Symbol:
Mapk7
Name:
mitogen-activated protein kinase 7
RGD ID:
621505
Description:
Enables ATP binding activity and MAP kinase activity. Involved in ERK5 cascade; negative regulation of smooth muscle cell apoptotic process; and protein autophosphorylation. Predicted to be located in PML body and cytosol. Predicted to be active in cytoplasm and nucleus. Orthologous to human MAPK7 (mitogen-activated protein kinase 7); PARTICIPATES IN Erk5 MAPK signaling pathway; altered Erk5 MAPK signaling pathway; gonadotropin-releasing hormone signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; Alisol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
big MAP kinase 1; BMK-1; Bmk1; BMK1 kinase; ERK-5; Erk5; extracellular signal-regulated kinase 5; LOC100912585; MAP kinase 7; MAPK 7; mitogen-activated protein kinase 7-like; Prkm7
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 46,669,721 - 46,675,768 (-) NCBI GRCr8 mRatBN7.2 10 46,170,264 - 46,176,262 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 46,170,167 - 46,176,267 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 50,873,542 - 50,878,848 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 50,364,065 - 50,369,371 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 45,867,492 - 45,872,798 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 47,768,592 - 47,775,130 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 47,766,680 - 47,775,055 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 49,002,126 - 49,009,156 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 47,541,086 - 47,547,066 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 47,649,203 - 47,654,316 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 47,662,825 - 47,664,689 (-) NCBI Celera 10 45,422,029 - 45,427,142 (-) NCBI Celera Cytogenetic Map 10 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mapk7 Rat 1,2-dimethylhydrazine decreases expression ISO Mapk7 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of MAPK7 mRNA CTD PMID:22206623 Mapk7 Rat 17alpha-ethynylestradiol affects expression ISO Mapk7 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of MAPK7 mRNA CTD PMID:17555576 Mapk7 Rat 17alpha-ethynylestradiol multiple interactions ISO Mapk7 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MAPK7 mRNA CTD PMID:17942748 Mapk7 Rat 17alpha-ethynylestradiol increases expression ISO Mapk7 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of MAPK7 mRNA CTD PMID:17942748 Mapk7 Rat 17beta-estradiol decreases expression ISO MAPK7 (Homo sapiens) 6480464 Estradiol results in decreased expression of MAPK7 mRNA CTD PMID:23094148 Mapk7 Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Mapk7 (Mus musculus) 6480464 2 more ... CTD PMID:23564643 Mapk7 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO MAPK7 (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin co-treated with Cycloheximide] results in increased expression of MAPK7 mRNA and Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of MAPK7 mRNA] CTD PMID:11007951 and PMID:19684285 Mapk7 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MAPK7 mRNA CTD PMID:33387578 Mapk7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mapk7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MAPK7 mRNA CTD PMID:24680724 Mapk7 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Mapk7 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MAPK7 mRNA and Tetrachlorodibenzodioxin affects the reaction [AHR protein binds to MAPK7 promoter] CTD PMID:17942748 and PMID:19654925 Mapk7 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO MAPK7 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of MAPK7 mRNA CTD PMID:11007951 and PMID:19684285 Mapk7 Rat 2-hydroxypropanoic acid decreases expression ISO MAPK7 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of MAPK7 mRNA CTD PMID:30851411 Mapk7 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO MAPK7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MAPK7 mRNA CTD PMID:28628672 Mapk7 Rat 4,4'-sulfonyldiphenol decreases expression ISO Mapk7 (Mus musculus) 6480464 bisphenol S results in decreased expression of MAPK7 mRNA CTD PMID:39298647 Mapk7 Rat 4-hydroxyphenyl retinamide multiple interactions ISO MAPK7 (Homo sapiens) 6480464 [IL24 protein co-treated with Fenretinide] results in increased phosphorylation of MAPK7 protein CTD PMID:15580305 Mapk7 Rat 5-fluorouracil multiple interactions ISO MAPK7 (Homo sapiens) 6480464 [BIX 02188 results in decreased activity of MAPK7] which results in increased susceptibility to Fluorouracil CTD PMID:22008504 Mapk7 Rat 5-fluorouracil decreases response to substance ISO MAPK7 (Homo sapiens) 6480464 MAPK7 results in decreased susceptibility to Fluorouracil CTD PMID:22008504 Mapk7 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of MAPK7 mRNA CTD PMID:24780913 Mapk7 Rat aflatoxin B1 decreases methylation ISO MAPK7 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of MAPK7 polyA tail CTD PMID:30157460 Mapk7 Rat Alisol A multiple interactions EXP 6480464 [alisol A co-treated with alisol A 24-acetate co-treated with alisol B co-treated with alisol B 23-acetate co-treated with alisol C 23-acetate co-treated with alisol F co-treated with alisol F 24-acetate] results in increased expression of MAPK7 mRNA CTD PMID:33035272 Mapk7 Rat Alisol B multiple interactions EXP 6480464 [alisol A co-treated with alisol A 24-acetate co-treated with alisol B co-treated with alisol B 23-acetate co-treated with alisol C 23-acetate co-treated with alisol F co-treated with alisol F 24-acetate] results in increased expression of MAPK7 mRNA CTD PMID:33035272 Mapk7 Rat Alisol C 23-acetate multiple interactions EXP 6480464 [alisol A co-treated with alisol A 24-acetate co-treated with alisol B co-treated with alisol B 23-acetate co-treated with alisol C 23-acetate co-treated with alisol F co-treated with alisol F 24-acetate] results in increased expression of MAPK7 mRNA CTD PMID:33035272 Mapk7 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MAPK7 mRNA CTD PMID:16483693 Mapk7 Rat ammonium chloride decreases expression EXP 6480464 Ammonium Chloride results in decreased expression of MAPK7 protein CTD PMID:16483693 Mapk7 Rat aprepitant multiple interactions EXP 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Aprepitant inhibits the reaction [Rotenone results in decreased phosphorylation of MAPK7 protein]] and Aprepitant inhibits the reaction [Rotenone results in decreased phosphorylation of MAPK7 protein] CTD PMID:37224993 Mapk7 Rat arecoline increases phosphorylation EXP 6480464 Arecoline results in increased phosphorylation of MAPK7 protein CTD PMID:34999050 Mapk7 Rat arsane affects methylation ISO MAPK7 (Homo sapiens) 6480464 Arsenic affects the methylation of MAPK7 gene CTD PMID:25304211 Mapk7 Rat arsenic atom affects methylation ISO MAPK7 (Homo sapiens) 6480464 Arsenic affects the methylation of MAPK7 gene CTD PMID:25304211 Mapk7 Rat arsenite(3-) decreases phosphorylation ISO Mapk7 (Mus musculus) 6480464 arsenite results in decreased phosphorylation of MAPK7 protein CTD PMID:25145660 Mapk7 Rat arsenite(3-) multiple interactions ISO Mapk7 (Mus musculus) 6480464 arsenite inhibits the reaction [TGFB2 protein results in increased localization of MAPK7 protein] CTD PMID:25145660 Mapk7 Rat arsenous acid multiple interactions ISO MAPK7 (Homo sapiens) 6480464 [IL24 protein co-treated with Arsenic Trioxide] results in increased phosphorylation of MAPK7 protein CTD PMID:15580305 Mapk7 Rat arsenous acid decreases activity ISO Mapk7 (Mus musculus) 6480464 Arsenic Trioxide results in decreased activity of MAPK7 protein CTD PMID:15761769 Mapk7 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of MAPK7 gene CTD PMID:28931070 Mapk7 Rat atrazine increases expression EXP 6480464 Atrazine results in increased expression of MAPK7 mRNA CTD PMID:36841081 Mapk7 Rat benzo[a]pyrene multiple interactions ISO Mapk7 (Mus musculus) 6480464 Benzo(a)pyrene affects the reaction [AHR protein binds to MAPK7 promoter] CTD PMID:19654925 Mapk7 Rat benzo[a]pyrene increases expression ISO MAPK7 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of MAPK7 mRNA CTD PMID:32234424 Mapk7 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MAPK7 mRNA CTD PMID:34947998 Mapk7 Rat bisphenol F multiple interactions ISO MAPK7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MAPK7 mRNA CTD PMID:28628672 Mapk7 Rat cadmium dichloride multiple interactions ISO MAPK7 (Homo sapiens) 6480464 BIX 02189 inhibits the reaction [Cadmium Chloride results in increased phosphorylation of MAPK7 protein] CTD PMID:22521884 Mapk7 Rat cadmium dichloride decreases expression ISO MAPK7 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of MAPK7 mRNA CTD PMID:38568856 Mapk7 Rat cadmium dichloride increases expression ISO MAPK7 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of MAPK7 mRNA CTD PMID:12160620 and PMID:32512071 Mapk7 Rat cadmium dichloride increases phosphorylation ISO MAPK7 (Homo sapiens) 6480464 Cadmium Chloride results in increased phosphorylation of MAPK7 protein CTD PMID:22521884 Mapk7 Rat caffeine affects phosphorylation ISO MAPK7 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of MAPK7 protein CTD PMID:35688186 Mapk7 Rat capsaicin increases phosphorylation EXP 6480464 Capsaicin results in increased phosphorylation of MAPK7 protein CTD PMID:17237256 Mapk7 Rat chlorpyrifos increases expression ISO Mapk7 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of MAPK7 mRNA CTD PMID:37019170 Mapk7 Rat cisplatin multiple interactions ISO MAPK7 (Homo sapiens) 6480464 [BIX 02188 results in decreased activity of MAPK7] which results in increased susceptibility to Cisplatin CTD PMID:22008504 Mapk7 Rat cisplatin decreases response to substance ISO MAPK7 (Homo sapiens) 6480464 MAPK7 results in decreased susceptibility to Cisplatin CTD PMID:22008504 Mapk7 Rat cobalt dichloride increases expression ISO MAPK7 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of MAPK7 mRNA CTD PMID:19320972 Mapk7 Rat copper atom multiple interactions ISO MAPK7 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of MAPK7 mRNA CTD PMID:30911355 Mapk7 Rat copper(0) multiple interactions ISO MAPK7 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of MAPK7 mRNA CTD PMID:30911355 Mapk7 Rat crocidolite asbestos increases phosphorylation ISO Mapk7 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased phosphorylation of MAPK7 protein CTD PMID:14737115 Mapk7 Rat crocidolite asbestos multiple interactions ISO Mapk7 (Mus musculus) 6480464 AG 1879 inhibits the reaction [Asbestos more ... CTD PMID:14737115 Mapk7 Rat cycloheximide multiple interactions ISO MAPK7 (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin co-treated with Cycloheximide] results in increased expression of MAPK7 mRNA and Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of MAPK7 mRNA] CTD PMID:11007951 and PMID:19684285 Mapk7 Rat cycloheximide increases expression ISO MAPK7 (Homo sapiens) 6480464 Cycloheximide results in increased expression of MAPK7 mRNA CTD PMID:19684285 Mapk7 Rat cyclophosphamide multiple interactions EXP 6480464 Cyclophosphamide results in increased phosphorylation of and results in increased activity of MAPK7 protein CTD PMID:17110531 Mapk7 Rat cyclosporin A increases expression ISO MAPK7 (Homo sapiens) 6480464 Cyclosporine results in increased expression of MAPK7 mRNA CTD PMID:20106945 Mapk7 Rat D-glucitol increases activity ISO Mapk7 (Mus musculus) 6480464 Sorbitol results in increased activity of MAPK7 protein CTD PMID:11163183 Mapk7 Rat dexamethasone multiple interactions ISO MAPK7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MAPK7 mRNA CTD PMID:28628672 Mapk7 Rat diarsenic trioxide multiple interactions ISO MAPK7 (Homo sapiens) 6480464 [IL24 protein co-treated with Arsenic Trioxide] results in increased phosphorylation of MAPK7 protein CTD PMID:15580305 Mapk7 Rat diarsenic trioxide decreases activity ISO Mapk7 (Mus musculus) 6480464 Arsenic Trioxide results in decreased activity of MAPK7 protein CTD PMID:15761769 Mapk7 Rat doxorubicin multiple interactions EXP 6480464 Phosphocreatine inhibits the reaction [Doxorubicin results in increased expression of MAPK7 mRNA] CTD PMID:37597758 Mapk7 Rat doxorubicin decreases expression ISO MAPK7 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MAPK7 mRNA CTD PMID:29803840 Mapk7 Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of MAPK7 mRNA CTD PMID:37597758 Mapk7 Rat hesperidin multiple interactions ISO MAPK7 (Homo sapiens) 6480464 BIX 02189 promotes the reaction [Hesperidin results in decreased phosphorylation of MAPK7 protein] more ... CTD PMID:34984768 Mapk7 Rat hyaluronic acid multiple interactions ISO Mapk7 (Mus musculus) 6480464 MAPK7 protein promotes the reaction [TGFB2 protein results in increased abundance of Hyaluronic Acid] CTD PMID:20633555 Mapk7 Rat hydrogen peroxide multiple interactions ISO MAPK7 (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in decreased expression of MAPK7 protein CTD PMID:18951874 Mapk7 Rat hydrogen peroxide affects expression ISO MAPK7 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of MAPK7 protein CTD PMID:21179406 Mapk7 Rat hydrogen peroxide multiple interactions ISO Mapk7 (Mus musculus) 6480464 U 0126 inhibits the reaction [Hydrogen Peroxide results in increased phosphorylation of MAPK7 protein] CTD PMID:14737115 Mapk7 Rat hydrogen peroxide increases phosphorylation ISO Mapk7 (Mus musculus) 6480464 Hydrogen Peroxide results in increased phosphorylation of MAPK7 protein CTD PMID:14737115 Mapk7 Rat indometacin multiple interactions ISO MAPK7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MAPK7 mRNA CTD PMID:28628672 Mapk7 Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of MAPK7 mRNA CTD PMID:20080153 Mapk7 Rat methotrexate increases expression ISO MAPK7 (Homo sapiens) 6480464 Methotrexate results in increased expression of MAPK7 mRNA CTD PMID:21678067 Mapk7 Rat methyl methanesulfonate multiple interactions ISO MAPK7 (Homo sapiens) 6480464 [BIX 02188 results in decreased activity of MAPK7] which results in increased susceptibility to Methyl Methanesulfonate CTD PMID:22008504 Mapk7 Rat methyl methanesulfonate decreases response to substance ISO MAPK7 (Homo sapiens) 6480464 MAPK7 results in decreased susceptibility to Methyl Methanesulfonate CTD PMID:22008504 Mapk7 Rat N-methyl-4-phenylpyridinium decreases expression ISO MAPK7 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of MAPK7 mRNA CTD PMID:25234470 Mapk7 Rat N-phosphocreatine multiple interactions EXP 6480464 Phosphocreatine inhibits the reaction [Doxorubicin results in increased expression of MAPK7 mRNA] CTD PMID:37597758 Mapk7 Rat N-phosphocreatine decreases expression EXP 6480464 Phosphocreatine results in decreased expression of MAPK7 mRNA CTD PMID:37597758 Mapk7 Rat okadaic acid multiple interactions ISO Mapk7 (Mus musculus) 6480464 Okadaic Acid results in increased phosphorylation of and results in increased activity of MAPK7 protein and U 0126 inhibits the reaction [Okadaic Acid results in increased phosphorylation of and results in increased activity of MAPK7 protein] CTD PMID:19716839 Mapk7 Rat okadaic acid multiple interactions ISO MAPK7 (Homo sapiens) 6480464 Okadaic Acid results in increased phosphorylation of and results in increased activity of MAPK7 protein CTD PMID:19716839 Mapk7 Rat ouabain multiple interactions ISO MAPK7 (Homo sapiens) 6480464 Ouabain inhibits the reaction [palytoxin results in increased phosphorylation of and results in increased activity of MAPK7 protein] CTD PMID:19716839 Mapk7 Rat palytoxin multiple interactions ISO MAPK7 (Homo sapiens) 6480464 MAPK7 mutant form inhibits the reaction [palytoxin results in increased expression of FOS mRNA] more ... CTD PMID:19716839 Mapk7 Rat palytoxin multiple interactions ISO Mapk7 (Mus musculus) 6480464 palytoxin results in increased phosphorylation of and results in increased activity of MAPK7 protein CTD PMID:19716839 Mapk7 Rat paracetamol affects expression ISO Mapk7 (Mus musculus) 6480464 Acetaminophen affects the expression of MAPK7 mRNA CTD PMID:17562736 Mapk7 Rat perfluorohexanesulfonic acid decreases expression ISO Mapk7 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of MAPK7 mRNA CTD PMID:37995155 Mapk7 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Mapk7 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of MAPK7 mRNA CTD PMID:36331819 Mapk7 Rat phenylephrine multiple interactions EXP 6480464 Phenylephrine inhibits the reaction [MAPK7 protein results in increased expression of JUN protein] CTD PMID:12574153 Mapk7 Rat pterostilbene increases phosphorylation ISO MAPK7 (Homo sapiens) 6480464 pterostilbene results in increased phosphorylation of MAPK7 protein CTD PMID:26443543 Mapk7 Rat pterostilbene multiple interactions ISO MAPK7 (Homo sapiens) 6480464 MAPK7 protein affects the reaction [pterostilbene results in increased expression of KLF2 mRNA] more ... CTD PMID:26443543 Mapk7 Rat rac-lactic acid decreases expression ISO MAPK7 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of MAPK7 mRNA CTD PMID:30851411 Mapk7 Rat resveratrol increases phosphorylation ISO MAPK7 (Homo sapiens) 6480464 resveratrol results in increased phosphorylation of MAPK7 protein CTD PMID:26443543 Mapk7 Rat rotenone decreases phosphorylation EXP 6480464 Rotenone results in decreased phosphorylation of MAPK7 protein CTD PMID:37224993 Mapk7 Rat rotenone multiple interactions EXP 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Aprepitant inhibits the reaction [Rotenone results in decreased phosphorylation of MAPK7 protein]] and Aprepitant inhibits the reaction [Rotenone results in decreased phosphorylation of MAPK7 protein] CTD PMID:37224993 Mapk7 Rat sodium arsenite decreases expression ISO Mapk7 (Mus musculus) 6480464 sodium arsenite results in decreased expression of MAPK7 mRNA CTD PMID:16014739 Mapk7 Rat sodium dichromate decreases expression ISO Mapk7 (Mus musculus) 6480464 sodium bichromate results in decreased expression of MAPK7 mRNA CTD PMID:22155349 Mapk7 Rat sodium dichromate increases expression ISO Mapk7 (Mus musculus) 6480464 sodium bichromate results in increased expression of MAPK7 mRNA CTD PMID:22155349 Mapk7 Rat sodium fluoride decreases expression EXP 6480464 Sodium Fluoride results in decreased expression of MAPK7 mRNA CTD PMID:36736877 Mapk7 Rat sodium fluoride increases phosphorylation ISO Mapk7 (Mus musculus) 6480464 Sodium Fluoride results in increased phosphorylation of MAPK7 protein CTD PMID:26862884 Mapk7 Rat sunitinib increases expression ISO MAPK7 (Homo sapiens) 6480464 Sunitinib results in increased expression of MAPK7 mRNA CTD PMID:31533062 Mapk7 Rat tamoxifen affects expression ISO Mapk7 (Mus musculus) 6480464 Tamoxifen affects the expression of MAPK7 mRNA CTD PMID:17555576 Mapk7 Rat tetrachloromethane increases expression ISO Mapk7 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of MAPK7 mRNA CTD PMID:15056808 Mapk7 Rat theophylline multiple interactions ISO MAPK7 (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in decreased expression of MAPK7 protein CTD PMID:18951874 Mapk7 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of MAPK7 mRNA CTD PMID:34492290 Mapk7 Rat titanium dioxide decreases methylation ISO Mapk7 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MAPK7 gene CTD PMID:35295148 Mapk7 Rat trans-piceid multiple interactions ISO MAPK7 (Homo sapiens) 6480464 XMD 8-92 inhibits the reaction [polydatin results in increased phosphorylation of MAPK7 protein] CTD PMID:28980048 Mapk7 Rat trans-piceid increases phosphorylation ISO MAPK7 (Homo sapiens) 6480464 polydatin results in increased phosphorylation of MAPK7 protein CTD PMID:28980048 Mapk7 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of MAPK7 mRNA CTD PMID:33387578 Mapk7 Rat triphenyl phosphate affects expression ISO MAPK7 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MAPK7 mRNA CTD PMID:37042841 Mapk7 Rat tyrphostin AG 1478 multiple interactions ISO Mapk7 (Mus musculus) 6480464 RTKI cpd inhibits the reaction [EGF protein results in increased phosphorylation of MAPK7 protein] CTD PMID:14737115 Mapk7 Rat urethane decreases expression ISO MAPK7 (Homo sapiens) 6480464 Urethane results in decreased expression of MAPK7 mRNA CTD PMID:28818685 Mapk7 Rat valproic acid affects expression ISO MAPK7 (Homo sapiens) 6480464 Valproic Acid affects the expression of MAPK7 mRNA CTD PMID:25979313 Mapk7 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of MAPK7 mRNA CTD PMID:23555832 Mapk7 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of MAPK7 gene CTD PMID:31682807 Mapk7 Rat zinc sulfate increases expression ISO MAPK7 (Homo sapiens) 6480464 Zinc Sulfate results in increased expression of MAPK7 mRNA CTD PMID:16330358
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) Alisol A (EXP) Alisol B (EXP) Alisol C 23-acetate (EXP) ammonium chloride (EXP) aprepitant (EXP) arecoline (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (EXP) benzo[a]pyrene (ISO) bisphenol A (EXP) bisphenol F (ISO) cadmium dichloride (ISO) caffeine (ISO) capsaicin (EXP) chlorpyrifos (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) crocidolite asbestos (ISO) cycloheximide (ISO) cyclophosphamide (EXP) cyclosporin A (ISO) D-glucitol (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) doxorubicin (EXP,ISO) hesperidin (ISO) hyaluronic acid (ISO) hydrogen peroxide (ISO) indometacin (ISO) ketamine (EXP) methotrexate (ISO) methyl methanesulfonate (ISO) N-methyl-4-phenylpyridinium (ISO) N-phosphocreatine (EXP) okadaic acid (ISO) ouabain (ISO) palytoxin (ISO) paracetamol (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) phenylephrine (EXP) pterostilbene (ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (EXP) sodium arsenite (ISO) sodium dichromate (ISO) sodium fluoride (EXP,ISO) sunitinib (ISO) tamoxifen (ISO) tetrachloromethane (ISO) theophylline (ISO) thioacetamide (EXP) titanium dioxide (ISO) trans-piceid (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) tyrphostin AG 1478 (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) zinc sulfate (ISO)
Biological Process
calcineurin-NFAT signaling cascade (IEA,ISO) cell differentiation (IEA) cellular response to growth factor stimulus (IEA,ISO) cellular response to hydrogen peroxide (IEA,ISO) cellular response to laminar fluid shear stress (IEA,ISO) cellular response to transforming growth factor beta stimulus (IEA,ISO) ERK5 cascade (IMP) intracellular signal transduction (IBA) MAPK cascade (IEA,IMP) negative regulation of apoptotic process (IEA,ISO) negative regulation of calcineurin-NFAT signaling cascade (IEA,ISO) negative regulation of endothelial cell apoptotic process (IEA,ISO) negative regulation of extrinsic apoptotic signaling pathway in absence of ligand (IEA,ISO) negative regulation of heterotypic cell-cell adhesion (IEA,ISO) negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway (IEA,ISO) negative regulation of response to cytokine stimulus (IEA,ISO) negative regulation of smooth muscle cell apoptotic process (IMP) peptidyl-serine phosphorylation (ISO) positive regulation of protein metabolic process (IEA,ISO) positive regulation of transcription by RNA polymerase II (IEA,ISO) protein autophosphorylation (IDA) protein phosphorylation (IDA,ISO) regulation of angiogenesis (IEA,ISO)
1.
Big mitogen-activated protein kinase 1 (BMK1) is a redox-sensitive kinase.
Abe J, etal., J Biol Chem. 1996 Jul 12;271(28):16586-90.
2.
Canonical and kinase activity-independent mechanisms for extracellular signal-regulated kinase 5 (ERK5) nuclear translocation require dissociation of Hsp90 from the ERK5-Cdc37 complex.
Erazo T, etal., Mol Cell Biol. 2013 Apr;33(8):1671-86. doi: 10.1128/MCB.01246-12. Epub 2013 Feb 19.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Gastrin stimulates cyclooxygenase-2 expression in intestinal epithelial cells through multiple signaling pathways. Evidence for involvement of ERK5 kinase and transactivation of the epidermal growth factor receptor.
Guo YS, etal., J Biol Chem 2002 Dec 13;277(50):48755-63.
5.
Aberrant expression of extracellular signal-regulated kinase 5 in human prostate cancer.
McCracken SR, etal., Oncogene. 2008 May 8;27(21):2978-88. Epub 2007 Dec 10.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
MEK5 and ERK5 are localized in the nuclei of resting as well as stimulated cells, while MEKK2 translocates from the cytosol to the nucleus upon stimulation.
Raviv Z, etal., J Cell Sci. 2004 Apr 1;117(Pt 9):1773-84. Epub 2004 Mar 16.
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Hydrogen peroxide stimulates c-Src-mediated big mitogen-activated protein kinase 1 (BMK1) and the MEF2C signaling pathway in PC12 cells: potential role in cell survival following oxidative insults.
Suzaki Y, etal., J Biol Chem. 2002 Mar 15;277(11):9614-21. Epub 2002 Jan 8.
12.
The ERK5-MEF2C transcription factor pathway contributes to anti-apoptotic effect of cerebral ischemia preconditioning in the hippocampal CA1 region of rats.
Wang RM, etal., Brain Res. 2009 Feb 19;1255:32-41. doi: 10.1016/j.brainres.2008.12.011. Epub 2008 Dec 11.
13.
Regulation of cellular functions by the ERK5 signalling pathway.
Wang X and Tournier C, Cell Signal. 2006 Jun;18(6):753-60. Epub 2006 Jan 6.
14.
Novel role of C terminus of Hsc70-interacting protein (CHIP) ubiquitin ligase on inhibiting cardiac apoptosis and dysfunction via regulating ERK5-mediated degradation of inducible cAMP early repressor.
Woo CH, etal., FASEB J. 2010 Dec;24(12):4917-28. doi: 10.1096/fj.10-162636. Epub 2010 Aug 19.
15.
Interaction of myocyte enhancer factor 2 (MEF2) with a mitogen-activated protein kinase, ERK5/BMK1.
Yang CC, etal., Nucleic Acids Res 1998 Oct 15;26(20):4771-7.
Mapk7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 46,669,721 - 46,675,768 (-) NCBI GRCr8 mRatBN7.2 10 46,170,264 - 46,176,262 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 46,170,167 - 46,176,267 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 50,873,542 - 50,878,848 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 50,364,065 - 50,369,371 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 45,867,492 - 45,872,798 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 47,768,592 - 47,775,130 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 47,766,680 - 47,775,055 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 49,002,126 - 49,009,156 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 47,541,086 - 47,547,066 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 47,649,203 - 47,654,316 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 47,662,825 - 47,664,689 (-) NCBI Celera 10 45,422,029 - 45,427,142 (-) NCBI Celera Cytogenetic Map 10 q22 NCBI
MAPK7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 19,377,750 - 19,383,544 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 19,377,721 - 19,383,544 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 19,281,063 - 19,286,857 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 19,221,659 - 19,227,445 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 19,222,399 - 19,227,445 NCBI Celera 17 16,693,845 - 16,699,668 (+) NCBI Celera Cytogenetic Map 17 p11.2 NCBI HuRef 17 18,660,602 - 18,666,426 (+) NCBI HuRef CHM1_1 17 19,289,782 - 19,295,605 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 19,325,785 - 19,331,579 (+) NCBI T2T-CHM13v2.0
Mapk7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 61,379,638 - 61,385,101 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 61,379,638 - 61,385,232 (-) Ensembl GRCm39 Ensembl GRCm38 11 61,488,812 - 61,494,267 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 61,488,812 - 61,494,406 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 61,302,314 - 61,307,715 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 61,305,007 - 61,310,410 (-) NCBI MGSCv36 mm8 MGSCv36 11 61,918,787 - 61,924,191 (-) NCBI MGSCv36 mm8 Cytogenetic Map 11 B2 NCBI cM Map 11 37.96 NCBI
Mapk7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955467 378,156 - 386,532 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955467 381,801 - 387,078 (-) NCBI ChiLan1.0 ChiLan1.0
MAPK7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 54,387,153 - 54,392,917 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 59,195,965 - 59,205,328 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 31,729,429 - 31,736,216 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 36,894,146 - 36,899,969 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 36,894,146 - 36,899,969 (-) Ensembl panpan1.1 panPan2
MAPK7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 40,831,949 - 40,836,990 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 40,831,947 - 40,836,505 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 40,973,093 - 40,978,133 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 40,939,555 - 40,944,595 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 40,939,106 - 40,944,557 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 40,907,887 - 40,912,927 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 40,854,664 - 40,859,704 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 41,046,762 - 41,051,802 (-) NCBI UU_Cfam_GSD_1.0
Mapk7
MAPK7
MAPK7 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 17,962,827 - 17,969,027 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 17,964,408 - 17,968,714 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 2,882,238 - 2,888,383 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mapk7
.
Predicted Target Of
Count of predictions: 292 Count of miRNA genes: 92 Interacting mature miRNAs: 104 Transcripts: ENSRNOT00000003290, ENSRNOT00000057864, ENSRNOT00000072970, ENSRNOT00000073706 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 1354614 Hpcl1 Hepatic cholesterol level QTL 1 3.3 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 35392267 51793994 Rat 631532 Cm50 Cardiac mass QTL 50 6.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 17907113 51786432 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1600371 Mcs21 Mammary carcinoma susceptibility QTL 21 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 28875650 52200160 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
RH129756
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 46,169,904 - 46,170,104 (+) MAPPER mRatBN7.2 Rnor_6.0 10 49,003,684 - 49,003,883 NCBI Rnor6.0 Rnor_6.0 10 47,768,233 - 47,768,432 NCBI Rnor6.0 Rnor_5.0 10 48,788,343 - 48,788,542 UniSTS Rnor5.0 Rnor_5.0 10 47,540,727 - 47,540,926 UniSTS Rnor5.0 RGSC_v3.4 10 47,648,844 - 47,649,043 UniSTS RGSC3.4 Celera 10 45,421,670 - 45,421,869 UniSTS RH 3.4 Map 10 529.92 UniSTS Cytogenetic Map 10 q23 UniSTS
STS-U29725
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 46,170,430 - 46,170,681 (+) MAPPER mRatBN7.2 Rnor_6.0 10 49,004,210 - 49,004,460 NCBI Rnor6.0 Rnor_6.0 10 47,768,759 - 47,769,009 NCBI Rnor6.0 Rnor_5.0 10 47,541,253 - 47,541,503 UniSTS Rnor5.0 Rnor_5.0 10 48,788,869 - 48,789,119 UniSTS Rnor5.0 RGSC_v3.4 10 47,649,370 - 47,649,620 UniSTS RGSC3.4 Celera 10 45,422,196 - 45,422,446 UniSTS Cytogenetic Map 10 q23 UniSTS
RH141658
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 46,170,359 - 46,170,574 (+) MAPPER mRatBN7.2 Rnor_6.0 10 49,004,139 - 49,004,353 NCBI Rnor6.0 Rnor_6.0 10 47,768,688 - 47,768,902 NCBI Rnor6.0 Rnor_5.0 10 48,788,798 - 48,789,012 UniSTS Rnor5.0 Rnor_5.0 10 47,541,182 - 47,541,396 UniSTS Rnor5.0 RGSC_v3.4 10 47,649,299 - 47,649,513 UniSTS RGSC3.4 Celera 10 45,422,125 - 45,422,339 UniSTS RH 3.4 Map 10 530.18 UniSTS Cytogenetic Map 10 q23 UniSTS
G67083
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 46,174,461 - 46,175,014 (+) MAPPER mRatBN7.2 Rnor_6.0 10 49,008,241 - 49,008,793 NCBI Rnor6.0 Rnor_6.0 10 47,772,790 - 47,773,342 NCBI Rnor6.0 Rnor_5.0 10 47,545,284 - 47,545,836 UniSTS Rnor5.0 Rnor_5.0 10 48,792,900 - 48,793,452 UniSTS Rnor5.0 RGSC_v3.4 10 47,653,401 - 47,653,953 UniSTS RGSC3.4 Celera 10 45,426,227 - 45,426,779 UniSTS Cytogenetic Map 10 q23 UniSTS
UniSTS:469818
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 46,170,282 - 46,170,553 (+) MAPPER mRatBN7.2 Rnor_6.0 10 49,004,062 - 49,004,332 NCBI Rnor6.0 Rnor_6.0 10 47,768,611 - 47,768,881 NCBI Rnor6.0 Rnor_5.0 10 47,541,105 - 47,541,375 UniSTS Rnor5.0 Rnor_5.0 10 48,788,721 - 48,788,991 UniSTS Rnor5.0 RGSC_v3.4 10 47,649,222 - 47,649,492 UniSTS RGSC3.4 Celera 10 45,422,048 - 45,422,318 UniSTS Cytogenetic Map 10 q23 UniSTS
Mapk7
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 46,174,537 - 46,175,220 (+) MAPPER mRatBN7.2 Rnor_6.0 10 49,008,317 - 49,008,999 NCBI Rnor6.0 Rnor_6.0 10 47,772,866 - 47,773,548 NCBI Rnor6.0 Rnor_5.0 10 47,545,360 - 47,546,042 UniSTS Rnor5.0 Rnor_5.0 10 48,792,976 - 48,793,658 UniSTS Rnor5.0 RGSC_v3.4 10 47,653,477 - 47,654,159 UniSTS RGSC3.4 Celera 10 45,426,303 - 45,426,985 UniSTS Cytogenetic Map 10 q23 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
3
7
38
128
41
51
26
23
26
146
71
121
42
57
25
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000057864 ⟹ ENSRNOP00000054673
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 10 47,766,680 - 47,775,055 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000072970 ⟹ ENSRNOP00000064205
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 46,170,167 - 46,175,714 (-) Ensembl Rnor_6.0 Ensembl 10 49,004,342 - 49,009,156 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000073706 ⟹ ENSRNOP00000064398
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 10 49,002,126 - 49,007,089 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000111246 ⟹ ENSRNOP00000079913
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 46,170,169 - 46,176,267 (-) Ensembl
RefSeq Acc Id:
NM_001191547 ⟹ NP_001178476
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 46,669,721 - 46,674,834 (-) NCBI mRatBN7.2 10 46,170,264 - 46,175,377 (-) NCBI Rnor_6.0 10 47,768,592 - 47,773,705 (-) NCBI Rnor_5.0 10 47,541,086 - 47,547,066 (-) NCBI Celera 10 45,422,029 - 45,427,142 (-) NCBI
Sequence:
ATGGCCGAACCGTTGAAGGAGGAGGACGGCGAAGATGGCTCTGGGGAACCCCCTGGGCGGGTGAAGGCAGAACCCGTCCACTCCGCTGCATCTGTCGTGGCCAAGAACCTGGCCCTGCTCAAAGCCCG
hide sequence
RefSeq Acc Id:
XM_006246417 ⟹ XP_006246479
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 46,669,721 - 46,675,250 (-) NCBI mRatBN7.2 10 46,170,264 - 46,176,036 (-) NCBI Rnor_6.0 10 47,768,592 - 47,774,416 (-) NCBI Rnor_5.0 10 47,541,086 - 47,547,066 (-) NCBI
Sequence:
ATCGCCCCTTATCTCCGCCCCTTCGGGCCTGTGGAGCCGGTAAACTCAGAAGTGCACACGAACT
hide sequence
RefSeq Acc Id:
XM_006246418 ⟹ XP_006246480
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 46,669,721 - 46,675,768 (-) NCBI mRatBN7.2 10 46,170,264 - 46,176,262 (-) NCBI Rnor_6.0 10 47,768,592 - 47,775,130 (-) NCBI Rnor_5.0 10 47,541,086 - 47,547,066 (-) NCBI
Sequence:
TTAGAAATTCGCTGCCCTCTGCCTCTCCAGTACTGAGACCAACTAAAGGCGTGAGCTACCATGC
hide sequence
RefSeq Acc Id:
XM_006246420 ⟹ XP_006246482
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 46,669,721 - 46,675,250 (-) NCBI mRatBN7.2 10 46,170,264 - 46,176,036 (-) NCBI Rnor_6.0 10 47,768,592 - 47,773,453 (-) NCBI Rnor_5.0 10 47,541,086 - 47,547,066 (-) NCBI
Sequence:
TCAGCATGTGTGGACTGCTTTCCAGAGGCCCCGCACGGTTCCAGGAGGATCAGCTGCACCGGGG
hide sequence
RefSeq Acc Id:
XM_008767756 ⟹ XP_008765978
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 46,669,721 - 46,675,250 (-) NCBI mRatBN7.2 10 46,170,264 - 46,176,036 (-) NCBI Rnor_6.0 10 47,768,592 - 47,773,453 (-) NCBI
Sequence:
TCAGCATGTGTGGACTGCTTTCCAGAGGCCCCGCACGGTTCCAGGAGGATCAGCTGCACCGGGGATTCTGGTTCCACTCACGCTTACCGACTAGGTGCCAGCTCCCCGTTAGGTCAGCAGGTGGCCAT
hide sequence
RefSeq Acc Id:
XM_039085036 ⟹ XP_038940964
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 46,669,721 - 46,675,250 (-) NCBI mRatBN7.2 10 46,170,264 - 46,175,004 (-) NCBI
RefSeq Acc Id:
XM_063268274 ⟹ XP_063124344
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 46,669,721 - 46,675,502 (-) NCBI
RefSeq Acc Id:
XM_063268275 ⟹ XP_063124345
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 46,669,721 - 46,675,485 (-) NCBI
RefSeq Acc Id:
XM_063268276 ⟹ XP_063124346
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 46,669,721 - 46,675,667 (-) NCBI
RefSeq Acc Id:
NP_001178476 ⟸ NM_001191547
- UniProtKB:
P0C865 (UniProtKB/Swiss-Prot), E9PTH2 (UniProtKB/TrEMBL)
- Sequence:
MAEPLKEEDGEDGSGEPPGRVKAEPVHSAASVVAKNLALLKARSFDVTFDVGDEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDILRPTVPYG
hide sequence
RefSeq Acc Id:
XP_006246480 ⟸ XM_006246418
- Peptide Label:
isoform X1
- UniProtKB:
P0C865 (UniProtKB/Swiss-Prot), E9PTH2 (UniProtKB/TrEMBL)
- Sequence:
MAEPLKEEDGEDGSGEPPGRVKAEPVHSAASVVAKNLALLKARSFDVTFDVGDEYEIIETIGNG
hide sequence
RefSeq Acc Id:
XP_006246479 ⟸ XM_006246417
- Peptide Label:
isoform X1
- UniProtKB:
P0C865 (UniProtKB/Swiss-Prot), E9PTH2 (UniProtKB/TrEMBL)
- Sequence:
MAEPLKEEDGEDGSGEPPGRVKAEPVHSAASVVAKNLALLKARSFDVTFDVGDEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDILRPTVPYG
hide sequence
RefSeq Acc Id:
XP_006246482 ⟸ XM_006246420
- Peptide Label:
isoform X2
- UniProtKB:
P0C865 (UniProtKB/Swiss-Prot)
- Sequence:
MESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGM
hide sequence
RefSeq Acc Id:
XP_008765978 ⟸ XM_008767756
- Peptide Label:
isoform X2
- UniProtKB:
P0C865 (UniProtKB/Swiss-Prot)
- Sequence:
MESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNY
hide sequence
RefSeq Acc Id:
XP_038940964 ⟸ XM_039085036
- Peptide Label:
isoform X2
- UniProtKB:
P0C865 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSRNOP00000064205 ⟸ ENSRNOT00000072970
Ensembl Acc Id:
ENSRNOP00000054673 ⟸ ENSRNOT00000057864
Ensembl Acc Id:
ENSRNOP00000064398 ⟸ ENSRNOT00000073706
Ensembl Acc Id:
ENSRNOP00000079913 ⟸ ENSRNOT00000111246
RefSeq Acc Id:
XP_063124346 ⟸ XM_063268276
- Peptide Label:
isoform X2
- UniProtKB:
P0C865 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063124344 ⟸ XM_063268274
- Peptide Label:
isoform X1
- UniProtKB:
P0C865 (UniProtKB/Swiss-Prot), E9PTH2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063124345 ⟸ XM_063268275
- Peptide Label:
isoform X2
- UniProtKB:
P0C865 (UniProtKB/Swiss-Prot)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Mapk7
mitogen-activated protein kinase 7
LOC100912585
mitogen-activated protein kinase 7-like
Data merged from RGD:6486357
737654 PROVISIONAL
2012-07-05
LOC100912585
mitogen-activated protein kinase 7-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2004-09-10
Mapk7
mitogen-activated protein kinase 7
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Mapk7
mitogen-activated protein kinase 7
Symbol and Name status set to provisional
70820 PROVISIONAL
