vcp Rat crocidolite asbestos increases expression ISO RGD:731621 6480464 Asbestos, Crocidolite results in increased expression of VCP protein CTD PMID:29553831 Vcp Rat curcumin increases expression ISO RGD:731621 6480464 Curcumin results in increased expression of VCP mRNA; Curcumin results in increased expression of VCP more ... CTD PMID:38229314 Vcp Rat cyclophosphamide increases expression EXP 6480464 Cyclophosphamide results in increased expression of VCP protein CTD PMID:15928459 Vcp Rat cyclosporin A decreases methylation ISO RGD:731621 6480464 Cyclosporine results in decreased methylation of VCP promoter CTD PMID:27989131 Vcp Rat cyclosporin A multiple interactions ISO RGD:731621 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650 Vcp Rat deoxycholic acid multiple interactions ISO RGD:731621 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650 Vcp Rat diarsenic trioxide multiple interactions ISO RGD:731621 6480464 Arsenic Trioxide promotes the reaction [CREBBP protein results in increased expression of VCP mRNA] CTD PMID:18822310 Vcp Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of VCP mRNA CTD PMID:18636392 Vcp Rat diethylstilbestrol decreases expression ISO RGD:731622 6480464 Diethylstilbestrol results in decreased expression of VCP mRNA CTD PMID:22467019 Vcp Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of VCP mRNA; Endosulfan results in increased expression of VCP more ... CTD PMID:31464424 Vcp Rat enzyme inhibitor multiple interactions ISO RGD:731621 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Vcp Rat epoxiconazole decreases expression ISO RGD:731622 6480464 epoxiconazole results in decreased expression of VCP mRNA CTD PMID:35436446 Vcp Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of VCP protein CTD PMID:23702218 Vcp Rat ethanol multiple interactions ISO RGD:731622 6480464 Ethanol affects the expression of and affects the splicing of VCP mRNA CTD PMID:30319688 Vcp Rat fenthion decreases expression ISO RGD:731622 6480464 Fenthion results in decreased expression of VCP mRNA CTD PMID:34813904 Vcp Rat fenvalerate decreases expression EXP 6480464 fenvalerate results in decreased expression of VCP protein CTD PMID:33656234 Vcp Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of VCP mRNA CTD PMID:24136188 Vcp Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of VCP mRNA CTD PMID:24136188 Vcp Rat folic acid decreases expression ISO RGD:731622 6480464 Folic Acid results in decreased expression of VCP mRNA CTD PMID:25629700 Vcp Rat folic acid multiple interactions ISO RGD:731622 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of VCP mRNA] CTD PMID:22206623 Vcp Rat FR900359 increases phosphorylation ISO RGD:731621 6480464 FR900359 results in increased phosphorylation of VCP protein CTD PMID:37730182 Vcp Rat furfural multiple interactions ISO RGD:731621 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of more ... CTD PMID:38598786 Vcp Rat glycochenodeoxycholic acid multiple interactions ISO RGD:731621 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650 Vcp Rat glycocholic acid multiple interactions ISO RGD:731621 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650 Vcp Rat glycodeoxycholic acid multiple interactions ISO RGD:731621 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650 Vcp Rat hyaluronic acid multiple interactions EXP 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of VCP protein] CTD PMID:23178681 Vcp Rat hydrazine increases expression EXP 6480464 hydrazine results in increased expression of VCP protein CTD PMID:15370871 Vcp Rat hydrogen peroxide multiple interactions EXP 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of VCP protein] CTD PMID:23178681 Vcp Rat hydrogen peroxide decreases expression EXP 6480464 Hydrogen Peroxide results in decreased expression of VCP protein CTD PMID:23178681 Vcp Rat isoflavones multiple interactions EXP 6480464 [9,10-Dimethyl-1,2-benzanthracene co-treated with Isoflavones] results in increased expression of VCP protein CTD PMID:22248470 Vcp Rat ivermectin decreases expression ISO RGD:731621 6480464 Ivermectin results in decreased expression of VCP protein CTD PMID:32959892 Vcp Rat L-serine decreases expression ISO RGD:731621 6480464 Serine results in decreased expression of VCP mRNA CTD PMID:29098664 Vcp Rat lactacystin multiple interactions ISO RGD:731621 6480464 lactacystin promotes the reaction [VCP protein binds to UBXN1 protein binds to PSMD4 protein] CTD PMID:15362974 Vcp Rat lactacystin increases expression ISO RGD:731621 6480464 lactacystin results in increased expression of VCP protein CTD PMID:15362974 Vcp Rat lead(II) chloride decreases expression ISO RGD:731621 6480464 lead chloride results in decreased expression of VCP protein CTD PMID:24419708 Vcp Rat leflunomide decreases expression ISO RGD:731621 6480464 leflunomide results in decreased expression of VCP mRNA CTD PMID:28988120 Vcp Rat lipopolysaccharide multiple interactions ISO RGD:731621 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of VCP mRNA CTD PMID:35877022 Vcp Rat lovastatin decreases expression ISO RGD:731622 6480464 Lovastatin results in decreased expression of VCP mRNA CTD PMID:20493250 Vcp Rat lovastatin increases expression ISO RGD:731622 6480464 Lovastatin results in increased expression of VCP mRNA CTD PMID:20493250 Vcp Rat lycopene increases expression ISO RGD:731621 6480464 lycopene results in increased expression of VCP mRNA CTD PMID:16886892 Vcp Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO RGD:731621 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of VCP protein CTD PMID:15362974 Vcp Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO RGD:731621 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde promotes the reaction [VCP protein binds to UBXN1 protein binds to PSMD4 protein] CTD PMID:15362974 Vcp Rat naphthalene affects binding ISO RGD:731622 6480464 naphthalene metabolite binds to VCP protein CTD PMID:16206326 Vcp Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of VCP mRNA CTD PMID:24136188 Vcp Rat NMS-873 decreases response to substance ISO RGD:731621 6480464 VCP gene SNP results in decreased susceptibility to NMS-873; VCP protein mutant form results in more ... CTD PMID:27105284 Vcp Rat NMS-873 increases ubiquitination ISO RGD:731621 6480464 NMS-873 results in increased ubiquitination of VCP protein CTD PMID:27105284 Vcp Rat NMS-873 decreases activity ISO RGD:731621 6480464 NMS-873 results in decreased activity of VCP protein CTD PMID:23892893|PMID:24878061|PMID:27105284|PMID:27434122 Vcp Rat NMS-873 multiple interactions ISO RGD:731621 6480464 NMS-873 promotes the reaction [AMFR protein binds to VCP protein]; NMS-873 promotes the reaction [FAF1 more ... CTD PMID:27105284 Vcp Rat ochratoxin A increases expression ISO RGD:731622 6480464 ochratoxin A results in increased expression of VCP protein CTD PMID:19445961 Vcp Rat okadaic acid decreases expression ISO RGD:731621 6480464 Okadaic Acid results in decreased expression of VCP mRNA CTD PMID:28939011 Vcp Rat okadaic acid increases expression ISO RGD:731621 6480464 Okadaic Acid results in increased expression of VCP mRNA CTD PMID:38832940 Vcp Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of VCP mRNA CTD PMID:18636392 Vcp Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of VCP protein CTD PMID:16538041 Vcp Rat paracetamol affects expression ISO RGD:731622 6480464 Acetaminophen affects the expression of VCP mRNA CTD PMID:17562736 Vcp Rat perfluorooctane-1-sulfonic acid affects expression ISO RGD:731622 6480464 perfluorooctane sulfonic acid affects the expression of VCP mRNA CTD PMID:19429403 Vcp Rat perfluorooctane-1-sulfonic acid increases expression ISO RGD:731622 6480464 perfluorooctane sulfonic acid results in increased expression of VCP mRNA CTD PMID:20936131 Vcp Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:731622 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of VCP mRNA; PPARA protein more ... CTD PMID:20936131|PMID:36331819 Vcp Rat perfluorooctanoic acid affects expression ISO RGD:731622 6480464 perfluorooctanoic acid affects the expression of VCP mRNA CTD PMID:19429403 Vcp Rat phenethyl isothiocyanate affects binding ISO RGD:731621 6480464 VCP protein binds to phenethyl isothiocyanate CTD PMID:21838287 Vcp Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of VCP mRNA CTD PMID:19162173 Vcp Rat piroxicam decreases expression ISO RGD:731621 6480464 Piroxicam results in decreased expression of VCP mRNA CTD PMID:21858171 Vcp Rat potassium chromate decreases expression ISO RGD:731622 6480464 potassium chromate(VI) results in decreased expression of VCP protein CTD PMID:22144121 Vcp Rat potassium chromate affects response to substance ISO RGD:731621 6480464 VCP mRNA affects the susceptibility to potassium chromate(VI) CTD PMID:22144121 Vcp Rat prostaglandin A1 increases metabolic processing ISO RGD:731622 6480464 prostaglandin A1 analog results in increased metabolism of VCP protein CTD PMID:19800325 Vcp Rat quartz affects expression ISO RGD:731621 6480464 Quartz affects the expression of VCP protein CTD PMID:27917503 Vcp Rat quercetin decreases phosphorylation ISO RGD:731621 6480464 Quercetin results in decreased phosphorylation of VCP protein CTD PMID:35688186 Vcp Rat resveratrol multiple interactions ISO RGD:731621 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of VCP mRNA CTD PMID:23557933 Vcp Rat rotenone increases oxidation EXP 6480464 Rotenone results in increased oxidation of VCP protein CTD PMID:30951809 Vcp Rat rotenone decreases expression ISO RGD:731621 6480464 Rotenone results in decreased expression of VCP mRNA CTD PMID:29955902 Vcp Rat silicon dioxide affects secretion ISO RGD:731621 6480464 Silicon Dioxide analog affects the secretion of VCP protein CTD PMID:25895662 Vcp Rat silicon dioxide increases expression ISO RGD:731621 6480464 Silicon Dioxide results in increased expression of VCP mRNA CTD PMID:25351596 Vcp Rat silicon dioxide affects expression ISO RGD:731621 6480464 Silicon Dioxide affects the expression of VCP protein CTD PMID:27917503 Vcp Rat sirolimus multiple interactions ISO RGD:731621 6480464 Sirolimus inhibits the reaction [VCP protein mutant form results in increased expression of SQSTM1 protein] CTD PMID:25884947 Vcp Rat sirolimus multiple interactions ISO RGD:731622 6480464 Sirolimus inhibits the reaction [VCP protein mutant form results in decreased expression of MAP1LC3B protein]; more ... CTD PMID:25884947 Vcp Rat sodium arsenite decreases expression ISO RGD:731621 6480464 sodium arsenite results in decreased expression of VCP protein CTD PMID:21925251 Vcp Rat sodium arsenite multiple interactions ISO RGD:731622 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased secretion of VCP more ... CTD PMID:37527016 Vcp Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of VCP protein CTD PMID:31874112 Vcp Rat sodium arsenite increases expression ISO RGD:731621 6480464 sodium arsenite results in increased expression of VCP mRNA; sodium arsenite results in increased expression more ... CTD PMID:15362974|PMID:20886546|PMID:38568856 Vcp Rat sodium chloride multiple interactions ISO RGD:731621 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of more ... CTD PMID:38598786 Vcp Rat sodium dichromate increases expression ISO RGD:731622 6480464 sodium bichromate results in increased expression of VCP mRNA CTD PMID:22155349 Vcp Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of VCP mRNA CTD PMID:22561333 Vcp Rat streptozocin multiple interactions EXP 6480464 4-phenylbutyric acid inhibits the reaction [Streptozocin results in increased expression of VCP protein] CTD PMID:30980806 Vcp Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of VCP protein CTD PMID:30980806 Vcp Rat sulforaphane affects binding ISO RGD:731621 6480464 VCP protein binds to sulforaphane CTD PMID:21838287 Vcp Rat sulindac decreases expression EXP 6480464 Sulindac results in decreased expression of VCP mRNA CTD PMID:24136188 Vcp Rat sunitinib decreases expression ISO RGD:731621 6480464 Sunitinib results in decreased expression of VCP mRNA CTD PMID:31533062 Vcp Rat tamoxifen affects expression ISO RGD:731622 6480464 Tamoxifen affects the expression of VCP mRNA CTD PMID:17555576 Vcp Rat taurine decreases expression ISO RGD:731621 6480464 Taurine results in decreased expression of VCP mRNA CTD PMID:16579726 Vcp Rat temozolomide increases expression ISO RGD:731621 6480464 Temozolomide results in increased expression of VCP mRNA CTD PMID:31758290 Vcp Rat testosterone enanthate affects expression ISO RGD:731621 6480464 testosterone enanthate affects the expression of VCP mRNA CTD PMID:17440010 Vcp Rat tetrachloromethane multiple interactions EXP 6480464 [Olive Oil analog co-treated with Carbon Tetrachloride] affects the expression of VCP protein CTD PMID:25303780 Vcp Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of VCP protein CTD PMID:35544339 Vcp Rat thimerosal decreases expression ISO RGD:731621 6480464 Thimerosal results in decreased expression of VCP mRNA CTD PMID:27188386 Vcp Rat titanium dioxide decreases methylation ISO RGD:731622 6480464 titanium dioxide results in decreased methylation of VCP gene CTD PMID:35295148 Vcp Rat trichloroethene affects expression ISO RGD:731622 6480464 Trichloroethylene affects the expression of VCP mRNA CTD PMID:21135412 Vcp Rat trimellitic anhydride increases expression ISO RGD:731622 6480464 trimellitic anhydride results in increased expression of VCP mRNA CTD PMID:19042947 Vcp Rat triphenyl phosphate affects expression ISO RGD:731621 6480464 triphenyl phosphate affects the expression of VCP mRNA CTD PMID:37042841 Vcp Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of VCP mRNA CTD PMID:24136188 Vcp Rat valproic acid decreases methylation ISO RGD:731621 6480464 Valproic Acid results in decreased methylation of VCP gene CTD PMID:29154799 Vcp Rat valproic acid affects expression ISO RGD:731621 6480464 Valproic Acid affects the expression of VCP mRNA CTD PMID:25979313 Vcp Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of VCP mRNA CTD PMID:23034163 Vcp Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of VCP gene CTD PMID:31682807 Vcp Rat vorinostat increases expression ISO RGD:731621 6480464 vorinostat results in increased expression of VCP protein CTD PMID:20543569 Vcp Rat warfarin decreases expression ISO RGD:731622 6480464 Warfarin results in decreased expression of VCP mRNA CTD PMID:20493250 Vcp Rat warfarin increases expression ISO RGD:731622 6480464 Warfarin results in increased expression of VCP mRNA CTD PMID:20493250
Biological Process
Only show annotations with direct experimental evidence (0 objects hidden)
Vcp Rat aggresome assembly acts_upstream_of_or_within ISO RGD:731622 1624291 MGI:1333752 PMID:16810319 RGD PMID:16810319 Vcp Rat aggresome assembly acts_upstream_of_or_within IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat ATP metabolic process involved_in ISO RGD:731622 1624291 PMID:12847084 RGD PMID:12847084 Vcp Rat ATP metabolic process involved_in IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat autophagosome maturation involved_in ISS UniProtKB:P55072 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat autophagosome maturation involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat autophagosome maturation involved_in IBA FB:FBgn0286784|PANTHER:PTN000554506|UniProtKB:P55072 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Vcp Rat autophagosome maturation involved_in ISO RGD:731621 1624291 PMID:20104022 RGD PMID:20104022 Vcp Rat autophagy involved_in ISS UniProtKB:P55072 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat autophagy involved_in IEA UniProtKB-KW:KW-0072 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Vcp Rat autophagy involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat autophagy involved_in ISO RGD:731621 1624291 PMID:20104022, PMID:25125609 RGD PMID:20104022|PMID:25125609 Vcp Rat cellular response to arsenite ion involved_in ISO RGD:731621 1624291 PMID:29804830 RGD PMID:29804830 Vcp Rat cellular response to arsenite ion involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat cellular response to arsenite ion involved_in ISS UniProtKB:P55072 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat cellular response to heat involved_in ISS UniProtKB:P55072 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat cellular response to heat involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat cellular response to heat involved_in ISO RGD:731621 1624291 PMID:29804830 RGD PMID:29804830 Vcp Rat cellular response to misfolded protein involved_in ISO RGD:731621 1624291 PMID:24089527 RGD PMID:24089527 Vcp Rat cellular response to misfolded protein involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat cellular response to stress involved_in IEA ARBA:ARBA00028184 1600115 GO_REF:0000117 UniProt GO_REF:0000117 Vcp Rat cytoplasm protein quality control involved_in ISO RGD:731621 1624291 PMID:29033132 RGD PMID:29033132 Vcp Rat cytoplasm protein quality control involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat DNA damage response involved_in ISO RGD:731621 1624291 PMID:16140914, PMID:22120668, PMID:23042605 RGD PMID:16140914|PMID:22120668|PMID:23042605 Vcp Rat DNA damage response involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat DNA damage response involved_in IEA UniProtKB-KW:KW-0227 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Vcp Rat DNA damage response involved_in ISS UniProtKB:P55072 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat DNA repair involved_in ISS UniProtKB:P23787 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat DNA repair involved_in IEA UniProtKB-KW:KW-0234 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Vcp Rat double-strand break repair involved_in ISS UniProtKB:P55072 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat double-strand break repair involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat double-strand break repair involved_in ISO RGD:731621 1624291 PMID:10855792, PMID:22120668 RGD PMID:10855792|PMID:22120668 Vcp Rat endoplasmic reticulum stress-induced pre-emptive quality control involved_in ISS UniProtKB:P55072 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat endoplasmic reticulum stress-induced pre-emptive quality control involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat endoplasmic reticulum stress-induced pre-emptive quality control involved_in ISO RGD:731621 1624291 PMID:26565908 RGD PMID:26565908 Vcp Rat endoplasmic reticulum to Golgi vesicle-mediated transport IMP 730179 RGD Vcp Rat endosome to lysosome transport via multivesicular body sorting pathway involved_in ISS UniProtKB:P55072 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat endosome to lysosome transport via multivesicular body sorting pathway involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat endosome to lysosome transport via multivesicular body sorting pathway involved_in ISO RGD:731621 1624291 PMID:21822278 RGD PMID:21822278 Vcp Rat ERAD pathway involved_in IDA 10047330 PMID:12847084 ComplexPortal Vcp Rat ERAD pathway involved_in ISO RGD:731621 1624291 PMID:17872946, PMID:20104022, PMID:22607976, PMID:24089527, PMID:24129571, PMID:25088257, PMID:26265139 RGD PMID:17872946|PMID:20104022|PMID:22607976|PMID:24089527|PMID:24129571|PMID:25088257|PMID:26265139 Vcp Rat ERAD pathway involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat ERAD pathway involved_in ISS UniProtKB:P55072 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat ERAD pathway involved_in ISO RGD:731622 1624291 PMID:12847084 RGD PMID:12847084 Vcp Rat flavin adenine dinucleotide catabolic process involved_in ISO RGD:731621 1624291 PMID:23498975 RGD PMID:23498975 Vcp Rat flavin adenine dinucleotide catabolic process involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat interstrand cross-link repair involved_in ISS UniProtKB:P23787 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat macroautophagy involved_in ISS UniProtKB:P55072 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat macroautophagy involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat macroautophagy involved_in ISO RGD:731621 1624291 PMID:27753622 RGD PMID:27753622 Vcp Rat mitotic spindle disassembly involved_in IBA PANTHER:PTN000554506|PomBase:SPAC1565.08|SGD:S000002284 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Vcp Rat NADH metabolic process involved_in ISO RGD:731621 1624291 PMID:23498975 RGD PMID:23498975 Vcp Rat NADH metabolic process involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat negative regulation of hippo signaling involved_in ISO RGD:731621 1624291 FB:FBgn0286784 PMID:38710747 RGD PMID:38710747 Vcp Rat negative regulation of hippo signaling involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat negative regulation of protein localization to chromatin involved_in ISO RGD:731621 1624291 PMID:35013556 RGD PMID:35013556 Vcp Rat negative regulation of protein localization to chromatin involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat negative regulation of smoothened signaling pathway involved_in ISO RGD:731621 1624291 PMID:23747190 RGD PMID:23747190 Vcp Rat negative regulation of smoothened signaling pathway involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat obsolete positive regulation of Lys63-specific deubiquitinase activity involved_in ISO RGD:731621 1624291 PMID:22970133 RGD PMID:22970133 Vcp Rat positive regulation of ATP biosynthetic process involved_in ISO RGD:731621 1624291 PMID:23498975 RGD PMID:23498975 Vcp Rat positive regulation of ATP biosynthetic process involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat positive regulation of canonical Wnt signaling pathway involved_in ISO RGD:731621 1624291 PMID:28689657 RGD PMID:28689657 Vcp Rat positive regulation of canonical Wnt signaling pathway involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat positive regulation of mitochondrial membrane potential involved_in ISO RGD:731621 1624291 PMID:23498975 RGD PMID:23498975 Vcp Rat positive regulation of mitochondrial membrane potential involved_in IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat positive regulation of mitochondrial membrane potential involved_in ISO RGD:731622 1624291 PMID:23498975 RGD PMID:23498975 Vcp Rat positive regulation of mitochondrial membrane potential involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat positive regulation of non-canonical NF-kappaB signal transduction involved_in ISO RGD:731621 1624291 PMID:37816088 RGD PMID:37816088 Vcp Rat positive regulation of non-canonical NF-kappaB signal transduction involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat positive regulation of oxidative phosphorylation involved_in ISO RGD:731621 1624291 PMID:23498975 RGD PMID:23498975 Vcp Rat positive regulation of oxidative phosphorylation involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat positive regulation of proteasomal ubiquitin-dependent protein catabolic process involved_in ISO RGD:731621 1624291 PMID:9452483 RGD PMID:9452483 Vcp Rat positive regulation of proteasomal ubiquitin-dependent protein catabolic process involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat positive regulation of protein catabolic process involved_in ISO RGD:731621 1624291 PMID:11483959, PMID:18775313 RGD PMID:11483959|PMID:18775313 Vcp Rat positive regulation of protein catabolic process involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat positive regulation of protein K63-linked deubiquitination involved_in ISO RGD:731621 1624291 PMID:22970133 RGD PMID:22970133 Vcp Rat positive regulation of protein K63-linked deubiquitination involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat positive regulation of protein-containing complex assembly involved_in ISO RGD:731621 1624291 PMID:18775313 RGD PMID:18775313 Vcp Rat positive regulation of protein-containing complex assembly involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat positive regulation of ubiquitin-dependent protein catabolic process IMP 1599730 RGD Vcp Rat proteasomal protein catabolic process involved_in ISS UniProtKB:P55072 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat proteasomal protein catabolic process involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat proteasomal protein catabolic process involved_in ISO RGD:731621 1624291 PMID:26565908 RGD PMID:26565908 Vcp Rat proteasome-mediated ubiquitin-dependent protein catabolic process involved_in ISO RGD:731621 1624291 PMID:20104022, PMID:31387940 RGD PMID:20104022|PMID:31387940 Vcp Rat proteasome-mediated ubiquitin-dependent protein catabolic process involved_in IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat proteasome-mediated ubiquitin-dependent protein catabolic process involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat proteasome-mediated ubiquitin-dependent protein catabolic process involved_in ISO RGD:731622 1624291 PMID:26692333 RGD PMID:26692333 Vcp Rat proteasome-mediated ubiquitin-dependent protein catabolic process involved_in IBA FB:FBgn0286784|MGI:99919|PANTHER:PTN000554506|PomBase:SPAC1565.08|SGD:S000002284|UniProtKB:P55072 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Vcp Rat proteasome-mediated ubiquitin-dependent protein catabolic process involved_in ISS UniProtKB:P55072 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat protein ubiquitination involved_in ISS UniProtKB:P55072 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat protein ubiquitination involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat protein ubiquitination involved_in ISO RGD:731621 1624291 PMID:22120668 RGD PMID:22120668 Vcp Rat protein-DNA covalent cross-linking repair involved_in ISS UniProtKB:P55072 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat protein-DNA covalent cross-linking repair involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat protein-DNA covalent cross-linking repair involved_in ISO RGD:731621 1624291 PMID:32152270 RGD PMID:32152270 Vcp Rat regulation of aerobic respiration involved_in ISO RGD:731621 1624291 PMID:23498975 RGD PMID:23498975 Vcp Rat regulation of aerobic respiration involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat regulation of protein localization to chromatin involved_in ISO RGD:731621 1624291 PMID:32152270 RGD PMID:32152270 Vcp Rat regulation of protein localization to chromatin involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat regulation of protein localization to chromatin involved_in ISS UniProtKB:P23787 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat regulation of protein localization to chromatin involved_in ISS UniProtKB:P55072 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat regulation of synapse organization involved_in IDA 13702359 PMID:22105171 SynGO Vcp Rat regulation of synapse organization involved_in IMP 13702359 PMID:22105171 SynGO Vcp Rat retrograde protein transport, ER to cytosol involved_in ISO RGD:731621 1624291 PMID:15215856, PMID:25660456 RGD PMID:15215856|PMID:25660456 Vcp Rat retrograde protein transport, ER to cytosol involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat retrograde protein transport, ER to cytosol involved_in ISO RGD:731622 1624291 PMID:12847084 RGD PMID:12847084 Vcp Rat retrograde protein transport, ER to cytosol involved_in IBA MGI:99919|PANTHER:PTN000554506|RGD:621595|SGD:S000002284|UniProtKB:P55072 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Vcp Rat retrograde protein transport, ER to cytosol involved_in IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat retrograde protein transport, ER to cytosol involved_in EXP 10047330 PMID:12847084 ComplexPortal Vcp Rat stress granule disassembly involved_in ISO RGD:731621 1624291 PMID:29804830, PMID:36692217 RGD PMID:29804830|PMID:36692217 Vcp Rat stress granule disassembly involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat stress granule disassembly involved_in ISS UniProtKB:P55072 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat translesion synthesis involved_in ISS UniProtKB:P55072 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat translesion synthesis involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat translesion synthesis involved_in ISO RGD:731621 1624291 PMID:23042605 RGD PMID:23042605 Vcp Rat ubiquitin-dependent protein catabolic process acts_upstream_of_or_within ISO RGD:731622 1624291 MGI:1333752 PMID:16810319 RGD PMID:16810319 Vcp Rat ubiquitin-dependent protein catabolic process acts_upstream_of_or_within IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat viral genome replication involved_in ISO RGD:731621 1624291 PMID:22379090 RGD PMID:22379090 Vcp Rat viral genome replication involved_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107
Cellular Component
Only show annotations with direct experimental evidence (0 objects hidden)
Vcp Rat ATPase complex part_of ISO RGD:731622 1624291 PMID:15740751 RGD PMID:15740751 Vcp Rat ATPase complex part_of IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat ciliary basal body located_in ISO RGD:731621 1624291 RGD GO_REF:0000052 Vcp Rat ciliary basal body located_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat cytoplasm located_in NAS 8554186 PMID:16601695 ComplexPortal Vcp Rat cytoplasm located_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat cytoplasm located_in IEA UniProtKB-KW:KW-0963 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Vcp Rat cytoplasm located_in ISO RGD:731621 1624291 PMID:27753622 RGD PMID:27753622 Vcp Rat cytoplasmic stress granule located_in ISS UniProtKB:P55072 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat cytoplasmic stress granule located_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat cytoplasmic stress granule located_in IEA UniProtKB-SubCell:SL-0496 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Vcp Rat cytoplasmic stress granule located_in ISO RGD:731621 1624291 PMID:29804830 RGD PMID:29804830 Vcp Rat cytoplasmic ubiquitin ligase complex part_of ISO RGD:731622 1624291 PMID:11689694 RGD PMID:11689694 Vcp Rat cytosol is_active_in ISO RGD:731621 1624291 PMID:38710747 RGD PMID:38710747 Vcp Rat cytosol located_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat cytosol located_in IEA UniProtKB-SubCell:SL-0091 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Vcp Rat cytosol is_active_in IBA FB:FBgn0286784|PANTHER:PTN000554506|RGD:621595|SGD:S000002284|TAIR:locus:2101933|UniProtKB:P55072 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Vcp Rat cytosol located_in ISO RGD:731621 1624291 PMID:10855792, PMID:15215856 RGD GO_REF:0000052|PMID:10855792|PMID:15215856 Vcp Rat cytosol located_in IDA 633466 PMID:9214505 ParkinsonsUK-UCL Vcp Rat cytosol located_in IDA 8554667 PMID:23444373 MGI Vcp Rat Derlin-1 retrotranslocation complex part_of ISO RGD:731622 1624291 PMID:15215856 RGD PMID:15215856 Vcp Rat Derlin-1 retrotranslocation complex part_of IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat Derlin-1 retrotranslocation complex part_of IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat Derlin-1 retrotranslocation complex part_of ISO RGD:731621 1624291 PMID:15215856, PMID:17872946 RGD PMID:15215856|PMID:17872946 Vcp Rat endoplasmic reticulum located_in IEA UniProtKB-SubCell:SL-0095 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Vcp Rat endoplasmic reticulum located_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat endoplasmic reticulum located_in IEA UniProtKB-KW:KW-0256 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Vcp Rat endoplasmic reticulum located_in ISO RGD:731621 1624291 PMID:15215856, PMID:24089527 RGD PMID:15215856|PMID:24089527 Vcp Rat endoplasmic reticulum membrane located_in ISO RGD:731621 1624291 PMID:17872946 RGD PMID:17872946 Vcp Rat endoplasmic reticulum membrane located_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat endoplasmic reticulum membrane located_in IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat endoplasmic reticulum membrane located_in ISO RGD:731622 1624291 PMID:12847084 RGD PMID:12847084 Vcp Rat endoplasmic reticulum membrane is_active_in ISO RGD:731621 1624291 PMID:24129571 RGD PMID:24129571 Vcp Rat glutamatergic synapse is_active_in IDA 13702359 PMID:22105171 SynGO Vcp Rat glutamatergic synapse is_active_in IMP 13702359 PMID:22105171 SynGO Vcp Rat lipid droplet located_in ISO RGD:731621 1624291 PMID:23297223 RGD PMID:23297223 Vcp Rat lipid droplet located_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat nucleoplasm located_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat nucleoplasm located_in ISO RGD:731621 1624291 RGD GO_REF:0000052 Vcp Rat nucleus located_in ISO RGD:731621 1624291 PMID:10855792, PMID:26842564 RGD PMID:10855792|PMID:26842564 Vcp Rat nucleus located_in IEA UniProtKB-KW:KW-0539 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Vcp Rat nucleus located_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat nucleus located_in IEA UniProtKB-SubCell:SL-0191 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Vcp Rat nucleus is_active_in IBA PANTHER:PTN000554506|PomBase:SPAC1565.08|SGD:S000002284|TAIR:locus:2085064|TAIR:locus:2101933|UniProtKB:P55072|WB:WBGene00007352|WB:WBGene00008053|dictyBase:DDB_G0288065 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Vcp Rat perinuclear region of cytoplasm located_in ISO RGD:731621 1624291 PMID:16275660 RGD PMID:16275660 Vcp Rat perinuclear region of cytoplasm located_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat proteasome complex part_of ISO RGD:731621 1624291 PMID:9452483 RGD PMID:9452483 Vcp Rat proteasome complex part_of IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat protein-containing complex part_of ISO RGD:731621 1624291 PMID:21822278, PMID:23349634 RGD PMID:21822278|PMID:23349634 Vcp Rat protein-containing complex part_of IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat protein-containing complex part_of IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat protein-containing complex part_of ISO RGD:731622 1624291 PR:Q9Z2V5|UniProtKB:P38532 PMID:17785525 RGD PMID:17785525 Vcp Rat site of double-strand break located_in ISS UniProtKB:P55072 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Vcp Rat site of double-strand break located_in IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat site of double-strand break located_in ISO RGD:731621 1624291 PMID:22120668 RGD PMID:22120668 Vcp Rat synapse is_active_in ISO RGD:731622 1624291 PMID:16635246, PMID:24534009 RGD PMID:16635246|PMID:24534009 Vcp Rat synapse is_active_in IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat VCP-NPL4-UFD1 AAA ATPase complex part_of EXP 13432281 PMID:22232657 ComplexPortal Vcp Rat VCP-NPL4-UFD1 AAA ATPase complex part_of IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat VCP-NPL4-UFD1 AAA ATPase complex part_of ISO RGD:731622 1624291 UniProtKB:Q9ES53 PMID:10811609, PMID:12847084, PMID:17000876, PMID:22232657 RGD PMID:10811609|PMID:12847084|PMID:17000876|PMID:22232657 Vcp Rat VCP-NPL4-UFD1 AAA ATPase complex part_of IBA MGI:99919|PANTHER:PTN000554506|RGD:621595|SGD:S000002284|UniProtKB:P55072|WB:WBGene00007352|WB:WBGene00008053 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Vcp Rat VCP-NPL4-UFD1 AAA ATPase complex part_of IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat VCP-NPL4-UFD1 AAA ATPase complex part_of IDA 633500 PMID:10811609 ParkinsonsUK-UCL Vcp Rat VCP-NPL4-UFD1 AAA ATPase complex part_of ISO RGD:731621 1624291 PMID:20414249 RGD PMID:20414249 Vcp Rat VCP-NSFL1C complex part_of IPI 8554186 PMID:16601695 ComplexPortal Vcp Rat VCP-NSFL1C complex part_of IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat VCP-NSFL1C complex part_of ISO RGD:731622 1624291 UniProtKB:O35987 PMID:10811609, PMID:12847084, PMID:14988733 RGD PMID:10811609|PMID:12847084|PMID:14988733 Vcp Rat VCP-NSFL1C complex part_of IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat VCP-NSFL1C complex part_of IPI UniProtKB:O35987 633500 PMID:10811609 ParkinsonsUK-UCL Vcp Rat VCP-NSFL1C complex part_of IPI UniProtKB:O35987 633466 PMID:9214505 ParkinsonsUK-UCL Vcp Rat VCP-NSFL1C complex part_of ISO RGD:731621 1624291 PMID:21645854 RGD PMID:21645854
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Vcp Rat ADP binding IMP 7241008 RGD Vcp Rat ADP binding enables IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat ADP binding enables ISO RGD:731622 1624291 PMID:15740751 RGD PMID:15740751 Vcp Rat ATP binding IMP 7241008 RGD Vcp Rat ATP binding enables IEA UniProtKB-KW:KW-0067 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Vcp Rat ATP binding enables IEA InterPro:IPR003959|InterPro:IPR003960 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Vcp Rat ATP binding enables IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat ATP binding enables ISO RGD:731622 1624291 PMID:12847084, PMID:15740751 RGD PMID:12847084|PMID:15740751 Vcp Rat ATP binding enables IDA 730179 PMID:7806566 BHF-UCL Vcp Rat ATP hydrolysis activity IDA 730179 RGD Vcp Rat ATP hydrolysis activity enables IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat ATP hydrolysis activity enables IEA InterPro:IPR003593|InterPro:IPR003959|InterPro:IPR003960 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Vcp Rat ATP hydrolysis activity enables IEA RHEA:13065 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Vcp Rat ATP hydrolysis activity enables IBA MGI:99919|PANTHER:PTN004603074|RGD:621595|SGD:S000001680|SGD:S000002284|SGD:S000004389|SGD:S000005273|UniProtKB:O43933|UniProtKB:P46468|UniProtKB:P55072|UniProtKB:Q13608|WB:WBGene00007352|WB:WBGene00008053|WB:WBGene00010562 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Vcp Rat ATP hydrolysis activity enables ISO RGD:731622 1624291 PMID:12847084 RGD PMID:12847084 Vcp Rat ATP hydrolysis activity enables ISO RGD:731621 1624291 PMID:23349634, PMID:24129571 RGD PMID:23349634|PMID:24129571 Vcp Rat ATP hydrolysis activity enables IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat ATP hydrolysis activity IMP 7241008 RGD Vcp Rat BAT3 complex binding enables ISO RGD:731621 1624291 ComplexPortal:CPX-132 PMID:21636303 RGD PMID:21636303 Vcp Rat BAT3 complex binding enables IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat deubiquitinase activator activity enables ISO RGD:731621 1624291 PMID:22970133 RGD PMID:22970133 Vcp Rat deubiquitinase activator activity enables IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat hydrolase activity enables IEA InterPro:IPR005938 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Vcp Rat hydrolase activity enables IEA UniProtKB-KW:KW-0378 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Vcp Rat identical protein binding IPI RGD:621595 730179 homooligomerization RGD Vcp Rat identical protein binding enables IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat identical protein binding enables IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat identical protein binding enables ISO RGD:731621 1624291 UniProtKB:P55072 PMID:20512113, PMID:24055316, PMID:25416956, PMID:26712278, PMID:26822609, PMID:26849035 RGD PMID:20512113|PMID:24055316|PMID:25416956|PMID:26712278|PMID:26822609|PMID:26849035 Vcp Rat identical protein binding enables ISO RGD:731622 1624291 UniProtKB:Q01853 PMID:15740751, PMID:18462676, PMID:22232657 RGD PMID:15740751|PMID:18462676|PMID:22232657 Vcp Rat identical protein binding enables IDA 730179 PMID:7806566 BHF-UCL Vcp Rat identical protein binding IPI RGD:621595 7241008 homohexamerization RGD Vcp Rat K48-linked polyubiquitin modification-dependent protein binding enables ISO RGD:731622 1624291 PMID:12847084 RGD PMID:12847084 Vcp Rat K48-linked polyubiquitin modification-dependent protein binding enables IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat K48-linked polyubiquitin modification-dependent protein binding enables ISO RGD:731621 1624291 PMID:37816088 RGD PMID:37816088 Vcp Rat K48-linked polyubiquitin modification-dependent protein binding enables IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat lipid binding enables IEA UniProtKB-KW:KW-0446 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Vcp Rat MHC class I protein binding enables ISO RGD:731622 1624291 PMID:12847084 RGD PMID:12847084 Vcp Rat MHC class I protein binding enables IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat nucleotide binding enables IEA UniProtKB-KW:KW-0547 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Vcp Rat polyubiquitin modification-dependent protein binding enables ISO RGD:731621 1624291 PMID:11483959 RGD PMID:11483959 Vcp Rat polyubiquitin modification-dependent protein binding enables ISO RGD:731622 1624291 PMID:11483959 RGD PMID:11483959 Vcp Rat polyubiquitin modification-dependent protein binding enables IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat polyubiquitin modification-dependent protein binding enables IBA MGI:99919|PANTHER:PTN000554506|SGD:S000002284|UniProtKB:P55072 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Vcp Rat polyubiquitin modification-dependent protein binding enables IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat protein binding IPI RGD:619952 633500 RGD Vcp Rat protein binding enables ISO RGD:731621 1624291 UniProtKB:A9UGY9|UniProtKB:B1AQ61|UniProtKB:O00124|UniProtKB:O60858|UniProtKB:O60941|UniProtKB:O60941-5|UniProtKB:O75175|UniProtKB:O76064|UniProtKB:O94868|UniProtKB:O94888|UniProtKB:O94941|UniProtKB:O96017|UniProtKB:P07602-1|UniProtKB:P09471|UniProtKB:P24278|UniProtKB:P25786|UniProtKB:P25963|UniProtKB:P26045|UniProtKB:P26378-2|UniProtKB:P32297|UniProtKB:P32969|UniProtKB:P38398|UniProtKB:P42858|UniProtKB:P46977|UniProtKB:P51668|UniProtKB:P54252|UniProtKB:P54252-1|UniProtKB:P54253|UniProtKB:P62136|UniProtKB:P62191|UniProtKB:P62993|UniProtKB:P63027|UniProtKB:P63104|UniProtKB:P68543|UniProtKB:Q03135|UniProtKB:Q04323|UniProtKB:Q07869|UniProtKB:Q13619|UniProtKB:Q14CS0|UniProtKB:Q16560-2|UniProtKB:Q5T124-6|UniProtKB:Q5VVQ6|UniProtKB:Q6GPH4|UniProtKB:Q6UX01|UniProtKB:Q8BHC7|UniProtKB:Q8NBI5|UniProtKB:Q8NHG7|UniProtKB:Q8TAT6|UniProtKB:Q8TBB1|UniProtKB:Q8TCF1|UniProtKB:Q8WZA0|UniProtKB:Q92575|UniProtKB:Q92890|UniProtKB:Q969W3|UniProtKB:Q96CS3|UniProtKB:Q96EP0|UniProtKB:Q96EQ8|UniProtKB:Q96HA8|UniProtKB:Q96J88-3|UniProtKB:Q96LJ8|UniProtKB:Q96LK0|UniProtKB:Q96Q80|UniProtKB:Q9BQE4|UniProtKB:Q9BUN8|UniProtKB:Q9BUU2|UniProtKB:Q9BZE9|UniProtKB:Q9BZV1|UniProtKB:Q9GZP9|UniProtKB:Q9H040|UniProtKB:Q9H0K1|UniProtKB:Q9H7H0-2|UniProtKB:Q9H867|UniProtKB:Q9HC29|UniProtKB:Q9UKV5|UniProtKB:Q9UNE7|UniProtKB:Q9UNN5|UniProtKB:Q9UNN5-1|UniProtKB:Q9UNZ2|UniProtKB:Q9WTX6|UniProtKB:Q9Y263|UniProtKB:Q9Y468|UniProtKB:Q9Y4L5|UniProtKB:Q9Y6I9 PMID:10364224, PMID:10855792, PMID:15161933, PMID:15215856, PMID:15743842, PMID:16186510, PMID:16275660, PMID:16306228, PMID:16407162, PMID:16449189, PMID:16525503, PMID:17314412, PMID:17525332, more ... RGD PMID:10364224|PMID:10855792|PMID:15161933|PMID:15215856|PMID:15743842|PMID:16186510|PMID:16275660|PMID:16306228|PMID:16407162|PMID:16449189|PMID:16525503|PMID:17314412|PMID:17525332|PMID:17681147|PMID:17872946|PMID:18654987|PMID:18656546|PMID:18711132|PMID:18775313|PMID:19275885|PMID:19570996|PMID:19818707|PMID:19822669|PMID:20414249|PMID:21135095|PMID:21343306|PMID:21645854|PMID:21822278|PMID:21900206|PMID:21949850|PMID:21988832|PMID:22119785|PMID:22120668|PMID:22466964|PMID:22795130|PMID:22902628|PMID:22948820|PMID:23042605|PMID:23042607|PMID:23349634|PMID:24089527|PMID:24726327|PMID:25416956|PMID:25593058|PMID:25814554|PMID:25959826|PMID:26265139|PMID:26389662|PMID:26471729|PMID:26496610|PMID:26712280|PMID:26842564|PMID:27714797|PMID:27753622|PMID:27812135|PMID:28514442|PMID:29804830|PMID:29892012|PMID:29997244|PMID:30455355|PMID:31073040|PMID:31515488|PMID:31847414|PMID:32152270|PMID:32296183|PMID:32814053|PMID:33961781|PMID:35271311|PMID:35273242|PMID:9452483 Vcp Rat protein binding enables IPI UniProtKB:O35987 8553465 PMID:20691684 IntAct Vcp Rat protein binding enables IPI UniProtKB:O35987 633500 PMID:10811609 IntAct Vcp Rat protein binding enables IPI UniProtKB:O35987 8554186 PMID:16601695 IntAct Vcp Rat protein binding enables IPI UniProtKB:O35987 633466 PMID:9214505 IntAct Vcp Rat protein binding enables ISO RGD:731622 1624291 PR:E9Q9D5|PR:O08736|PR:O35245|PR:P27612|PR:P57716|PR:Q80UW2|PR:Q8C3Q9|PR:Q91X58|PR:Q9CVD2|PR:Q9CZ44|PR:Q9ES00|PR:Q9QZN4|PR:Q9Z2V5|UniProtKB:F1M8V2|UniProtKB:O35987|UniProtKB:P36037|UniProtKB:P70362|UniProtKB:Q80UU1|UniProtKB:Q8R1K1|UniProtKB:Q9BQE4|UniProtKB:Q9D024|UniProtKB:Q9D1E5|UniProtKB:Q9ES00|UniProtKB:Q9ES53|UniProtKB:Q9ES54|UniProtKB:Q9JI78|UniProtKB:Q9R049 PMID:10811609, PMID:11689694, PMID:12504083, PMID:12847084, PMID:14561754, PMID:14988733, PMID:15215856, PMID:15723043, PMID:16525503, PMID:16709668, PMID:17202270, PMID:17496150, PMID:18178578, more ... RGD PMID:10811609|PMID:11689694|PMID:12504083|PMID:12847084|PMID:14561754|PMID:14988733|PMID:15215856|PMID:15723043|PMID:16525503|PMID:16709668|PMID:17202270|PMID:17496150|PMID:18178578|PMID:19805280|PMID:20691684|PMID:21070972|PMID:21600962|PMID:22232657|PMID:22773186|PMID:23055941|PMID:24160817|PMID:24424410|PMID:25009997|PMID:31073040 Vcp Rat protein domain specific binding enables ISO RGD:731621 1624291 UniProtKB:Q04323 PMID:15362974 RGD PMID:15362974 Vcp Rat protein domain specific binding enables IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat protein phosphatase binding enables ISO RGD:731621 1624291 UniProtKB:P26045 PMID:10364224 RGD PMID:10364224 Vcp Rat protein phosphatase binding enables IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat protein-containing complex binding IPI RGD:620794|RGD:619822 633500 RGD Vcp Rat ubiquitin protein ligase binding enables ISO RGD:731621 1624291 UniProtKB:Q86TM6 PMID:22590560 RGD PMID:22590560 Vcp Rat ubiquitin protein ligase binding enables IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat ubiquitin-like protein ligase binding enables ISO RGD:731621 1624291 UniProtKB:Q86TM6 PMID:16186510 RGD PMID:16186510 Vcp Rat ubiquitin-like protein ligase binding enables IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat ubiquitin-modified protein reader activity enables ISO RGD:731621 1624291 PMID:29033132, PMID:31387940, PMID:35013556 RGD PMID:29033132|PMID:31387940|PMID:35013556 Vcp Rat ubiquitin-modified protein reader activity enables IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat ubiquitin-specific protease binding enables ISO RGD:731621 1624291 UniProtKB:P54252|UniProtKB:Q9UHP3 PMID:22590560, PMID:22970133 RGD PMID:22590560|PMID:22970133 Vcp Rat ubiquitin-specific protease binding enables IEA UniProtKB:P55072|ensembl:ENSP00000351777 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Vcp Rat ubiquitin-specific protease binding enables ISO RGD:731622 1624291 UniProtKB:P54252 PMID:17000876 RGD PMID:17000876 Vcp Rat ubiquitin-specific protease binding enables IEA UniProtKB:Q01853|ensembl:ENSMUSP00000030164 1600115 GO_REF:0000107 Ensembl GO_REF:0000107
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2,4-trimethylbenzene (EXP) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 1H-pyrazole (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP,ISO) 2,5-hexanedione (EXP) 2,6-dinitrotoluene (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 4-phenylbutyric acid (EXP) 7,12-dimethyltetraphene (EXP) aflatoxin B1 (ISO) aristolochic acid A (ISO) Aroclor 1254 (EXP) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bortezomib (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) calcidiol (EXP) CB-5083 (ISO) ceruletide (EXP) chenodeoxycholic acid (ISO) chloropicrin (ISO) chloroquine (ISO) chlorpyrifos (ISO) chromium trinitrate (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) curcumin (ISO) cyclophosphamide (EXP) cyclosporin A (ISO) deoxycholic acid (ISO) diarsenic trioxide (ISO) dichlorine (EXP) diethylstilbestrol (ISO) endosulfan (EXP) enzyme inhibitor (ISO) epoxiconazole (ISO) ethanol (EXP,ISO) fenthion (ISO) fenvalerate (EXP) finasteride (EXP) flutamide (EXP) folic acid (ISO) FR900359 (ISO) furfural (ISO) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) hyaluronic acid (EXP) hydrazine (EXP) hydrogen peroxide (EXP) isoflavones (EXP) ivermectin (ISO) L-serine (ISO) lactacystin (ISO) lead(II) chloride (ISO) leflunomide (ISO) lipopolysaccharide (ISO) lovastatin (ISO) lycopene (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) naphthalene (ISO) nefazodone (EXP) NMS-873 (ISO) ochratoxin A (ISO) okadaic acid (ISO) ozone (EXP) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenethyl isothiocyanate (ISO) phenobarbital (EXP) piroxicam (ISO) potassium chromate (ISO) prostaglandin A1 (ISO) quartz (ISO) quercetin (ISO) resveratrol (ISO) rotenone (EXP,ISO) silicon dioxide (ISO) sirolimus (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) sodium dichromate (EXP,ISO) streptozocin (EXP) sulforaphane (ISO) sulindac (EXP) sunitinib (ISO) tamoxifen (ISO) taurine (ISO) temozolomide (ISO) testosterone enanthate (ISO) tetrachloromethane (EXP) thapsigargin (EXP) thimerosal (ISO) titanium dioxide (ISO) trichloroethene (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) valdecoxib (EXP) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO) warfarin (ISO)
Biological Process
aggresome assembly (IEA,ISO) ATP metabolic process (IEA,ISO) autophagosome maturation (IBA,IEA,ISO,ISS) autophagy (IEA,ISO,ISS) cellular response to arsenite ion (IEA,ISO,ISS) cellular response to heat (IEA,ISO,ISS) cellular response to misfolded protein (IEA,ISO) cellular response to stress (IEA) cytoplasm protein quality control (IEA,ISO) DNA damage response (IEA,ISO,ISS) DNA repair (IEA,ISS) double-strand break repair (IEA,ISO,ISS) endoplasmic reticulum stress-induced pre-emptive quality control (IEA,ISO,ISS) endoplasmic reticulum to Golgi vesicle-mediated transport (IMP) endosome to lysosome transport via multivesicular body sorting pathway (IEA,ISO,ISS) ERAD pathway (IDA,IEA,ISO,ISS) flavin adenine dinucleotide catabolic process (IEA,ISO) interstrand cross-link repair (ISS) macroautophagy (IEA,ISO,ISS) mitotic spindle disassembly (IBA) NADH metabolic process (IEA,ISO) negative regulation of hippo signaling (IEA,ISO) negative regulation of protein localization to chromatin (IEA,ISO) negative regulation of smoothened signaling pathway (IEA,ISO) obsolete positive regulation of Lys63-specific deubiquitinase activity (ISO) positive regulation of ATP biosynthetic process (IEA,ISO) positive regulation of canonical Wnt signaling pathway (IEA,ISO) positive regulation of mitochondrial membrane potential (IEA,ISO) positive regulation of non-canonical NF-kappaB signal transduction (IEA,ISO) positive regulation of oxidative phosphorylation (IEA,ISO) positive regulation of proteasomal ubiquitin-dependent protein catabolic process (IEA,ISO) positive regulation of protein catabolic process (IEA,ISO) positive regulation of protein K63-linked deubiquitination (IEA,ISO) positive regulation of protein-containing complex assembly (IEA,ISO) positive regulation of ubiquitin-dependent protein catabolic process (IMP) proteasomal protein catabolic process (IEA,ISO,ISS) proteasome-mediated ubiquitin-dependent protein catabolic process (IBA,IEA,ISO,ISS) protein ubiquitination (IEA,ISO,ISS) protein-DNA covalent cross-linking repair (IEA,ISO,ISS) regulation of aerobic respiration (IEA,ISO) regulation of protein localization to chromatin (IEA,ISO,ISS) regulation of synapse organization (IDA,IMP) retrograde protein transport, ER to cytosol (EXP,IBA,IEA,ISO) stress granule disassembly (IEA,ISO,ISS) translesion synthesis (IEA,ISO,ISS) ubiquitin-dependent protein catabolic process (IEA,ISO) viral genome replication (IEA,ISO)
Cellular Component
ATPase complex (IEA,ISO) ciliary basal body (IEA,ISO) cytoplasm (IEA,ISO,NAS) cytoplasmic stress granule (IEA,ISO,ISS) cytoplasmic ubiquitin ligase complex (ISO) cytosol (IBA,IDA,IEA,ISO) Derlin-1 retrotranslocation complex (IEA,ISO) endoplasmic reticulum (IEA,ISO) endoplasmic reticulum membrane (IEA,ISO) glutamatergic synapse (IDA,IMP) lipid droplet (IEA,ISO) nucleoplasm (IEA,ISO) nucleus (IBA,IEA,ISO) perinuclear region of cytoplasm (IEA,ISO) proteasome complex (IEA,ISO) protein-containing complex (IEA,ISO) site of double-strand break (IEA,ISO,ISS) synapse (IEA,ISO) VCP-NPL4-UFD1 AAA ATPase complex (EXP,IBA,IDA,IEA,ISO) VCP-NSFL1C complex (IEA,IPI,ISO)
Molecular Function
ADP binding (IEA,IMP,ISO) ATP binding (IDA,IEA,IMP,ISO) ATP hydrolysis activity (IBA,IDA,IEA,IMP,ISO) BAT3 complex binding (IEA,ISO) deubiquitinase activator activity (IEA,ISO) hydrolase activity (IEA) identical protein binding (IDA,IEA,IPI,ISO) K48-linked polyubiquitin modification-dependent protein binding (IEA,ISO) lipid binding (IEA) MHC class I protein binding (IEA,ISO) nucleotide binding (IEA) polyubiquitin modification-dependent protein binding (IBA,IEA,ISO) protein binding (IPI,ISO) protein domain specific binding (IEA,ISO) protein phosphatase binding (IEA,ISO) protein-containing complex binding (IPI) ubiquitin protein ligase binding (IEA,ISO) ubiquitin-like protein ligase binding (IEA,ISO) ubiquitin-modified protein reader activity (IEA,ISO) ubiquitin-specific protease binding (IEA,ISO)
1.
Involvement of the p97-Ufd1-Npl4 complex in the regulated endoplasmic reticulum-associated degradation of inositol 1,4,5-trisphosphate receptors.
Alzayady KJ, etal., J Biol Chem. 2005 Oct 14;280(41):34530-7. Epub 2005 Aug 15.
2.
Distinct conformations of the protein complex p97-Ufd1-Npl4 revealed by electron cryomicroscopy.
Bebeacua C, etal., Proc Natl Acad Sci U S A. 2012 Jan 24;109(4):1098-103. doi: 10.1073/pnas.1114341109. Epub 2012 Jan 9.
3.
Conformational changes in the AAA ATPase p97-p47 adaptor complex.
Beuron F, etal., EMBO J. 2006 May 3;25(9):1967-76. Epub 2006 Apr 6.
4.
Analysis of nucleotide binding to P97 reveals the properties of a tandem AAA hexameric ATPase.
Briggs LC, etal., J Biol Chem. 2008 May 16;283(20):13745-52. doi: 10.1074/jbc.M709632200. Epub 2008 Mar 10.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Isolation of a point-mutated p47 lacking binding affinity to p97ATPase.
Kaneko Y, etal., FEBS Lett. 2010 Sep 24;584(18):3873-7. doi: 10.1016/j.febslet.2010.07.061. Epub 2010 Aug 6.
8.
Functional ATPase activity of p97/valosin-containing protein (VCP) is required for the quality control of endoplasmic reticulum in neuronally differentiated mammalian PC12 cells.
Kobayashi T, etal., J Biol Chem 2002 Dec 6;277(49):47358-65.
9.
p47 is a cofactor for p97-mediated membrane fusion.
Kondo H, etal., Nature 1997 Jul 3;388(6637):75-8.
10.
A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways.
Meyer HH, etal., EMBO J 2000 May 15;19(10):2181-92.
11.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
12.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
14.
Double-strand break repair: 53BP1 comes into focus.
Panier S and Boulton SJ, Nat Rev Mol Cell Biol. 2014 Jan;15(1):7-18. doi: 10.1038/nrm3719. Epub 2013 Dec 11.
15.
Push back to respond better: regulatory inhibition of the DNA double-strand break response.
Panier S and Durocher D, Nat Rev Mol Cell Biol. 2013 Oct;14(10):661-72. doi: 10.1038/nrm3659. Epub 2013 Sep 4.
16.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
17.
GOA pipeline
RGD automated data pipeline
18.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
19.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
20.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
21.
SDF2L1 interacts with the ER-associated degradation machinery and retards the degradation of mutant proinsulin in pancreatic beta-cells.
Tiwari A, etal., J Cell Sci. 2013 May 1;126(Pt 9):1962-8. doi: 10.1242/jcs.117374. Epub 2013 Feb 26.
22.
Valosin-containing protein and neurofibromin interact to regulate dendritic spine density.
Wang HF, etal., J Clin Invest. 2011 Dec;121(12):4820-37. doi: 10.1172/JCI45677. Epub 2011 Nov 21.
23.
Inclusion body myopathy associated with Paget disease of bone and frontotemporal dementia is caused by mutant valosin-containing protein.
Watts GD, etal., Nat Genet. 2004 Apr;36(4):377-81. Epub 2004 Mar 21.
24.
Function of the p97-Ufd1-Npl4 complex in retrotranslocation from the ER to the cytosol: dual recognition of nonubiquitinated polypeptide segments and polyubiquitin chains.
Ye Y, etal., J Cell Biol. 2003 Jul 7;162(1):71-84.
25.
Isolation and characterization of the principal ATPase associated with transitional endoplasmic reticulum of rat liver.
Zhang L, etal., J Cell Biol 1994 Dec;127(6 Pt 2):1871-83.
Vcp (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 62,005,984 - 62,025,387 (-) NCBI GRCr8 mRatBN7.2 5 57,210,167 - 57,229,571 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 57,210,168 - 57,229,571 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 59,183,339 - 59,202,747 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 61,002,153 - 61,021,561 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 60,987,322 - 61,006,704 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 58,426,548 - 58,445,953 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 58,426,549 - 58,445,953 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 62,951,999 - 62,971,402 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 59,472,100 - 59,491,508 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 59,472,279 - 59,491,687 (-) NCBI Celera 5 55,799,589 - 55,818,873 (-) NCBI Celera Cytogenetic Map 5 q22 NCBI
VCP (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 35,056,064 - 35,072,625 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 35,053,928 - 35,072,668 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 35,056,061 - 35,072,622 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 35,046,560 - 35,062,564 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 35,046,560 - 35,062,564 NCBI Celera 9 34,988,041 - 35,004,706 (-) NCBI Celera Cytogenetic Map 9 p13.3 NCBI HuRef 9 35,011,651 - 35,028,327 (-) NCBI HuRef CHM1_1 9 35,055,907 - 35,072,605 (-) NCBI CHM1_1 T2T-CHM13v2.0 9 35,075,243 - 35,091,804 (-) NCBI T2T-CHM13v2.0
Vcp (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 42,979,964 - 43,000,507 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 42,979,963 - 43,000,507 (-) Ensembl GRCm39 Ensembl GRCm38 4 42,979,964 - 43,000,507 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 42,979,963 - 43,000,507 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 42,992,836 - 43,013,379 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 43,001,064 - 43,021,534 (-) NCBI MGSCv36 mm8 Celera 4 43,010,123 - 43,030,659 (-) NCBI Celera Cytogenetic Map 4 A5 NCBI cM Map 4 22.95 NCBI
Vcp (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955472 1,107,164 - 1,124,076 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955472 1,111,649 - 1,124,076 (+) NCBI ChiLan1.0 ChiLan1.0
VCP (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 89,517,045 - 89,533,247 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 89,522,985 - 89,539,187 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 34,907,147 - 34,923,227 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 35,712,937 - 35,729,588 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 35,712,937 - 35,729,588 (-) Ensembl panpan1.1 panPan2
VCP (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 51,636,986 - 51,651,749 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 51,637,411 - 51,651,714 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 50,205,792 - 50,220,556 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 52,702,444 - 52,717,215 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 52,702,830 - 52,724,878 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 51,246,536 - 51,261,297 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 51,231,677 - 51,246,443 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 51,933,494 - 51,948,301 (-) NCBI UU_Cfam_GSD_1.0
Vcp (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 166,538,385 - 166,554,770 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936524 3,085,500 - 3,102,466 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936524 3,085,959 - 3,102,461 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
VCP (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 235,851,206 - 235,869,634 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 235,854,532 - 235,869,712 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 263,379,929 - 263,394,992 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
VCP (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 45,545,139 - 45,560,702 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 45,545,507 - 45,563,380 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 42,661,397 - 42,677,470 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Vcp (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 306 Count of miRNA genes: 196 Interacting mature miRNAs: 222 Transcripts: ENSRNOT00000046102 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578776 Stresp18 Stress response QTL 18 2.9 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 5 27955440 72955440 Rat 1298067 Scl15 Serum cholesterol level QTL 15 4.8 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 33215665 78215665 Rat 1300115 Hrtrt7 Heart rate QTL 7 2.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 5 47869062 90099692 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1358353 Srcrtb2 Stress Responsive Cort Basal QTL 2 3.48 0.003 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 18873947 74251464 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 1598807 Glom12 Glomerulus QTL 12 2.7 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 33215665 78215665 Rat 1302786 Kidm8 Kidney mass QTL 8 28.15 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 33215665 78215665 Rat 6903292 Stl28 Serum triglyceride level QTL 28 2.6 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 5 28515489 73515489 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1578767 Stresp17 Stress response QTL 17 4.3 0.01 blood aldosterone amount (VT:0005346) plasma aldosterone level (CMO:0000551) 5 27955440 72955440 Rat 7411561 Bw134 Body weight QTL 134 24 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 49463600 94463600 Rat 1641922 Alcrsp8 Alcohol response QTL 8 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 5 35189153 68564008 Rat 2303615 Vencon7 Ventilatory control QTL 7 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 5 50983895 95983895 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 6903306 Scl35 Serum cholesterol QTL 35 2.6 0.0073 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 28515489 73515489 Rat 1576317 Eutr2 Estrogen induced uterine response QTL 2 0.01 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 34730116 104251008 Rat 7394712 Emca13 Estrogen-induced mammary cancer QTL 13 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 9823266 99753708 Rat 1331773 Scl26 Serum cholesterol level QTL 26 3.065 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 43726656 86724018 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 1331771 Rf35 Renal function QTL 35 4.36965 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 729470 86724018 Rat 61359 Eaex Experimental allergic encephalomyelitis QTL x 3 nervous system integrity trait (VT:0010566) post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422) 5 55715622 100715622 Rat 8662454 Vetf3 Vascular elastic tissue fragility QTL 3 27.4 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 5 2282226 69540447 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 9589025 Epfw7 Epididymal fat weight QTL 7 20.66 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 5 49463600 94463600 Rat 2303574 Gluco42 Glucose level QTL 42 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 53496719 98496719 Rat 1641903 Alcrsp3 Alcohol response QTL 3 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 12689285 57689285 Rat 1331756 Rf34 Renal function QTL 34 4.16275 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 1 90450412 Rat 8552954 Pigfal14 Plasma insulin-like growth factor 1 level QTL 14 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 21226744 66226744 Rat 2316959 Gluco59 Glucose level QTL 59 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 34944474 113558310 Rat 1600358 Mamtr5 Mammary tumor resistance QTL 5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 18873947 63873947 Rat
This gene Vcp is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000046102 ⟹ ENSRNOP00000040121
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 57,210,168 - 57,229,571 (-) Ensembl Rnor_6.0 Ensembl 5 58,426,549 - 58,445,953 (-) Ensembl
RefSeq Acc Id:
NM_053864 ⟹ NP_446316
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 62,005,984 - 62,025,387 (-) NCBI mRatBN7.2 5 57,210,167 - 57,229,571 (-) NCBI Rnor_6.0 5 58,426,548 - 58,445,953 (-) NCBI Rnor_5.0 5 62,951,999 - 62,971,402 (-) NCBI RGSC_v3.4 5 59,472,100 - 59,491,508 (-) RGD Celera 5 55,799,589 - 55,818,873 (-) RGD
Sequence:
GTCGCCTCTCGCGGATTAGGAGCTAGCGTCTCCCGCCCGCCTGCCGCCCCGGTGCCGCTGGGAGGAAGCGAGAGGGAGGCTGCCTGTGGGTTTGTCACTGCTGTTGCTCCTCCACCTGAGTGAGTCAA GCCCGGGCCTAGTCGGTCGCCTACCATTCTCGTAGCCGTTACCCTCAGGCCGCCACAGCCGCCGACCGGGAGAGGCGCGCGCCATGGCCTCTGGAGCCGATTCAAAAGGTGATGATTTATCAACAGCC ATTCTCAAACAGAAGAACCGTCCCAATCGGTTAATTGTTGATGAAGCCATCAATGAAGATAACAGTGTGGTGTCCTTGTCCCAGCCCAAGATGGATGAACTACAGTTGTTCAGAGGTGACACGGTGTT GCTAAAAGGAAAGAAGAGAAGGGAAGCTGTATGCATTGTTCTTTCTGATGACACGTGTTCTGATGAGAAGATTCGAATGAATAGAGTTGTTCGGAATAACCTCCGAGTTCGCCTAGGAGATGTCATCA GCATCCAGCCATGCCCTGATGTAAAGTATGGCAAACGTATCCATGTGCTACCCATTGATGACACAGTGGAAGGCATCACTGGCAATCTTTTTGAGGTATACCTTAAGCCGTACTTCCTGGAAGCATAT CGGCCCATCCGTAAAGGAGATATTTTCCTTGTCCGGGGTGGGATGCGTGCTGTGGAGTTCAAAGTAGTAGAGACAGATCCCAGCCCTTACTGTATTGTTGCTCCAGACACAGTGATCCACTGTGAGGG GGAGCCAATCAAGCGAGAGGATGAGGAGGAGTCCTTGAATGAAGTAGGCTATGATGACATCGGTGGTTGCAGGAAGCAGCTAGCTCAGATAAAGGAGATGGTGGAGCTGCCACTGAGACATCCTGCAC TCTTTAAGGCAATTGGTGTGAAGCCTCCTCGGGGAATCTTGCTATATGGACCTCCTGGGACAGGGAAAACCTTGATTGCCCGAGCTGTGGCAAATGAAACTGGAGCCTTCTTCTTTCTGATCAATGGT CCTGAAATCATGAGCAAATTGGCTGGTGAGTCTGAGAGCAACCTTCGTAAAGCCTTTGAGGAAGCTGAAAAGAATGCTCCTGCCATCATCTTCATCGACGAGCTTGATGCCATTGCACCCAAAAGAGA GAAAACTCACGGGGAAGTGGAGCGTCGCATCGTGTCTCAGTTGTTGACCCTTATGGATGGCCTAAAGCAGAGAGCACATGTGATAGTTATGGCAGCAACCAATAGACCCAACAGCATTGACCCAGCCC TACGGCGATTTGGTCGCTTTGACAGAGAGGTAGATATTGGAATCCCTGATGCTACAGGACGTTTGGAAATTCTTCAGATCCATACCAAGAACATGAAACTGGCAGATGATGTGGACTTGGAACAGGTA GCCAATGAGACTCATGGTCATGTGGGTGCTGACTTGGCAGCCCTGTGTTCAGAGGCTGCTCTACAGGCCATCCGGAAAAAAATGGACCTCATTGACCTAGAAGATGAGACCATTGACGCTGAGGTCAT GAATTCCCTGGCAGTTACTATGGATGACTTCCGGTGGGCCTTAAGTCAAAGCAACCCATCAGCACTTCGGGAAACTGTGGTAGAAGTGCCACAAGTAACCTGGGAAGACATTGGAGGCCTGGAGGATG TCAAACGGGAGCTTCAGGAGTTGGTTCAGTATCCTGTGGAGCATCCAGACAAATTCCTCAAATTTGGCATGACTCCTTCCAAAGGTGTTCTTTTCTATGGACCGCCTGGCTGTGGGAAAACCTTACTG GCCAAAGCCATTGCTAATGAATGCCAGGCTAACTTCATCTCCATCAAGGGTCCTGAGCTGCTTACCATGTGGTTTGGGGAATCTGAGGCCAATGTCAGGGAAATATTTGACAAGGCACGACAAGCTGC CCCCTGTGTACTCTTCTTTGATGAGTTAGATTCAATTGCCAAGGCTCGTGGTGGTAATATTGGAGATGGTGGTGGAGCTGCAGACCGAGTCATCAATCAGATCCTGACAGAAATGGATGGCATGTCCA CAAAAAAGAATGTGTTTATCATTGGAGCTACCAACCGGCCTGACATCATTGATCCTGCTATCCTAAGACCTGGCCGTCTTGATCAGCTCATTTATATCCCACTTCCTGATGAGAAGTCCCGTGTTGCC ATCCTAAAAGCCAATCTGCGAAAATCCCCAGTTGCCAAGGATGTGGATTTGGAGTTCTTGGCTAAGATGACTAATGGCTTTTCTGGAGCTGACCTGACAGAAATTTGCCAACGTGCTTGTAAACTAGC CATTCGTGAATCTATCGAGAGTGAGATTAGGCGAGAACGAGAGAGGCAGACAAATCCATCAGCTATGGAAGTAGAAGAGGATGATCCAGTGCCTGAGATCCGCAGAGATCACTTTGAGGAAGCCATGC GTTTTGCCCGACGTTCTGTCAGTGATAATGACATTCGGAAGTATGAAATGTTTGCCCAGACACTGCAGCAAAGTCGAGGTTTTGGCAGCTTCAGATTCCCTTCAGGGAACCAGGGTGGAGCTGGCCCA AGTCAGGGCAGTGGAGGTGGCACAGGTGGCAATGTGTACACAGAAGACAATGACGATGACCTCTATGGCTAAGTGATGTGCCAGCATGCAGCGAGCTGGCCTGGCTGGACCTTGTTCCCTGGGGGTGG GGGCGCTCGCCCAATGGGAACCAGGGGTGTGCCCATGGCCTGTTCCATTCCTCAGTCCGAACAGTTCAGCCCCAGTCAGACTCTGGACAGGGGTTTTCTGTTGCAAAAAAAAATTACAAAAGCGATAA AATAAAAGTGATTTTCATTTGGGAGGTGAAGAGTGAATTACCAGCAAGGAGCTGGGCCTTGGGCCCTCACCATTTCTGTTGTAGTTTGGGTGGTGCAGGTAACCTGTGTGGTGTGAACCGAGGCGCTG CCCCCACCATCACCACAGTAAAGCATCTATACTCAATGCTGTCCAAGCCCTCCCTTACCTCTAGCCAGCCTGGGTAGGTGGACAAGGGGCCTCAGTTTGCTGGGTGTTTATATAGAAAGTAGGTTGAT TTTTATTTTACATGCTTTTGAGTTACTGTTGGAAGACTAATCATAAGCAGTTTCTAAACCAAAAAAAAAAAAAAAAAAAAAAGACATGTTGTAAAAGGATAATAAATGTTGGGTCAAAATGGAAAAAA AAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_446316 ⟸ NM_053864
- UniProtKB:
P46462 (UniProtKB/Swiss-Prot), A6IIZ6 (UniProtKB/TrEMBL), A6IIZ7 (UniProtKB/TrEMBL)
- Sequence:
MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITG NLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIAR AVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIH TKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSK GVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLD QLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGF GSFRFPSGNQGGAGPSQGSGGGTGGNVYTEDNDDDLYG
hide sequence
Ensembl Acc Id:
ENSRNOP00000040121 ⟸ ENSRNOT00000046102
RGD ID: 13693667
Promoter ID: EPDNEW_R4192
Type: initiation region
Name: Vcp_1
Description: valosin-containing protein
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 58,445,989 - 58,446,049 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-07-08
Vcp
valosin-containing protein
Symbol and Name status set to approved
1299863
APPROVED
2002-08-07
Vcp
valosin-containing protein
Symbol and Name status set to provisional
70820
PROVISIONAL
Note Type
Note
Reference
gene_domains
contains two conserved ATPase domains (D1 and D2)
727438
gene_process
may be important for degrading membrane-associated ubiquitinated proteins in the endoplasmic reticulum
727438