Symbol:
Psmc1
Name:
proteasome 26S subunit, ATPase 1
RGD ID:
621097
Description:
Enables TBP-class protein binding activity. Predicted to be involved in proteasome-mediated ubiquitin-dependent protein catabolic process. Predicted to be located in cytosol and nucleoplasm. Predicted to be part of proteasome regulatory particle, base subcomplex. Human ortholog(s) of this gene implicated in neurodevelopmental disorder with poor growth, spastic tetraplegia, and hearing loss. Orthologous to human PSMC1 (proteasome 26S subunit, ATPase 1); PARTICIPATES IN ubiquitin/proteasome degradation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2-nitrofluorene; 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
26S protease regulatory subunit 4; 26S proteasome AAA-ATPase subunit RPT2; 26S proteasome regulatory subunit 4; P26s4; peptidase (prosome, macropain) 26S subunit, ATPase 1; protease (prosome, macropain) 26S subunit, ATPase 1; proteasome (prosome, macropain) 26S subunit, ATPase, 1; proteasome 26S subunit ATPase 1; s4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PSMC1 (proteasome 26S subunit, ATPase 1)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Psmc1 (protease (prosome, macropain) 26S subunit, ATPase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Psmc1 (proteasome 26S subunit, ATPase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PSMC1 (proteasome 26S subunit, ATPase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PSMC1 (proteasome 26S subunit, ATPase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Psmc1 (proteasome 26S subunit, ATPase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PSMC1 (proteasome 26S subunit, ATPase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PSMC1 (proteasome 26S subunit, ATPase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Psmc1 (proteasome 26S subunit, ATPase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PSMC1 (proteasome 26S subunit, ATPase 1)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Psmc1 (protease (prosome, macropain) 26S subunit, ATPase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
psmc1b (proteasome 26S subunit, ATPase 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
psmc1a (proteasome 26S subunit, ATPase 1a)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
RPT2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
rpt-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Rpt2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
psmc1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 125,122,497 - 125,134,859 (+) NCBI GRCr8 mRatBN7.2 6 119,392,833 - 119,405,233 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 119,392,855 - 119,410,123 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 119,555,520 - 119,567,890 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 119,852,325 - 119,864,695 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 119,187,189 - 119,199,560 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 124,123,283 - 124,135,644 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 124,123,228 - 124,135,658 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 133,350,578 - 133,362,939 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 124,380,976 - 124,393,338 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 124,384,722 - 124,397,084 (+) NCBI Celera 6 116,922,860 - 116,935,222 (+) NCBI Celera Cytogenetic Map 6 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Psmc1 Rat 1,2-dichloroethane increases expression ISO RGD:734426 6480464 ethylene dichloride results in increased expression of PSMC1 mRNA CTD PMID:28960355 Psmc1 Rat 1,2-dimethylhydrazine increases expression ISO RGD:734426 6480464 1,2-Dimethylhydrazine results in increased expression of PSMC1 mRNA CTD PMID:22206623 Psmc1 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:734426 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of PSMC1 mRNA] CTD PMID:22206623 Psmc1 Rat 17alpha-ethynylestradiol increases expression ISO RGD:734426 6480464 Ethinyl Estradiol results in increased expression of PSMC1 mRNA CTD PMID:17942748 Psmc1 Rat 17beta-estradiol increases expression ISO RGD:734426 6480464 Estradiol results in increased expression of PSMC1 mRNA CTD PMID:39298647 Psmc1 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO RGD:734425 6480464 Metribolone results in increased expression of PSMC1 protein CTD PMID:17152098 Psmc1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:734426 6480464 Tetrachlorodibenzodioxin affects the expression of PSMC1 mRNA CTD PMID:21570461 Psmc1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PSMC1 mRNA CTD PMID:34747641 Psmc1 Rat 2-bromohexadecanoic acid multiple interactions ISO RGD:734425 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Psmc1 Rat 2-nitrofluorene increases expression EXP 6480464 2-nitrofluorene results in increased expression of PSMC1 mRNA CTD PMID:15890375 Psmc1 Rat 3H-1,2-dithiole-3-thione increases expression ISO RGD:734426 6480464 1,2-dithiol-3-thione results in increased expression of PSMC1 mRNA CTD PMID:15375163 Psmc1 Rat 4,4'-diaminodiphenylmethane decreases expression ISO RGD:734426 6480464 4,4'-diaminodiphenylmethane results in decreased expression of PSMC1 mRNA CTD PMID:18648102 Psmc1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:734426 6480464 bisphenol S results in increased expression of PSMC1 mRNA CTD PMID:39298647 Psmc1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:734425 6480464 bisphenol S results in increased expression of PSMC1 protein CTD PMID:34186270 Psmc1 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of PSMC1 mRNA CTD PMID:15890375 Psmc1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of PSMC1 mRNA CTD PMID:19483382 Psmc1 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of PSMC1 mRNA CTD PMID:19483382 Psmc1 Rat acrylamide increases expression ISO RGD:734425 6480464 Acrylamide results in increased expression of PSMC1 mRNA CTD PMID:32763439 Psmc1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of PSMC1 mRNA CTD PMID:15890375 Psmc1 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of PSMC1 mRNA CTD PMID:19483382 Psmc1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PSMC1 mRNA CTD PMID:16483693 Psmc1 Rat arsane multiple interactions ISO RGD:734425 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Psmc1 Rat arsenic atom multiple interactions ISO RGD:734425 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Psmc1 Rat benzatropine decreases expression ISO RGD:734425 6480464 Benztropine results in decreased expression of PSMC1 protein CTD PMID:34122009 Psmc1 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of PSMC1 mRNA CTD PMID:19483382 Psmc1 Rat benzo[a]pyrene increases expression ISO RGD:734426 6480464 Benzo(a)pyrene results in increased expression of PSMC1 mRNA CTD PMID:21715664|PMID:22228805 Psmc1 Rat beta-naphthoflavone increases expression ISO RGD:734425 6480464 beta-Naphthoflavone results in increased expression of PSMC1 mRNA CTD PMID:19737606 Psmc1 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of PSMC1 mRNA CTD PMID:21318169 Psmc1 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:734426 6480464 Diethylhexyl Phthalate results in increased expression of PSMC1 mRNA CTD PMID:33754040 Psmc1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PSMC1 mRNA CTD PMID:25181051|PMID:37611474 Psmc1 Rat bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of PSMC1 promoter CTD PMID:37611474 Psmc1 Rat bisphenol A increases methylation ISO RGD:734425 6480464 bisphenol A results in increased methylation of PSMC1 gene CTD PMID:31601247 Psmc1 Rat bisphenol A decreases expression ISO RGD:734426 6480464 bisphenol A results in decreased expression of PSMC1 mRNA CTD PMID:33221593 Psmc1 Rat bisphenol A decreases expression ISO RGD:734425 6480464 bisphenol A results in decreased expression of PSMC1 mRNA CTD PMID:29275510 Psmc1 Rat bisphenol F increases expression ISO RGD:734425 6480464 bisphenol F results in increased expression of PSMC1 protein CTD PMID:34186270 Psmc1 Rat butane-2,3-dione increases expression ISO RGD:734425 6480464 Diacetyl results in increased expression of PSMC1 protein CTD PMID:34031698 Psmc1 Rat cadmium atom multiple interactions ISO RGD:734425 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Psmc1 Rat cadmium dichloride multiple interactions ISO RGD:734425 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Psmc1 Rat chlorpyrifos decreases expression ISO RGD:734426 6480464 Chlorpyrifos results in decreased expression of PSMC1 mRNA CTD PMID:37019170 Psmc1 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of PSMC1 mRNA CTD PMID:19483382 Psmc1 Rat copper(II) chloride increases expression ISO RGD:734425 6480464 cupric chloride results in increased expression of PSMC1 mRNA CTD PMID:17211630 Psmc1 Rat copper(II) sulfate increases expression ISO RGD:734425 6480464 Copper Sulfate results in increased expression of PSMC1 mRNA CTD PMID:19549813 Psmc1 Rat Dibutyl phosphate affects expression ISO RGD:734425 6480464 di-n-butylphosphoric acid affects the expression of PSMC1 mRNA CTD PMID:37042841 Psmc1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of PSMC1 mRNA CTD PMID:21266533 Psmc1 Rat dibutyl phthalate decreases expression ISO RGD:734426 6480464 Dibutyl Phthalate results in decreased expression of PSMC1 mRNA CTD PMID:17361019 Psmc1 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of PSMC1 mRNA CTD PMID:18636392 Psmc1 Rat dicrotophos decreases expression ISO RGD:734425 6480464 dicrotophos results in decreased expression of PSMC1 mRNA CTD PMID:28302478 Psmc1 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of PSMC1 mRNA CTD PMID:15890375 Psmc1 Rat doxorubicin affects expression ISO RGD:734425 6480464 Doxorubicin affects the expression of PSMC1 protein CTD PMID:29385562 Psmc1 Rat elemental selenium increases expression ISO RGD:734425 6480464 Selenium results in increased expression of PSMC1 mRNA CTD PMID:19244175 Psmc1 Rat elesclomol increases expression ISO RGD:734425 6480464 elesclomol results in increased expression of PSMC1 mRNA CTD PMID:18723479 Psmc1 Rat ethanol decreases expression ISO RGD:734426 6480464 Ethanol results in decreased expression of PSMC1 protein CTD PMID:26769846 Psmc1 Rat ethanol affects splicing ISO RGD:734426 6480464 Ethanol affects the splicing of PSMC1 mRNA CTD PMID:30319688 Psmc1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of PSMC1 mRNA CTD PMID:24136188 Psmc1 Rat flavone increases expression ISO RGD:734425 6480464 flavone results in increased expression of PSMC1 protein CTD PMID:14750173 Psmc1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PSMC1 mRNA CTD PMID:24136188 Psmc1 Rat folic acid multiple interactions ISO RGD:734426 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of PSMC1 mRNA] CTD PMID:22206623 Psmc1 Rat FR900359 increases phosphorylation ISO RGD:734425 6480464 FR900359 results in increased phosphorylation of PSMC1 protein CTD PMID:37730182 Psmc1 Rat furfural multiple interactions ISO RGD:734425 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ... CTD PMID:38598786 Psmc1 Rat hypochlorous acid increases expression ISO RGD:734426 6480464 Hypochlorous Acid results in increased expression of PSMC1 mRNA CTD PMID:19376150 Psmc1 Rat ivermectin decreases expression ISO RGD:734425 6480464 Ivermectin results in decreased expression of PSMC1 protein CTD PMID:32959892 Psmc1 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of PSMC1 mRNA CTD PMID:19483382 Psmc1 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of PSMC1 mRNA CTD PMID:24136188 Psmc1 Rat manganese atom multiple interactions ISO RGD:734425 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Psmc1 Rat manganese(0) multiple interactions ISO RGD:734425 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Psmc1 Rat manganese(II) chloride multiple interactions ISO RGD:734425 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Psmc1 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of PSMC1 mRNA CTD PMID:15890375 Psmc1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO RGD:734425 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of PSMC1 mRNA CTD PMID:31806706 Psmc1 Rat N-methyl-4-phenylpyridinium increases expression ISO RGD:734426 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PSMC1 protein CTD PMID:26558463 Psmc1 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of PSMC1 mRNA CTD PMID:15890375 Psmc1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of PSMC1 mRNA CTD PMID:24136188 Psmc1 Rat nitrates multiple interactions ISO RGD:734426 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PSMC1 more ... CTD PMID:35964746 Psmc1 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of PSMC1 mRNA CTD PMID:19483382 Psmc1 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of PSMC1 mRNA CTD PMID:18636392 Psmc1 Rat patulin multiple interactions ISO RGD:734426 6480464 NFE2L1 protein affects the reaction [Patulin results in increased expression of PSMC1 mRNA] CTD PMID:35367319 Psmc1 Rat patulin increases expression ISO RGD:734426 6480464 Patulin results in increased expression of PSMC1 mRNA CTD PMID:35367319 Psmc1 Rat perfluorooctane-1-sulfonic acid affects expression ISO RGD:734426 6480464 perfluorooctane sulfonic acid affects the expression of PSMC1 mRNA CTD PMID:19429403 Psmc1 Rat perfluorooctane-1-sulfonic acid increases expression ISO RGD:734426 6480464 perfluorooctane sulfonic acid results in increased expression of PSMC1 mRNA CTD PMID:20936131 Psmc1 Rat perfluorooctanoic acid affects expression ISO RGD:734426 6480464 perfluorooctanoic acid affects the expression of PSMC1 mRNA CTD PMID:19429403 Psmc1 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of PSMC1 mRNA CTD PMID:19162173|PMID:21318169 Psmc1 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of PSMC1 mRNA CTD PMID:19162173 Psmc1 Rat phlorizin decreases expression ISO RGD:734426 6480464 Phlorhizin results in decreased expression of PSMC1 mRNA CTD PMID:22538082 Psmc1 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of PSMC1 mRNA CTD PMID:15890375 Psmc1 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of PSMC1 mRNA CTD PMID:19483382 Psmc1 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of PSMC1 mRNA CTD PMID:15890375 Psmc1 Rat Propiverine affects binding EXP 6480464 propiverine binds to PSMC1 protein CTD PMID:29273565 Psmc1 Rat pyrogallol multiple interactions ISO RGD:734426 6480464 Silymarin inhibits the reaction [Pyrogallol results in decreased expression of PSMC1 mRNA] CTD PMID:20362636 Psmc1 Rat pyrogallol decreases expression ISO RGD:734426 6480464 Pyrogallol results in decreased expression of PSMC1 mRNA CTD PMID:20362636 Psmc1 Rat quinoline increases expression ISO RGD:734425 6480464 quinoline analog results in increased expression of PSMC1 protein CTD PMID:18645022 Psmc1 Rat selenium atom increases expression ISO RGD:734425 6480464 Selenium results in increased expression of PSMC1 mRNA CTD PMID:19244175 Psmc1 Rat sodium arsenite increases expression ISO RGD:734425 6480464 sodium arsenite results in increased expression of PSMC1 mRNA CTD PMID:38568856 Psmc1 Rat sodium arsenite multiple interactions ISO RGD:734425 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Psmc1 Rat sodium chloride multiple interactions ISO RGD:734425 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ... CTD PMID:38598786 Psmc1 Rat sunitinib decreases expression ISO RGD:734425 6480464 Sunitinib results in decreased expression of PSMC1 mRNA CTD PMID:31533062 Psmc1 Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of PSMC1 protein CTD PMID:35544339 Psmc1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of PSMC1 mRNA CTD PMID:19483382 Psmc1 Rat thiram increases expression ISO RGD:734425 6480464 Thiram results in increased expression of PSMC1 mRNA CTD PMID:38568856 Psmc1 Rat titanium dioxide decreases methylation ISO RGD:734426 6480464 titanium dioxide results in decreased methylation of PSMC1 promoter CTD PMID:35295148 Psmc1 Rat trimellitic anhydride increases expression ISO RGD:734426 6480464 trimellitic anhydride results in increased expression of PSMC1 mRNA CTD PMID:19042947 Psmc1 Rat triphenyl phosphate affects expression ISO RGD:734425 6480464 triphenyl phosphate affects the expression of PSMC1 mRNA CTD PMID:37042841 Psmc1 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of PSMC1 mRNA CTD PMID:24136188 Psmc1 Rat valproic acid affects expression ISO RGD:734426 6480464 Valproic Acid affects the expression of PSMC1 mRNA CTD PMID:17963808 Psmc1 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of PSMC1 mRNA CTD PMID:21318169 Psmc1 Rat vitamin E increases expression ISO RGD:734425 6480464 Vitamin E results in increased expression of PSMC1 mRNA CTD PMID:19244175 Psmc1 Rat zearalenone decreases expression ISO RGD:734426 6480464 Zearalenone results in decreased expression of PSMC1 protein CTD PMID:36252740
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Psmc1 Rat ATP binding enables IEA UniProtKB-KW:KW-0067 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Psmc1 Rat ATP binding enables IEA InterPro:IPR003959|InterPro:IPR003960 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Psmc1 Rat ATP hydrolysis activity TAS 729492 RGD Psmc1 Rat ATP hydrolysis activity enables IEA InterPro:IPR003593|InterPro:IPR003959|InterPro:IPR003960 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Psmc1 Rat nucleotide binding enables IEA UniProtKB-KW:KW-0547 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Psmc1 Rat proteasome-activating activity enables IBA PANTHER:PTN000553037|SGD:S000002165|UniProtKB:P35998 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Psmc1 Rat protein binding enables ISO RGD:734425 1624291 UniProtKB:O43463|UniProtKB:O60341|UniProtKB:P00441|UniProtKB:P35998|UniProtKB:P37840|UniProtKB:P43356|UniProtKB:P43686|UniProtKB:P50222|UniProtKB:P55036|UniProtKB:P55072|UniProtKB:P62333|UniProtKB:Q13200|UniProtKB:Q16401|UniProtKB:Q3KNR5|UniProtKB:Q8TBB1|UniProtKB:Q96BR9 PMID:16189514, PMID:16990800, PMID:19060904, PMID:19490896, PMID:22901813, PMID:23455924, PMID:25036637, PMID:25416956, PMID:26496610, PMID:27342858, PMID:28514442, PMID:29128334, PMID:29636472, more ... RGD PMID:16189514|PMID:16990800|PMID:19060904|PMID:19490896|PMID:22901813|PMID:23455924|PMID:25036637|PMID:25416956|PMID:26496610|PMID:27342858|PMID:28514442|PMID:29128334|PMID:29636472|PMID:31515488|PMID:32296183|PMID:32814053|PMID:33961781|PMID:35271311|PMID:9452483 Psmc1 Rat TBP-class protein binding IPI RGD:68981 6771232 RGD
Imported Annotations - KEGG (archival)
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-bromohexadecanoic acid (ISO) 2-nitrofluorene (EXP) 3H-1,2-dithiole-3-thione (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) aflatoxin B1 (EXP) amiodarone (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) benzatropine (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) beta-naphthoflavone (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butane-2,3-dione (ISO) cadmium atom (ISO) cadmium dichloride (ISO) chlorpyrifos (ISO) clofibrate (EXP) copper(II) chloride (ISO) copper(II) sulfate (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dichlorine (EXP) dicrotophos (ISO) diethylstilbestrol (EXP) doxorubicin (ISO) elemental selenium (ISO) elesclomol (ISO) ethanol (ISO) finasteride (EXP) flavone (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) furfural (ISO) hypochlorous acid (ISO) ivermectin (ISO) L-ethionine (EXP) leflunomide (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodimethylamine (EXP) nefazodone (EXP) nitrates (ISO) omeprazole (EXP) ozone (EXP) patulin (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) phenobarbital (EXP) phlorizin (ISO) piperonyl butoxide (EXP) pirinixic acid (EXP) Propiverine (EXP) pyrogallol (ISO) quinoline (ISO) selenium atom (ISO) sodium arsenite (ISO) sodium chloride (ISO) sunitinib (ISO) thapsigargin (EXP) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) valdecoxib (EXP) valproic acid (EXP,ISO) vitamin E (ISO) zearalenone (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Structures of the rat proteasomal ATPases: determination of highly conserved structural motifs and rules for their spacing.
Makino Y, etal., Biochem Biophys Res Commun 1996 Mar 27;220(3):1049-54.
3.
Multiple mammalian proteasomal ATPases, but not proteasome itself, are associated with TATA-binding protein and a novel transcriptional activator, TIP120.
Makino Y, etal., Genes Cells. 1999 Sep;4(9):529-39.
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
GOA pipeline
RGD automated data pipeline
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Comprehensive gene review and curation
RGD comprehensive gene curation
11.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Psmc1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 125,122,497 - 125,134,859 (+) NCBI GRCr8 mRatBN7.2 6 119,392,833 - 119,405,233 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 119,392,855 - 119,410,123 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 119,555,520 - 119,567,890 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 119,852,325 - 119,864,695 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 119,187,189 - 119,199,560 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 124,123,283 - 124,135,644 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 124,123,228 - 124,135,658 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 133,350,578 - 133,362,939 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 124,380,976 - 124,393,338 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 124,384,722 - 124,397,084 (+) NCBI Celera 6 116,922,860 - 116,935,222 (+) NCBI Celera Cytogenetic Map 6 q32 NCBI
PSMC1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 90,256,553 - 90,275,429 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 90,256,527 - 90,275,429 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 90,722,897 - 90,741,773 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 89,792,647 - 89,808,719 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 89,792,646 - 89,808,719 NCBI Celera 14 70,770,035 - 70,786,113 (+) NCBI Celera Cytogenetic Map 14 q32.11 NCBI HuRef 14 70,897,288 - 70,913,368 (+) NCBI HuRef CHM1_1 14 90,661,102 - 90,677,177 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 84,478,491 - 84,499,697 (+) NCBI T2T-CHM13v2.0
Psmc1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 100,076,461 - 100,089,623 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 100,076,413 - 100,089,664 (+) Ensembl GRCm39 Ensembl GRCm38 12 100,110,202 - 100,123,364 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 100,110,154 - 100,123,405 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 101,348,412 - 101,361,574 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 100,511,252 - 100,524,414 (+) NCBI MGSCv36 mm8 Celera 12 101,336,798 - 101,349,996 (+) NCBI Celera Cytogenetic Map 12 E NCBI cM Map 12 50.43 NCBI
Psmc1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955438 12,704,691 - 12,721,050 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955438 12,705,328 - 12,721,050 (+) NCBI ChiLan1.0 ChiLan1.0
PSMC1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 91,400,672 - 91,416,861 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 90,617,193 - 90,633,367 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 70,873,846 - 70,889,988 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 90,225,405 - 90,241,638 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 90,225,405 - 90,241,641 (+) Ensembl panpan1.1 panPan2
PSMC1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 61,272,363 - 61,285,886 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 61,272,363 - 61,285,886 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 60,851,941 - 60,865,464 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 61,544,550 - 61,558,080 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 61,544,577 - 61,558,051 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 61,225,967 - 61,239,658 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 61,274,899 - 61,288,618 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 61,603,196 - 61,616,721 (+) NCBI UU_Cfam_GSD_1.0
Psmc1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 14,600,035 - 14,613,399 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936488 17,455,461 - 17,469,527 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936488 17,455,612 - 17,468,933 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PSMC1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 112,027,921 - 112,041,489 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 112,027,904 - 112,041,360 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 118,594,314 - 118,607,772 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PSMC1 (Chlorocebus sabaeus - green monkey)
Psmc1 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 214 Count of miRNA genes: 143 Interacting mature miRNAs: 162 Transcripts: ENSRNOT00000005329 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 1331797 Bp213 Blood pressure QTL 213 3.291 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 104085867 128713626 Rat 4145118 Mcs26 Mammary carcinoma susceptibility QTL 26 0.0001 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 106752656 132339866 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 71111 Iddm8 Insulin dependent diabetes mellitus QTL 8 1.9 0.002 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 6 105156861 140994061 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 1358355 Srcrt4 Stress Responsive Cort QTL 4 6.39 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 100364669 140994061 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 737976 Pia24 Pristane induced arthritis QTL 24 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 6 112636280 140994061 Rat 1298087 Iddm18 Insulin dependent diabetes mellitus QTL 18 0.0001 urine glucose amount (VT:0001758) percentage of study population developing diabetes mellitus during a period of time (CMO:0001114) 6 116506292 130245370 Rat 2313399 Anxrr28 Anxiety related response QTL 28 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 6 100671796 132340886 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 1331725 Bp212 Blood pressure QTL 212 3.52475 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 93701310 128713626 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat
BE107583
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 119,403,531 - 119,403,747 (+) MAPPER mRatBN7.2 Rnor_6.0 6 124,133,944 - 124,134,159 NCBI Rnor6.0 Rnor_5.0 6 133,361,239 - 133,361,454 UniSTS Rnor5.0 RGSC_v3.4 6 124,391,637 - 124,391,852 UniSTS RGSC3.4 Celera 6 116,933,521 - 116,933,736 UniSTS RH 3.4 Map 6 856.9 UniSTS Cytogenetic Map 6 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005329 ⟹ ENSRNOP00000005329
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 119,392,855 - 119,405,233 (+) Ensembl Rnor_6.0 Ensembl 6 124,123,228 - 124,135,658 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113995 ⟹ ENSRNOP00000095712
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 119,393,070 - 119,410,123 (+) Ensembl
RefSeq Acc Id:
NM_057123 ⟹ NP_476464
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 125,122,497 - 125,134,859 (+) NCBI mRatBN7.2 6 119,392,869 - 119,405,233 (+) NCBI Rnor_6.0 6 124,123,283 - 124,135,644 (+) NCBI Rnor_5.0 6 133,350,578 - 133,362,939 (+) NCBI RGSC_v3.4 6 124,380,976 - 124,393,338 (+) RGD Celera 6 116,922,860 - 116,935,222 (+) RGD
Sequence:
ACGACTGAAGGAGAGATGGGTCAAAGTCAGAGTGGTGGCCATGGTCCTGGGGGTGGCAAGAAGGATGACAAGGACAAGAAAAAGAAATATGAACCTCCTGTCCCAACTAGAGTGGGGAAAAAGAAGAA GAAAACCAAGGGACCAGATGCTGCCAGCAAACTGCCACTGGTAACACCTCACACCCAGTGCCGCCTGAAATTACTAAAGCTGGAGAGAATAAAAGACTATCTTCTCATGGAGGAAGAATTCATTAGAA ATCAGGAACAGATGAAACCACTAGAAGAAAAGCAAGAGGAGGAAAGATCAAAGGTGGATGATCTTAGGGGAACCCCGATGTCTGTAGGAACCTTGGAAGAGATCATCGATGATAATCACGCCATTGTG TCCACATCGGTGGGCTCAGAACACTACGTCAGCATCCTGTCATTTGTAGACAAGGATCTGCTGGAACCGGGCTGTTCAGTCCTGCTCAACCACAAGGTGCATGCTGTGATAGGGGTGCTCATGGATGA CACGGATCCCCTGGTCACAGTGATGAAGGTGGAAAAGGCCCCCCAGGAAACCTATGCAGATATTGGGGGACTGGACAACCAGATCCAGGAAATTAAGGAATCTGTGGAGCTCCCTCTTACCCACCCTG AGTATTATGAGGAGATGGGGATAAAACCACCTAAGGGGGTCATTCTCTACGGCCCGCCAGGAACAGGTAAAACTCTATTGGCCAAAGCAGTAGCGAACCAGACTTCAGCGACTTTCTTGCGAGTGGTT GGCTCAGAGCTTATTCAGAAGTACCTAGGTGACGGGCCCAAGCTGGTCCGGGAGCTCTTCCGGGTCGCTGAGGAACACGCACCGTCCATTGTGTTCATTGATGAAATCGACGCCATTGGGACCAAAAG ATATGATTCAAACTCTGGAGGTGAGCGGGAAATCCAGCGGACAATGTTGGAACTGTTGAACCAGTTGGATGGATTTGATTCGAGGGGAGATGTAAAAGTTATCATGGCCACAAACCGAATAGAAACTT TGGATCCAGCACTTATCAGACCAGGCCGCATTGACAGAAAGATCGAGTTCCCCCTGCCTGATGAAAAGACCAAGAAGCGCATCTTCCAGATCCACACAAGCAGGATGACGCTGGCTGATGATGTAACC TTGGATGACTTGATCATGGCAAAGGATGACCTCTCTGGGGCTGACATCAAGGCAATCTGCACAGAGGCTGGCTTGATGGCTCTGCGGGAACGCAGGATGAAAGTGACAAACGAAGACTTCAAGAAATC TAAGGAGAACGTTCTGTATAAAAAACAAGAAGGCACCCCTGAGGGGCTGTATCTCTAGTGACACAGTTGTCTTCAGGGAACTTAATGAGTTTCCCCCACCTGGGAAGATGGGAAGCTGCCCCAAGGAA TCCATCTTCCAGTTAAGTTTTGCTAGTAGAAAGCCCGTGTCGTGGAGGACGCTGTGTGGTCTGTCTCCAATCTGTTGTTGGTCATTGTGCCCTGCAGCTCTCCGCTCCCAATAAAGGATTGTCCTGGT TTGCTTTCTAAAAAAACAAG
hide sequence
RefSeq Acc Id:
NP_476464 ⟸ NM_057123
- UniProtKB:
P62193 (UniProtKB/Swiss-Prot), A6JEG8 (UniProtKB/TrEMBL), A0A8I6APJ8 (UniProtKB/TrEMBL)
- Sequence:
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVG SEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELI QKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLI MAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL
hide sequence
Ensembl Acc Id:
ENSRNOP00000005329 ⟸ ENSRNOT00000005329
Ensembl Acc Id:
ENSRNOP00000095712 ⟸ ENSRNOT00000113995
RGD ID: 13694774
Promoter ID: EPDNEW_R5298
Type: initiation region
Name: Psmc1_1
Description: proteasome 26S subunit, ATPase 1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 124,123,276 - 124,123,336 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-08-19
Psmc1
proteasome 26S subunit, ATPase 1
Psmc1
proteasome (prosome, macropain) 26S subunit, ATPase, 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-12-15
Psmc1
proteasome (prosome, macropain) 26S subunit, ATPase, 1
Psmc1
protease (prosome, macropain) 26S subunit, ATPase 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-02-22
Psmc1
protease (prosome, macropain) 26S subunit, ATPase 1
Psmc1
peptidase (prosome, macropain) 26S subunit, ATPase 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2005-01-20
Psmc1
peptidase (prosome, macropain) 26S subunit, ATPase 1
protease (prosome, macropain) 26S subunit, ATPase 1
Name updated
1299863
APPROVED
2002-08-07
Psmc1
protease (prosome, macropain) 26S subunit, ATPase 1
Symbol and Name status set to provisional
70820
PROVISIONAL