Symbol:
Ubb
Name:
ubiquitin B
RGD ID:
621562
Description:
Predicted to enable protein tag activity and ubiquitin protein ligase binding activity. Predicted to be involved in modification-dependent protein catabolic process; positive regulation of protein monoubiquitination; and protein ubiquitination. Predicted to act upstream of or within several processes, including gonad development; meiosis I; and neuron development. Predicted to be located in mitochondrion; neuron projection; and neuronal cell body. Predicted to be active in cytoplasm and nucleus. Orthologous to human UBB (ubiquitin B); PARTICIPATES IN Parkinson's disease pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Loc192255; polyubiquitin; polyubiquitin-B; UBC; ubiquitin; ubiquitin C
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
UBB (ubiquitin B) RGD
RGD
Mus musculus (house mouse):
Ubb (ubiquitin B) RGD
RGD
Pan paniscus (bonobo/pygmy chimpanzee):
UBB (ubiquitin B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
UBB (ubiquitin B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ubb (ubiquitin B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
UBB (ubiquitin B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
UBB (ubiquitin B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ubb (ubiquitin B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
UBB (ubiquitin B)
Alliance
DIOPT (Ensembl Compara|HGNC|InParanoid|OMA)
Mus musculus (house mouse):
Ubb (ubiquitin B)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:ch211-202a12.4
Alliance
DIOPT (Ensembl Compara|OMA)
Drosophila melanogaster (fruit fly):
CG11700
Alliance
DIOPT (Ensembl Compara|OMA)
Saccharomyces cerevisiae (baker's yeast):
UBI4
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA)
Related Pseudogenes:
Ubb-ps1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 47,746,923 - 47,748,628 (+) NCBI GRCr8 mRatBN7.2 10 47,247,630 - 47,249,335 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 47,245,637 - 47,249,333 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 51,951,219 - 51,952,925 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 51,441,764 - 51,443,470 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 46,945,175 - 46,946,881 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 48,880,231 - 48,881,896 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 48,881,049 - 48,881,881 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 48,664,227 - 48,665,056 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.1 10 48,752,613 - 48,753,069 NCBI Celera 10 46,494,897 - 46,496,578 (+) NCBI Celera Cytogenetic Map 10 q23 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ubb Rat (1->4)-beta-D-glucan multiple interactions ISO Ubb (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of UBB mRNA CTD PMID:36331819 Ubb Rat (S)-nicotine multiple interactions ISO Ubb (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Ubb Rat 1,2-dimethylhydrazine multiple interactions ISO Ubb (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of UBB mRNA CTD PMID:22206623 Ubb Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases expression ISO Ubb (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Ubb Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Ubb (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Ubb Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of UBB mRNA CTD PMID:29097150 Ubb Rat 17beta-estradiol increases expression ISO UBB (Homo sapiens) 6480464 Estradiol results in increased expression of UBB mRNA CTD PMID:11179685 and PMID:20106945 Ubb Rat 17beta-estradiol decreases expression ISO Ubb (Mus musculus) 6480464 Estradiol results in decreased expression of UBB mRNA CTD PMID:39298647 Ubb Rat 17beta-estradiol decreases expression ISO UBB (Homo sapiens) 6480464 Estradiol results in decreased expression of UBB mRNA CTD PMID:23019147 Ubb Rat 17beta-estradiol multiple interactions ISO UBB (Homo sapiens) 6480464 3 more ... CTD PMID:11179685 Ubb Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Ubb (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Ubb Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ubb (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of UBB mRNA CTD PMID:21570461 Ubb Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of UBB mRNA CTD PMID:33387578 Ubb Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO UBB (Homo sapiens) 6480464 Tetrachlorodibenzodioxin inhibits the reaction [Estradiol results in increased expression of UBB mRNA] CTD PMID:11179685 Ubb Rat 3,3'-diindolylmethane multiple interactions ISO UBB (Homo sapiens) 6480464 3 and 3'-diindolylmethane promotes the reaction [Estradiol results in increased expression of UBB mRNA] CTD PMID:11179685 Ubb Rat 4,4'-diaminodiphenylmethane increases expression ISO Ubb (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of UBB mRNA CTD PMID:18648102 Ubb Rat 4-hydroperoxycyclophosphamide decreases expression ISO Ubb (Mus musculus) 6480464 perfosfamide results in decreased expression of UBB mRNA CTD PMID:19429390 Ubb Rat acrylamide increases expression ISO UBB (Homo sapiens) 6480464 Acrylamide results in increased expression of UBB mRNA CTD PMID:32763439 Ubb Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of UBB mRNA CTD PMID:16483693 Ubb Rat antimycin A increases expression ISO UBB (Homo sapiens) 6480464 Antimycin A results in increased expression of UBB mRNA CTD PMID:33512557 Ubb Rat aristolochic acid A increases expression ISO UBB (Homo sapiens) 6480464 aristolochic acid I results in increased expression of UBB mRNA CTD PMID:33212167 Ubb Rat Aroclor 1254 decreases expression ISO Ubb (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of UBB mRNA CTD PMID:23650126 Ubb Rat arsenite(3-) multiple interactions ISO UBB (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to UBB mRNA] CTD PMID:32406909 Ubb Rat astaxanthin multiple interactions ISO Ubb (Mus musculus) 6480464 astaxanthine inhibits the reaction [LEPR gene mutant form results in increased expression of UBB mRNA] CTD PMID:16964424 Ubb Rat Azaspiracid increases expression ISO UBB (Homo sapiens) 6480464 azaspiracid results in increased expression of UBB mRNA CTD PMID:28939011 Ubb Rat azoxystrobin multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of UBB mRNA CTD PMID:33854195 Ubb Rat benzo[a]pyrene increases methylation ISO UBB (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of UBB 5' UTR CTD PMID:27901495 Ubb Rat benzo[b]fluoranthene increases expression ISO Ubb (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of UBB mRNA CTD PMID:26377693 Ubb Rat beta-lapachone increases expression ISO UBB (Homo sapiens) 6480464 beta-lapachone results in increased expression of UBB mRNA CTD PMID:38218311 Ubb Rat bis(2-ethylhexyl) phthalate increases expression ISO Ubb (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of UBB mRNA CTD PMID:33754040 Ubb Rat bisphenol A increases expression ISO UBB (Homo sapiens) 6480464 bisphenol A results in increased expression of UBB mRNA CTD PMID:15223131 Ubb Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of UBB mRNA CTD PMID:30903817 Ubb Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of UBB mRNA CTD PMID:30816183 Ubb Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of UBB mRNA CTD PMID:25181051 and PMID:34947998 Ubb Rat cadmium atom increases expression ISO UBB (Homo sapiens) 6480464 Cadmium results in increased expression of UBB mRNA CTD PMID:23369406 Ubb Rat cadmium dichloride increases expression ISO UBB (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of UBB mRNA CTD PMID:26558471 and PMID:38568856 Ubb Rat cadmium sulfate increases expression ISO UBB (Homo sapiens) 6480464 cadmium sulfate results in increased expression of UBB mRNA CTD PMID:12064557 more ... Ubb Rat caffeine multiple interactions ISO Ubb (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Ubb Rat calcium atom affects expression EXP 6480464 Calcium affects the expression of UBB mRNA CTD PMID:15913539 Ubb Rat calcium(0) affects expression EXP 6480464 Calcium affects the expression of UBB mRNA CTD PMID:15913539 Ubb Rat cannabidiol increases expression ISO UBB (Homo sapiens) 6480464 Cannabidiol results in increased expression of UBB mRNA CTD PMID:28025562 and PMID:31801206 Ubb Rat carbon nanotube affects expression ISO UBB (Homo sapiens) 6480464 Nanotubes and Carbon affects the expression of UBB protein CTD PMID:22001959 Ubb Rat carbon nanotube increases expression ISO Ubb (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Ubb Rat chloropicrin increases expression ISO UBB (Homo sapiens) 6480464 chloropicrin results in increased expression of UBB mRNA CTD PMID:26352163 Ubb Rat chlorpyrifos multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of UBB mRNA CTD PMID:33854195 Ubb Rat chlorpyrifos increases expression ISO Ubb (Mus musculus) 6480464 Chlorpyrifos results in increased expression of UBB mRNA CTD PMID:37019170 Ubb Rat cisplatin increases expression ISO Ubb (Mus musculus) 6480464 Cisplatin results in increased expression of UBB mRNA CTD PMID:32738330 Ubb Rat cisplatin increases expression ISO UBB (Homo sapiens) 6480464 Cisplatin results in increased expression of UBB mRNA CTD PMID:38498338 Ubb Rat cisplatin decreases expression ISO UBB (Homo sapiens) 6480464 Cisplatin results in decreased expression of UBB protein CTD PMID:20540955 Ubb Rat cobalt dichloride increases expression ISO UBB (Homo sapiens) 6480464 cobaltous chloride results in increased expression of UBB mRNA CTD PMID:17553155 and PMID:19320972 Ubb Rat copper(II) sulfate affects expression ISO UBB (Homo sapiens) 6480464 Copper Sulfate affects the expression of UBB mRNA CTD PMID:19549813 Ubb Rat corosolic acid increases expression ISO UBB (Homo sapiens) 6480464 corosolic acid results in increased expression of UBB mRNA and corosolic acid results in increased expression of UBB protein CTD PMID:37939859 Ubb Rat cyclosporin A increases expression ISO UBB (Homo sapiens) 6480464 Cyclosporine results in increased expression of UBB mRNA CTD PMID:20106945 Ubb Rat cypermethrin decreases expression EXP 6480464 cypermethrin results in decreased expression of UBB mRNA CTD PMID:22528246 Ubb Rat cyproconazole increases expression ISO Ubb (Mus musculus) 6480464 cyproconazole results in increased expression of UBB mRNA CTD PMID:22334560 Ubb Rat dinophysistoxin 1 increases expression ISO UBB (Homo sapiens) 6480464 dinophysistoxin 1 results in increased expression of UBB mRNA CTD PMID:28939011 Ubb Rat diuron decreases expression ISO UBB (Homo sapiens) 6480464 Diuron results in decreased expression of UBB mRNA CTD PMID:35967413 Ubb Rat doxorubicin increases expression ISO UBB (Homo sapiens) 6480464 Doxorubicin results in increased expression of UBB mRNA CTD PMID:29803840 Ubb Rat enzalutamide affects expression ISO UBB (Homo sapiens) 6480464 enzalutamide affects the expression of UBB mRNA CTD PMID:30940724 Ubb Rat epoxiconazole increases expression ISO Ubb (Mus musculus) 6480464 epoxiconazole results in increased expression of UBB mRNA CTD PMID:22334560 Ubb Rat ethanol affects expression ISO Ubb (Mus musculus) 6480464 Ethanol affects the expression of UBB mRNA CTD PMID:30319688 Ubb Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of UBB mRNA CTD PMID:34044035 Ubb Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of UBB mRNA CTD PMID:18035473 Ubb Rat folic acid multiple interactions ISO Ubb (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of UBB mRNA CTD PMID:22206623 Ubb Rat FR900359 increases phosphorylation ISO UBB (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of UBB protein CTD PMID:37730182 Ubb Rat gallic acid decreases expression ISO UBB (Homo sapiens) 6480464 Gallic Acid results in decreased expression of UBB mRNA CTD PMID:34408198 Ubb Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of UBB mRNA CTD PMID:33387578 Ubb Rat glyphosate multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of UBB mRNA CTD PMID:33854195 Ubb Rat imidacloprid multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of UBB mRNA CTD PMID:33854195 Ubb Rat inulin multiple interactions ISO Ubb (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of UBB mRNA CTD PMID:36331819 Ubb Rat isoprenaline increases expression ISO Ubb (Mus musculus) 6480464 Isoproterenol results in increased expression of UBB mRNA CTD PMID:21335049 Ubb Rat Licochalcone B increases expression ISO UBB (Homo sapiens) 6480464 licochalcone B results in increased expression of UBB mRNA CTD PMID:33647349 Ubb Rat maneb multiple interactions ISO Ubb (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of UBB mRNA more ... CTD PMID:23963992 Ubb Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of UBB mRNA CTD PMID:20737472 Ubb Rat melatonin multiple interactions ISO Ubb (Mus musculus) 6480464 Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in decreased expression of UBB mRNA] CTD PMID:23963992 Ubb Rat menadione affects expression ISO UBB (Homo sapiens) 6480464 Vitamin K 3 affects the expression of UBB mRNA CTD PMID:20044591 Ubb Rat methylisothiazolinone increases expression ISO UBB (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of UBB mRNA CTD PMID:31629900 Ubb Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO UBB (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [[PARK protein co-treated with UBB protein] results in decreased expression of FIS1 protein] CTD PMID:20164189 Ubb Rat nickel atom multiple interactions ISO Ubb (Mus musculus) 6480464 MT1 affects the reaction [Nickel affects the expression of UBB mRNA] and MT2 affects the reaction [Nickel affects the expression of UBB mRNA] CTD PMID:16166738 Ubb Rat nicotine multiple interactions ISO Ubb (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Ubb Rat ochratoxin A decreases expression ISO UBB (Homo sapiens) 6480464 ochratoxin A metabolite results in decreased expression of UBB mRNA and ochratoxin A results in decreased expression of UBB mRNA CTD PMID:26314263 Ubb Rat ozone increases expression EXP 6480464 Ozone results in increased expression of UBB mRNA CTD PMID:16330353 Ubb Rat paracetamol affects expression ISO Ubb (Mus musculus) 6480464 Acetaminophen affects the expression of UBB mRNA CTD PMID:17562736 Ubb Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of UBB mRNA CTD PMID:33387578 Ubb Rat paracetamol decreases expression ISO UBB (Homo sapiens) 6480464 Acetaminophen results in decreased expression of UBB mRNA CTD PMID:38614205 Ubb Rat paracetamol increases expression ISO UBB (Homo sapiens) 6480464 Acetaminophen results in increased expression of UBB mRNA CTD PMID:26690555 Ubb Rat paracetamol increases expression ISO Ubb (Mus musculus) 6480464 Acetaminophen results in increased expression of UBB protein CTD PMID:21329376 Ubb Rat paraquat increases expression ISO UBB (Homo sapiens) 6480464 Paraquat results in increased expression of UBB mRNA CTD PMID:26409479 Ubb Rat paraquat multiple interactions ISO Ubb (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of UBB mRNA more ... CTD PMID:23963992 Ubb Rat pentachlorophenol increases expression ISO Ubb (Mus musculus) 6480464 Pentachlorophenol results in increased expression of UBB mRNA CTD PMID:23892564 Ubb Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ubb (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of UBB mRNA more ... CTD PMID:36331819 Ubb Rat phlorizin increases expression ISO Ubb (Mus musculus) 6480464 Phlorhizin results in increased expression of UBB mRNA CTD PMID:22538082 Ubb Rat propiconazole increases expression ISO Ubb (Mus musculus) 6480464 propiconazole results in increased expression of UBB mRNA CTD PMID:21278054 and PMID:22334560 Ubb Rat pyrimidifen increases expression ISO UBB (Homo sapiens) 6480464 pyrimidifen results in increased expression of UBB mRNA CTD PMID:33512557 Ubb Rat pyrogallol increases expression ISO Ubb (Mus musculus) 6480464 Pyrogallol results in increased expression of UBB mRNA CTD PMID:20362636 Ubb Rat quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of UBB protein CTD PMID:18095365 Ubb Rat raloxifene affects expression EXP 6480464 Raloxifene Hydrochloride affects the expression of UBB mRNA CTD PMID:16079270 Ubb Rat resveratrol affects expression EXP 6480464 resveratrol affects the expression of UBB mRNA CTD PMID:15748624 Ubb Rat rotenone increases expression ISO UBB (Homo sapiens) 6480464 Rotenone results in increased expression of UBB mRNA CTD PMID:33512557 Ubb Rat silicon dioxide increases expression ISO UBB (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of UBB mRNA CTD PMID:25351596 Ubb Rat sodium arsenite increases expression ISO UBB (Homo sapiens) 6480464 sodium arsenite results in increased expression of UBB mRNA CTD PMID:38568856 Ubb Rat sunitinib decreases expression ISO UBB (Homo sapiens) 6480464 Sunitinib results in decreased expression of UBB mRNA CTD PMID:31533062 Ubb Rat tebufenpyrad increases expression ISO UBB (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in increased expression of UBB mRNA CTD PMID:33512557 Ubb Rat thiabendazole multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of UBB mRNA CTD PMID:33854195 Ubb Rat thifluzamide increases expression ISO UBB (Homo sapiens) 6480464 thifluzamide results in increased expression of UBB mRNA CTD PMID:33512557 Ubb Rat titanium dioxide decreases methylation ISO Ubb (Mus musculus) 6480464 titanium dioxide results in decreased methylation of UBB promoter CTD PMID:35295148 Ubb Rat toluene affects expression EXP 6480464 Toluene affects the expression of UBB mRNA CTD PMID:21827849 Ubb Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of UBB mRNA CTD PMID:33387578 Ubb Rat valproic acid affects expression ISO Ubb (Mus musculus) 6480464 Valproic Acid affects the expression of UBB mRNA CTD PMID:17292431
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3'-diindolylmethane (ISO) 4,4'-diaminodiphenylmethane (ISO) 4-hydroperoxycyclophosphamide (ISO) acrylamide (ISO) ammonium chloride (EXP) antimycin A (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsenite(3-) (ISO) astaxanthin (ISO) Azaspiracid (ISO) azoxystrobin (EXP) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) cadmium sulfate (ISO) caffeine (ISO) calcium atom (EXP) calcium(0) (EXP) cannabidiol (ISO) carbon nanotube (ISO) chloropicrin (ISO) chlorpyrifos (EXP,ISO) cisplatin (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) corosolic acid (ISO) cyclosporin A (ISO) cypermethrin (EXP) cyproconazole (ISO) dinophysistoxin 1 (ISO) diuron (ISO) doxorubicin (ISO) enzalutamide (ISO) epoxiconazole (ISO) ethanol (ISO) fipronil (EXP) flavonoids (EXP) folic acid (ISO) FR900359 (ISO) gallic acid (ISO) gentamycin (EXP) glyphosate (EXP) imidacloprid (EXP) inulin (ISO) isoprenaline (ISO) Licochalcone B (ISO) maneb (ISO) manganese(II) chloride (EXP) melatonin (ISO) menadione (ISO) methylisothiazolinone (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) nickel atom (ISO) nicotine (ISO) ochratoxin A (ISO) ozone (EXP) paracetamol (EXP,ISO) paraquat (ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) phlorizin (ISO) propiconazole (ISO) pyrimidifen (ISO) pyrogallol (ISO) quercetin (EXP) raloxifene (EXP) resveratrol (EXP) rotenone (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sunitinib (ISO) tebufenpyrad (ISO) thiabendazole (EXP) thifluzamide (ISO) titanium dioxide (ISO) toluene (EXP) trichloroethene (EXP) valproic acid (ISO)
Biological Process
adipose tissue development (IEA,ISO) energy homeostasis (IEA,ISO) fat pad development (IEA,ISO) female gonad development (IEA,ISO) female meiosis I (IEA,ISO) hypothalamus gonadotrophin-releasing hormone neuron development (IEA,ISO) male gonad development (IEA,ISO) male meiosis I (IEA,ISO) mitochondrion transport along microtubule (IEA,ISO) modification-dependent protein catabolic process (IBA) neuron projection morphogenesis (IEA,ISO) positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator (IEA,ISO) positive regulation of protein monoubiquitination (IEA,ISO) positive regulation of protein ubiquitination (IEA,ISO) protein ubiquitination (IBA) regulation of mitochondrial membrane potential (IEA,ISO) regulation of neuron apoptotic process (IEA,ISO) regulation of proteasomal protein catabolic process (IEA,ISO) seminiferous tubule development (IEA,ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Nucleotide sequence and expression of the rat polyubiquitin mRNA.
Hayashi T, etal., Biochim Biophys Acta 1994 Jun 21;1218(2):232-4.
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.
Gene expressions of ubiquitin and hsp70 following focal ischaemia in rat brain.
Noga M, etal., Neuroreport 1997 Mar 24;8(5):1239-41.
6.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
7.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
8.
GOA pipeline
RGD automated data pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Ubb Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 47,746,923 - 47,748,628 (+) NCBI GRCr8 mRatBN7.2 10 47,247,630 - 47,249,335 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 47,245,637 - 47,249,333 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 51,951,219 - 51,952,925 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 51,441,764 - 51,443,470 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 46,945,175 - 46,946,881 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 48,880,231 - 48,881,896 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 48,881,049 - 48,881,881 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 48,664,227 - 48,665,056 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.1 10 48,752,613 - 48,753,069 NCBI Celera 10 46,494,897 - 46,496,578 (+) NCBI Celera Cytogenetic Map 10 q23 NCBI
UBB Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 16,380,779 - 16,382,745 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 16,380,798 - 16,382,745 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 16,284,093 - 16,286,059 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 16,225,092 - 16,226,779 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 16,225,091 - 16,226,779 NCBI Celera 17 16,187,292 - 16,188,979 (+) NCBI Celera Cytogenetic Map 17 p11.2 NCBI HuRef 17 16,150,949 - 16,152,636 (+) NCBI HuRef CHM1_1 17 16,294,106 - 16,295,793 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 16,283,097 - 16,285,063 (+) NCBI T2T-CHM13v2.0
Ubb Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 62,442,329 - 62,444,037 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 62,441,997 - 62,444,039 (+) Ensembl GRCm39 Ensembl GRCm38 11 62,551,171 - 62,553,213 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 62,551,171 - 62,553,213 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 62,365,006 - 62,366,714 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 62,367,697 - 62,369,407 (+) NCBI MGSCv36 mm8 Celera 11 69,470,925 - 69,472,633 (+) NCBI Celera Cytogenetic Map 11 B2 NCBI cM Map 11 38.46 NCBI
UBB Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 56,252,196 - 56,254,227 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 61,063,907 - 61,065,938 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 35,286,699 - 35,288,429 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 110,578,715 - 110,580,217 (+) NCBI panpan1.1 PanPan1.1 panPan2
UBB Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 39,533,365 - 39,535,120 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 39,511,426 - 39,535,815 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 39,679,659 - 39,681,890 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 39,643,511 - 39,645,744 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 39,640,787 - 39,645,440 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 39,615,228 - 39,617,465 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 39,560,488 - 39,562,718 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 39,752,689 - 39,754,922 (-) NCBI UU_Cfam_GSD_1.0
Ubb
UBB Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 59,171,289 - 59,172,841 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 59,171,258 - 59,172,841 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 62,297,981 - 62,299,561 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
UBB
Ubb
.
Predicted Target Of
Count of predictions: 146 Count of miRNA genes: 115 Interacting mature miRNAs: 120 Transcripts: ENSRNOT00000066885 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 1354614 Hpcl1 Hepatic cholesterol level QTL 1 3.3 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 35392267 51793994 Rat 631532 Cm50 Cardiac mass QTL 50 6.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 17907113 51786432 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1600371 Mcs21 Mammary carcinoma susceptibility QTL 21 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 28875650 52200160 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000066885
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 10 48,881,049 - 48,881,881 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000117146 ⟹ ENSRNOP00000086005
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 47,245,637 - 47,249,333 (+) Ensembl
RefSeq Acc Id:
NM_001409092 ⟹ NP_001396021
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 47,747,181 - 47,748,628 (+) NCBI mRatBN7.2 10 47,247,888 - 47,249,335 (+) NCBI
RefSeq Acc Id:
NM_138895 ⟹ NP_620250
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 47,746,923 - 47,748,628 (+) NCBI mRatBN7.2 10 47,247,630 - 47,249,335 (+) NCBI Rnor_6.0 10 48,880,231 - 48,881,896 (+) NCBI Rnor_5.0 10 48,664,227 - 48,665,056 (+) NCBI RGSC_v3.4 10 139,578,694 - 139,579,068 (+) RGD Celera 10 46,494,897 - 46,496,578 (+) NCBI
Sequence:
TCAGTGACGAGAGGCTTTGTCCGGTTCCGAGGTCTTTCTGTGAGGGTGTTTCGACGCGCTGGGCGGTTTGTTCCTTCATCGCATTCGTTAACAGGTCAAAATGCAAATCTTCGTGAAGACCCTGACCG
hide sequence
RefSeq Acc Id:
NP_620250 ⟸ NM_138895
- Peptide Label:
precursor
- UniProtKB:
P0CG51 (UniProtKB/Swiss-Prot), A6J0W7 (UniProtKB/TrEMBL)
- Sequence:
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTVKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLED
hide sequence
Ensembl Acc Id:
ENSRNOP00000086005 ⟸ ENSRNOT00000117146
RefSeq Acc Id:
NP_001396021 ⟸ NM_001409092
- UniProtKB:
P0CG51 (UniProtKB/Swiss-Prot), A6J0W7 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-02-25
Ubb
ubiquitin B
Ubb
polyubiquitin
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Ubb
polyubiquitin
Loc192255
Symbol and Name updated
1299863 APPROVED
2002-08-07
Loc192255
polyubiquitin
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_regulation
mRNA highly induced following ischaemia in the central zone of the middle cerebral artery (MCA)
724407
