Symbol:
Nln
Name:
neurolysin
RGD ID:
621518
Description:
Enables metalloendopeptidase activity and oligopeptidase activity. Involved in peptide catabolic process and protein catabolic process. Is active in mitochondrial intermembrane space. Orthologous to human NLN (neurolysin); PARTICIPATES IN renin-angiotensin cascade pathway; INTERACTS WITH 1,10-phenanthroline; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MEP; microsomal endopeptidase; mitochondrial oligopeptidase M; neurolysin (metallopeptidase M3 family); neurolysin, mitochondrial; neurotensin endopeptidase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NLN (neurolysin) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Nln (neurolysin (metallopeptidase M3 family)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nln (neurolysin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NLN (neurolysin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NLN (neurolysin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nln (neurolysin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NLN (neurolysin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NLN (neurolysin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nln (neurolysin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
NLN (neurolysin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Nln (neurolysin (metallopeptidase M3 family))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nln (neurolysin (metallopeptidase M3 family))
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
PRD1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
nln
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 36,867,436 - 36,966,749 (-) NCBI GRCr8 mRatBN7.2 2 35,133,634 - 35,232,927 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 35,134,145 - 35,232,914 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 42,248,083 - 42,345,656 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 40,306,773 - 40,404,352 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 35,163,341 - 35,261,069 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 34,086,970 - 34,185,835 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 34,087,880 - 34,185,812 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 53,215,233 - 53,314,136 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 34,915,111 - 35,031,566 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 34,835,479 - 34,951,935 (-) NCBI Celera 2 31,110,866 - 31,209,296 (-) NCBI Celera Cytogenetic Map 2 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nln Rat (1->4)-beta-D-glucan multiple interactions ISO Nln (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NLN mRNA CTD PMID:36331819 Nln Rat 1,10-phenanthroline decreases activity EXP 9831155 1 and 10-phenanthroline decreases activity of Nln protein RGD Nln Rat 17beta-estradiol increases expression ISO NLN (Homo sapiens) 6480464 Estradiol results in increased expression of NLN mRNA CTD PMID:31614463 Nln Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO NLN (Homo sapiens) 6480464 Metribolone results in increased expression of NLN protein CTD PMID:17152098 Nln Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Nln (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NLN mRNA CTD PMID:21570461 Nln Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NLN mRNA CTD PMID:33387578 Nln Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NLN mRNA CTD PMID:34747641 Nln Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of NLN mRNA CTD PMID:21346803 Nln Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Nln (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Nln Rat 3,4-methylenedioxymethamphetamine increases expression ISO Nln (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of NLN mRNA CTD PMID:26251327 Nln Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of NLN protein CTD PMID:34915118 Nln Rat 4,4'-sulfonyldiphenol increases expression ISO NLN (Homo sapiens) 6480464 bisphenol S results in increased expression of NLN protein CTD PMID:34186270 Nln Rat 4-hydroxyphenyl retinamide decreases expression ISO Nln (Mus musculus) 6480464 Fenretinide results in decreased expression of NLN mRNA CTD PMID:28973697 Nln Rat 4-phenylbutyric acid decreases expression ISO NLN (Homo sapiens) 6480464 4-phenylbutyric acid results in decreased expression of NLN mRNA CTD PMID:14583596 Nln Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of NLN mRNA CTD PMID:24780913 Nln Rat acrolein multiple interactions ISO NLN (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of NLN mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of NLN mRNA CTD PMID:32699268 Nln Rat acrylamide decreases expression ISO NLN (Homo sapiens) 6480464 Acrylamide results in decreased expression of NLN mRNA CTD PMID:32763439 Nln Rat aflatoxin B1 decreases methylation ISO NLN (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of NLN intron CTD PMID:30157460 Nln Rat all-trans-retinoic acid decreases expression ISO NLN (Homo sapiens) 6480464 Tretinoin results in decreased expression of NLN mRNA CTD PMID:33167477 Nln Rat alpha-pinene multiple interactions ISO NLN (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of NLN mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of NLN mRNA CTD PMID:32699268 Nln Rat aristolochic acid A decreases expression ISO NLN (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of NLN mRNA CTD PMID:33212167 Nln Rat arsane multiple interactions ISO NLN (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NLN mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of NLN mRNA CTD PMID:39836092 Nln Rat arsenic atom multiple interactions ISO NLN (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NLN mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of NLN mRNA CTD PMID:39836092 Nln Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of NLN gene CTD PMID:28931070 Nln Rat benzo[a]pyrene increases expression ISO Nln (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of NLN mRNA CTD PMID:22228805 Nln Rat benzo[a]pyrene increases methylation ISO Nln (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of NLN intron CTD PMID:27901495 Nln Rat benzo[a]pyrene increases expression ISO NLN (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of NLN mRNA CTD PMID:26238291 Nln Rat bis(2-ethylhexyl) phthalate increases expression ISO Nln (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of NLN mRNA CTD PMID:19850644 Nln Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Nln (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of NLN mRNA] CTD PMID:19850644 Nln Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NLN mRNA CTD PMID:25181051 more ... Nln Rat bisphenol A decreases expression ISO NLN (Homo sapiens) 6480464 bisphenol A results in decreased expression of NLN protein CTD PMID:37567409 Nln Rat bisphenol F increases expression ISO NLN (Homo sapiens) 6480464 bisphenol F results in increased expression of NLN protein CTD PMID:34186270 Nln Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of NLN mRNA CTD PMID:24136188 Nln Rat cadmium dichloride decreases expression ISO NLN (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of NLN mRNA CTD PMID:38568856 Nln Rat carbon nanotube increases expression ISO Nln (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of NLN mRNA CTD PMID:25620056 Nln Rat chromium(6+) affects expression ISO Nln (Mus musculus) 6480464 chromium hexavalent ion affects the expression of NLN mRNA CTD PMID:28472532 Nln Rat cobalt dichloride decreases expression ISO NLN (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of NLN mRNA CTD PMID:19320972 Nln Rat cyclosporin A decreases expression ISO NLN (Homo sapiens) 6480464 Cyclosporine results in decreased expression of NLN mRNA CTD PMID:27989131 Nln Rat dextran sulfate decreases expression ISO Nln (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of NLN protein CTD PMID:32272095 Nln Rat dextran sulfate multiple interactions ISO Nln (Mus musculus) 6480464 Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of NLN protein] CTD PMID:32272095 Nln Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of NLN mRNA CTD PMID:21266533 Nln Rat dorsomorphin multiple interactions ISO NLN (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Nln Rat doxorubicin decreases expression ISO NLN (Homo sapiens) 6480464 Doxorubicin results in decreased expression of NLN mRNA CTD PMID:29803840 Nln Rat EDTA(2-) decreases activity EXP 9831155 EDTA decreases activity of Nln protein RGD Nln Rat entinostat increases expression ISO NLN (Homo sapiens) 6480464 entinostat results in increased expression of NLN mRNA CTD PMID:26272509 Nln Rat entinostat multiple interactions ISO NLN (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NLN mRNA CTD PMID:27188386 Nln Rat ethanol affects expression ISO Nln (Mus musculus) 6480464 Ethanol affects the expression of NLN mRNA CTD PMID:30319688 Nln Rat ethyl methanesulfonate decreases expression ISO NLN (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of NLN mRNA CTD PMID:23649840 Nln Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of NLN mRNA CTD PMID:34044035 Nln Rat formaldehyde increases expression ISO NLN (Homo sapiens) 6480464 Formaldehyde results in increased expression of NLN mRNA CTD PMID:23649840 Nln Rat genistein decreases expression ISO NLN (Homo sapiens) 6480464 Genistein results in decreased expression of NLN protein CTD PMID:20884965 Nln Rat genistein multiple interactions ISO NLN (Homo sapiens) 6480464 ESR1 promotes the reaction [Genistein results in decreased expression of NLN protein] CTD PMID:20884965 Nln Rat inulin multiple interactions ISO Nln (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of NLN mRNA CTD PMID:36331819 Nln Rat ivermectin decreases expression ISO NLN (Homo sapiens) 6480464 Ivermectin results in decreased expression of NLN protein CTD PMID:32959892 Nln Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of NLN mRNA CTD PMID:20080153 Nln Rat manganese atom multiple interactions ISO NLN (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NLN mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of NLN mRNA CTD PMID:39836092 Nln Rat manganese(0) multiple interactions ISO NLN (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NLN mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of NLN mRNA CTD PMID:39836092 Nln Rat manganese(II) chloride multiple interactions ISO NLN (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NLN mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of NLN mRNA CTD PMID:39836092 Nln Rat mercury dibromide increases expression ISO NLN (Homo sapiens) 6480464 mercuric bromide results in increased expression of NLN mRNA CTD PMID:26272509 Nln Rat mercury dibromide multiple interactions ISO NLN (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NLN mRNA CTD PMID:27188386 Nln Rat methyl methanesulfonate decreases expression ISO NLN (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of NLN mRNA CTD PMID:23649840 Nln Rat methylmercury chloride increases expression ISO NLN (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of NLN mRNA CTD PMID:23179753 more ... Nln Rat methylmercury chloride multiple interactions ISO NLN (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NLN mRNA CTD PMID:27188386 Nln Rat nickel atom increases expression ISO NLN (Homo sapiens) 6480464 Nickel results in increased expression of NLN mRNA CTD PMID:24768652 Nln Rat nickel atom decreases expression ISO NLN (Homo sapiens) 6480464 Nickel results in decreased expression of NLN mRNA CTD PMID:23195993 Nln Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of NLN mRNA CTD PMID:25729387 Nln Rat ozone multiple interactions ISO NLN (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of NLN mRNA more ... CTD PMID:32699268 Nln Rat paracetamol affects expression ISO Nln (Mus musculus) 6480464 Acetaminophen affects the expression of NLN mRNA CTD PMID:17562736 Nln Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of NLN mRNA CTD PMID:33387578 Nln Rat paracetamol decreases expression ISO NLN (Homo sapiens) 6480464 Acetaminophen results in decreased expression of NLN mRNA CTD PMID:21420995 and PMID:25704631 Nln Rat pentachlorophenol increases expression ISO Nln (Mus musculus) 6480464 Pentachlorophenol results in increased expression of NLN mRNA CTD PMID:23892564 Nln Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Nln (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NLN mRNA more ... CTD PMID:36331819 Nln Rat perfluorooctanoic acid increases expression ISO NLN (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of NLN protein CTD PMID:26879310 Nln Rat phenobarbital multiple interactions ISO Nln (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of NLN mRNA] CTD PMID:19482888 Nln Rat phenobarbital increases expression ISO Nln (Mus musculus) 6480464 Phenobarbital results in increased expression of NLN mRNA CTD PMID:19482888 Nln Rat pirinixic acid multiple interactions ISO Nln (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of NLN mRNA CTD PMID:19710929 Nln Rat pirinixic acid increases expression ISO Nln (Mus musculus) 6480464 pirinixic acid results in increased expression of NLN mRNA CTD PMID:17426115 more ... Nln Rat resveratrol multiple interactions ISO NLN (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of NLN mRNA CTD PMID:23557933 Nln Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of NLN protein CTD PMID:35544339 Nln Rat SB 431542 multiple interactions ISO NLN (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Nln Rat sodium arsenite decreases expression ISO NLN (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NLN mRNA CTD PMID:38568856 Nln Rat sodium arsenite multiple interactions ISO NLN (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NLN mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of NLN mRNA CTD PMID:39836092 Nln Rat sodium fluoride increases expression ISO Nln (Mus musculus) 6480464 Sodium Fluoride results in increased expression of NLN protein CTD PMID:28918527 Nln Rat succimer multiple interactions ISO Nln (Mus musculus) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of NLN mRNA CTD PMID:26378955 Nln Rat sunitinib increases expression ISO NLN (Homo sapiens) 6480464 Sunitinib results in increased expression of NLN mRNA CTD PMID:31533062 Nln Rat tetrachloromethane decreases expression ISO Nln (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of NLN mRNA CTD PMID:31919559 Nln Rat titanium dioxide decreases methylation ISO Nln (Mus musculus) 6480464 titanium dioxide results in decreased methylation of NLN gene CTD PMID:35295148 Nln Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of NLN mRNA CTD PMID:25729387 Nln Rat trichloroethene affects expression ISO Nln (Mus musculus) 6480464 Trichloroethylene affects the expression of NLN mRNA CTD PMID:21135412 Nln Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of NLN mRNA CTD PMID:33387578 Nln Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of NLN gene CTD PMID:27618143 Nln Rat trichostatin A increases expression ISO NLN (Homo sapiens) 6480464 trichostatin A results in increased expression of NLN mRNA CTD PMID:24935251 and PMID:26272509 Nln Rat trichostatin A multiple interactions ISO NLN (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NLN mRNA CTD PMID:27188386 Nln Rat trimellitic anhydride increases expression ISO Nln (Mus musculus) 6480464 trimellitic anhydride results in increased expression of NLN mRNA CTD PMID:19042947 Nln Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of NLN mRNA CTD PMID:30589522 Nln Rat tunicamycin decreases expression ISO NLN (Homo sapiens) 6480464 Tunicamycin results in decreased expression of NLN mRNA CTD PMID:22378314 Nln Rat urethane decreases expression ISO NLN (Homo sapiens) 6480464 Urethane results in decreased expression of NLN mRNA CTD PMID:28818685 Nln Rat valproic acid affects expression ISO Nln (Mus musculus) 6480464 Valproic Acid affects the expression of NLN mRNA CTD PMID:17292431 Nln Rat valproic acid increases expression ISO Nln (Mus musculus) 6480464 Valproic Acid results in increased expression of NLN mRNA CTD PMID:21427059 Nln Rat valproic acid affects expression ISO NLN (Homo sapiens) 6480464 Valproic Acid affects the expression of NLN mRNA CTD PMID:25979313 Nln Rat valproic acid decreases methylation ISO NLN (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of NLN gene CTD PMID:29154799 Nln Rat valproic acid increases expression ISO NLN (Homo sapiens) 6480464 Valproic Acid results in increased expression of NLN mRNA CTD PMID:24383497 more ... Nln Rat valproic acid multiple interactions ISO NLN (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NLN mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,10-phenanthroline (EXP) 17beta-estradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 3,3',4,4'-tetrachlorobiphenyl (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 4-phenylbutyric acid (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) atrazine (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buspirone (EXP) cadmium dichloride (ISO) carbon nanotube (ISO) chromium(6+) (ISO) cobalt dichloride (ISO) cyclosporin A (ISO) dextran sulfate (ISO) dibutyl phthalate (EXP) dorsomorphin (ISO) doxorubicin (ISO) EDTA(2-) (EXP) entinostat (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) fipronil (EXP) formaldehyde (ISO) genistein (ISO) inulin (ISO) ivermectin (ISO) ketamine (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury dibromide (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) nickel atom (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) resveratrol (ISO) rotenone (EXP) SB 431542 (ISO) sodium arsenite (ISO) sodium fluoride (ISO) succimer (ISO) sunitinib (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP,ISO) trichostatin A (ISO) trimellitic anhydride (ISO) triphenyl phosphate (EXP) tunicamycin (ISO) urethane (ISO) valproic acid (ISO)
1.
Molecular cloning and expression of rat brain endopeptidase 3.4.24.16.
Dauch P, etal., J Biol Chem 1995 Nov 10;270(45):27266-71.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.
Metalloendopeptidases EC 3.4.24.15/16 regulate bradykinin activity in the cerebral microvasculature.
Norman MU, etal., Am J Physiol Heart Circ Physiol 2003 Jun;284(6):H1942-8. Epub 2003 Feb 13.
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
Mapping sequence differences between thimet oligopeptidase and neurolysin implicates key residues in substrate recognition.
Ray K, etal., Protein Sci 2002 Sep;11(9):2237-46.
8.
GOA pipeline
RGD automated data pipeline
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Novel natural peptide substrates for endopeptidase 24.15, neurolysin, and angiotensin-converting enzyme.
Rioli V, etal., J Biol Chem. 2003 Mar 7;278(10):8547-55. doi: 10.1074/jbc.M212030200. Epub 2002 Dec 24.
11.
Characterization of a mitochondrial metallopeptidase reveals neurolysin as a homologue of thimet oligopeptidase.
Serizawa A, etal., J Biol Chem. 1995 Feb 3;270(5):2092-8.
12.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Nln Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 36,867,436 - 36,966,749 (-) NCBI GRCr8 mRatBN7.2 2 35,133,634 - 35,232,927 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 35,134,145 - 35,232,914 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 42,248,083 - 42,345,656 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 40,306,773 - 40,404,352 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 35,163,341 - 35,261,069 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 34,086,970 - 34,185,835 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 34,087,880 - 34,185,812 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 53,215,233 - 53,314,136 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 34,915,111 - 35,031,566 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 34,835,479 - 34,951,935 (-) NCBI Celera 2 31,110,866 - 31,209,296 (-) NCBI Celera Cytogenetic Map 2 q13 NCBI
NLN Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 65,722,205 - 65,829,283 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 65,722,205 - 65,871,725 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 65,018,032 - 65,125,111 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 65,053,841 - 65,155,149 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 65,053,840 - 65,155,143 NCBI Celera 5 62,016,491 - 62,123,591 (+) NCBI Celera Cytogenetic Map 5 q12.3 NCBI HuRef 5 61,976,109 - 62,083,226 (+) NCBI HuRef CHM1_1 5 65,017,717 - 65,124,844 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 66,543,992 - 66,651,091 (+) NCBI T2T-CHM13v2.0
Nln Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 104,159,558 - 104,246,170 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 104,159,565 - 104,246,122 (-) Ensembl GRCm39 Ensembl GRCm38 13 104,023,050 - 104,109,673 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 104,023,057 - 104,109,614 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 104,813,519 - 104,899,694 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 105,143,604 - 105,229,957 (-) NCBI MGSCv36 mm8 Celera 13 108,414,173 - 108,500,684 (-) NCBI Celera Cytogenetic Map 13 D1 NCBI cM Map 13 56.16 NCBI
Nln Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955446 3,256,078 - 3,374,462 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955446 3,258,278 - 3,374,337 (-) NCBI ChiLan1.0 ChiLan1.0
NLN Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 48,098,743 - 48,198,296 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 46,242,006 - 46,351,916 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 48,180,768 - 48,283,281 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 49,834,121 - 49,938,192 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 49,840,482 - 49,938,192 (-) Ensembl panpan1.1 panPan2
NLN Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 51,445,941 - 51,551,425 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 51,444,566 - 51,538,028 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 48,400,415 - 48,494,439 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 51,935,923 - 52,030,529 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 51,935,938 - 52,041,328 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 48,995,440 - 49,095,747 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 49,784,767 - 49,878,766 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 50,676,985 - 50,771,434 (+) NCBI UU_Cfam_GSD_1.0
Nln Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 194,447,083 - 194,544,535 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936480 3,383,540 - 3,481,009 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936480 3,383,514 - 3,480,991 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NLN Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 44,225,677 - 44,334,610 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 44,225,706 - 44,333,623 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 47,574,962 - 47,681,332 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NLN Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 61,918,079 - 62,022,517 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 61,918,137 - 62,016,144 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666049 10,561,550 - 10,666,098 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nln
.
Predicted Target Of
Count of predictions: 86 Count of miRNA genes: 65 Interacting mature miRNAs: 78 Transcripts: ENSRNOT00000066925 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10755430 Coatc6 Coat color QTL 6 0.02576 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 11591100 56591100 Rat 7387318 Stl32 Serum triglyceride level QTL 32 3.2 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 22384627 67384627 Rat 10755436 Coatc8 Coat color QTL 8 0.02431 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 35023117 80023117 Rat 631682 Bp115 Blood pressure QTL 115 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 1 37410502 Rat 10755434 Coatc7 Coat color QTL 7 0.04794 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 30648065 75648065 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 738010 Lnnr3 Liver neoplastic nodule remodeling QTL 3 2.94 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 2 1 41244106 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300160 Hrtrt3 Heart rate QTL 3 3.62 heart pumping trait (VT:2000009) absolute change in heart rate (CMO:0000534) 2 29971593 51729300 Rat 731167 Glom4 Glomerulus QTL 4 2.4 0.0082 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 2 20304672 65304672 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 738012 Anxrr3 Anxiety related response QTL 3 3.8 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 2 9023519 54023519 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 10402051 Gdil2 Gastrointestinal dilation QTL 2 enteric ganglion morphology trait (VT:0001045) length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836) 2 24903853 74786777 Rat 9590095 Sffal3 Serum free fatty acids level QTL 3 6.78 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 2 27157160 72157160 Rat 1331764 Bp205 Blood pressure QTL 205 3.476 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 26999571 43154682 Rat 731179 Mamtr3 Mammary tumor resistance QTL 3 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 32373770 43665178 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1600379 Mcs18 Mammary carcinoma susceptibility QTL 18 2.6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 7887772 42804738 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1643006 Pain1 Pain QTL 1 3.63 0.005 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 2 26999571 48268661 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat 2300168 Bmd47 Bone mineral density QTL 47 6.6 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 2 20662448 65662448 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1354617 Bp240 Blood pressure QTL 240 4 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 81754745 Rat 1578664 Bmd9 Bone mineral QTL density 9 5 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 11852062 49003364 Rat 1357990 Ael1 Aortic elastin QTL 1 3.1 0.00091 aorta elastin amount (VT:0003905) aortic elastin 2 19076825 64076825 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 731184 Mamtr4 Mammary tumor resistance QTL 4 0.0003 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 16491740 61491740 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 61371 Edpm1 Estrogen-dependent pituitary mass QTL 1 4 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 35134841 88029593 Rat 1354603 Bp243 Blood pressure QTL 243 3.9 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 127469484 Rat
D2Mgh1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 36,868,643 - 36,868,772 (+) Marker Load Pipeline mRatBN7.2 2 35,134,841 - 35,134,970 (+) MAPPER mRatBN7.2 Rnor_6.0 2 34,088,175 - 34,088,303 NCBI Rnor6.0 Rnor_5.0 2 53,216,438 - 53,216,566 UniSTS Rnor5.0 RGSC_v3.4 2 34,914,943 - 34,915,072 RGD RGSC3.4 RGSC_v3.4 2 34,914,944 - 34,915,072 UniSTS RGSC3.4 RGSC_v3.1 2 34,835,312 - 34,835,441 RGD Celera 2 31,110,695 - 31,110,827 UniSTS RH 3.4 Map 2 126.7 UniSTS RH 3.4 Map 2 126.7 RGD RH 2.0 Map 2 189.6 RGD SHRSP x BN Map 2 15.0498 RGD FHH x ACI Map 2 23.0699 RGD Cytogenetic Map 2 q13 UniSTS
RH132947
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 35,231,684 - 35,232,738 (+) MAPPER mRatBN7.2 Rnor_6.0 2 34,184,591 - 34,185,644 NCBI Rnor6.0 Rnor_5.0 2 53,312,891 - 53,313,944 UniSTS Rnor5.0 RGSC_v3.4 2 35,030,475 - 35,031,528 UniSTS RGSC3.4 Celera 2 31,208,205 - 31,209,258 UniSTS RH 3.4 Map 2 139.8 UniSTS Cytogenetic Map 2 q13 UniSTS
BM382907
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 35,135,013 - 35,135,165 (+) MAPPER mRatBN7.2 Rnor_6.0 2 34,088,347 - 34,088,498 NCBI Rnor6.0 Rnor_5.0 2 53,216,610 - 53,216,761 UniSTS Rnor5.0 RGSC_v3.4 2 34,915,116 - 34,915,267 UniSTS RGSC3.4 Celera 2 31,110,871 - 31,111,022 UniSTS RH 3.4 Map 2 123.4 UniSTS Cytogenetic Map 2 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000066925 ⟹ ENSRNOP00000059652
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 35,135,300 - 35,232,914 (-) Ensembl Rnor_6.0 Ensembl 2 34,088,342 - 34,185,682 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000082755 ⟹ ENSRNOP00000069520
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 35,134,145 - 35,197,739 (-) Ensembl Rnor_6.0 Ensembl 2 34,087,880 - 34,185,812 (-) Ensembl
RefSeq Acc Id:
NM_053970 ⟹ NP_446422
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 36,868,811 - 36,966,572 (-) NCBI mRatBN7.2 2 35,135,009 - 35,232,776 (-) NCBI Rnor_6.0 2 34,088,342 - 34,185,682 (-) NCBI Rnor_5.0 2 53,215,233 - 53,314,136 (-) NCBI RGSC_v3.4 2 34,915,111 - 35,031,566 (-) RGD Celera 2 31,110,866 - 31,209,296 (-) RGD
Sequence:
GACGCGCCAGCTGCTGCCGGCCTCCCGGCGTGCCCATGATCACCCTGTGCCTTTCGACTCTGCGAGGCCTCCACAGAGCTGGTGGCTCCAGGCTTCAGCTGACAATGACACTGGGAAAGGAGCTGGCT
hide sequence
RefSeq Acc Id:
XM_006231880 ⟹ XP_006231942
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 36,869,341 - 36,966,729 (-) NCBI mRatBN7.2 2 35,135,539 - 35,232,925 (-) NCBI Rnor_6.0 2 34,097,165 - 34,185,835 (-) NCBI Rnor_5.0 2 53,215,233 - 53,314,136 (-) NCBI
Sequence:
CCACGGCGTAGGCGTGGGCCTGAAGCACGTGGGAGGGCGCTGGCAGGACTGACGGCCTCCGTCT
hide sequence
RefSeq Acc Id:
XM_039101583 ⟹ XP_038957511
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 36,867,436 - 36,966,749 (-) NCBI mRatBN7.2 2 35,133,634 - 35,232,925 (-) NCBI
RefSeq Acc Id:
XM_039101584 ⟹ XP_038957512
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 36,867,436 - 36,966,717 (-) NCBI mRatBN7.2 2 35,133,637 - 35,232,926 (-) NCBI
RefSeq Acc Id:
XM_039101585 ⟹ XP_038957513
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 36,885,894 - 36,966,729 (-) NCBI mRatBN7.2 2 35,153,414 - 35,232,927 (-) NCBI
RefSeq Acc Id:
XM_063281171 ⟹ XP_063137241
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 36,884,537 - 36,966,729 (-) NCBI
RefSeq Acc Id:
XR_005500227
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 36,869,338 - 36,966,729 (-) NCBI mRatBN7.2 2 35,135,536 - 35,232,925 (-) NCBI
RefSeq Acc Id:
NP_446422 ⟸ NM_053970
- Peptide Label:
precursor
- UniProtKB:
Q6GQQ4 (UniProtKB/Swiss-Prot), P42676 (UniProtKB/Swiss-Prot), A0A0G2JSY3 (UniProtKB/TrEMBL), A6I5E6 (UniProtKB/TrEMBL)
- Sequence:
MITLCLSTLRGLHRAGGSRLQLTMTLGKELASPLQAMSSYTAAGRNVLRWDLSPEQIKTRTEQLIAQTKQVYDTVGTIALKEVTYENCLQVLADIEVTYIVERTMLDFPQHVSSDREVRAASTEADKR
hide sequence
RefSeq Acc Id:
XP_006231942 ⟸ XM_006231880
- Peptide Label:
isoform X3
- UniProtKB:
Q6GQQ4 (UniProtKB/Swiss-Prot), P42676 (UniProtKB/Swiss-Prot)
- Sequence:
MITLCLSTLRGLHRAGGSRLQLTMTLGKELASPLQAMSSYTAAGRNVLRWDLSPEQIKTRTEQL
hide sequence
Ensembl Acc Id:
ENSRNOP00000069520 ⟸ ENSRNOT00000082755
Ensembl Acc Id:
ENSRNOP00000059652 ⟸ ENSRNOT00000066925
RefSeq Acc Id:
XP_038957511 ⟸ XM_039101583
- Peptide Label:
isoform X1
- UniProtKB:
Q6GQQ4 (UniProtKB/Swiss-Prot), P42676 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038957512 ⟸ XM_039101584
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2JVK4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038957513 ⟸ XM_039101585
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063137241 ⟸ XM_063281171
- Peptide Label:
isoform X5
RGD ID: 13691119 Promoter ID: EPDNEW_R1644 Type: initiation region Name: Nln_1 Description: neurolysin SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 34,185,744 - 34,185,804 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-03
Nln
neurolysin
Nln
neurolysin (metallopeptidase M3 family)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Nln
neurolysin (metallopeptidase M3 family)
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Nln
neurolysin (metallopeptidase M3 family)
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed in brain, ileum, kidney, and testis
729279
gene_protein
704-amino acid protein
729279
