Symbol:
Bard1
Name:
BRCA1 associated RING domain 1
RGD ID:
621072
Description:
Predicted to enable RNA binding activity; protein heterodimerization activity; and protein homodimerization activity. Predicted to contribute to ubiquitin-protein transferase activity. Involved in several processes, including cellular response to follicle-stimulating hormone stimulus; cellular response to testosterone stimulus; and response to aldosterone. Predicted to be located in cytoplasmic ribonucleoprotein granule and nuclear speck. Predicted to be part of nucleus. Biomarker of retinal degeneration. Human ortholog(s) of this gene implicated in breast cancer and ovarian cancer. Orthologous to human BARD1 (BRCA1 associated RING domain 1); INTERACTS WITH 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile; 1-naphthyl isothiocyanate; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
BARD-1; BRCA1-associated RING domain protein 1; RING-type E3 ubiquitin transferase BARD1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 80,069,960 - 80,144,167 (-) NCBI GRCr8 mRatBN7.2 9 72,616,070 - 72,694,553 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 72,623,155 - 72,694,265 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 81,082,647 - 81,149,936 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 86,211,538 - 86,278,825 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 84,594,537 - 84,662,040 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 78,297,723 - 78,368,777 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 78,294,834 - 78,369,031 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 78,074,908 - 78,145,962 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 70,120,151 - 70,198,591 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 70,267,132 - 70,345,573 (-) NCBI Celera 9 70,040,784 - 70,110,644 (-) NCBI Celera Cytogenetic Map 9 q33 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Bard1 Rat (+)-catechin multiple interactions ISO BARD1 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of BARD1 mRNA CTD PMID:24763279 Bard1 Rat (-)-demecolcine decreases expression ISO BARD1 (Homo sapiens) 6480464 Demecolcine results in decreased expression of BARD1 mRNA CTD PMID:23649840 Bard1 Rat 1,2-dichloroethane affects expression ISO Bard1 (Mus musculus) 6480464 ethylene dichloride affects the expression of BARD1 mRNA CTD PMID:28960355 Bard1 Rat 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile decreases expression EXP 6480464 Citalopram results in decreased expression of BARD1 mRNA CTD PMID:28467792 Bard1 Rat 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile decreases expression ISO BARD1 (Homo sapiens) 6480464 Citalopram results in decreased expression of BARD1 mRNA CTD PMID:28467792 Bard1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of BARD1 mRNA CTD PMID:30723492 Bard1 Rat 17beta-estradiol decreases expression ISO Bard1 (Mus musculus) 6480464 Estradiol results in decreased expression of BARD1 mRNA CTD PMID:19484750 Bard1 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of BARD1 mRNA CTD PMID:32741896 Bard1 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of BARD1 mRNA CTD PMID:32741896 Bard1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Bard1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Bard1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:20566336 Bard1 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Bard1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Bard1 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression ISO BARD1 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Bard1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Bard1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of BARD1 mRNA CTD PMID:21570461 Bard1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of BARD1 mRNA CTD PMID:32109520 Bard1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO BARD1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of BARD1 mRNA CTD PMID:22574217 Bard1 Rat 2-hydroxypropanoic acid decreases expression ISO BARD1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of BARD1 mRNA CTD PMID:30851411 Bard1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23196670 Bard1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO BARD1 (Homo sapiens) 6480464 3 more ... CTD PMID:29947894 Bard1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Bard1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of BARD1 mRNA CTD PMID:26251327 Bard1 Rat 3,7-dihydropurine-6-thione decreases expression EXP 6480464 Mercaptopurine results in decreased expression of BARD1 mRNA CTD PMID:23358152 Bard1 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Bard1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of BARD1 mRNA CTD PMID:18648102 Bard1 Rat 4-hydroxyphenyl retinamide decreases expression ISO BARD1 (Homo sapiens) 6480464 Fenretinide results in decreased expression of BARD1 mRNA CTD PMID:16570282 Bard1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of BARD1 mRNA CTD PMID:24780913 and PMID:30047161 Bard1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of BARD1 mRNA CTD PMID:31881176 Bard1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of BARD1 mRNA CTD PMID:28959563 Bard1 Rat aflatoxin B1 affects expression ISO BARD1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of BARD1 protein CTD PMID:20106945 Bard1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of BARD1 mRNA CTD PMID:23630614 and PMID:25378103 Bard1 Rat aflatoxin B1 increases expression ISO BARD1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of BARD1 mRNA CTD PMID:22100608 Bard1 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of BARD1 mRNA CTD PMID:20488242 Bard1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of BARD1 mRNA CTD PMID:30047161 Bard1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of BARD1 mRNA CTD PMID:16483693 Bard1 Rat aristolochic acid A decreases expression ISO BARD1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of BARD1 mRNA CTD PMID:33212167 Bard1 Rat arsane multiple interactions ISO BARD1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of BARD1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of BARD1 mRNA CTD PMID:39836092 Bard1 Rat arsenic atom multiple interactions ISO BARD1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of BARD1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of BARD1 mRNA CTD PMID:39836092 Bard1 Rat azathioprine decreases expression ISO BARD1 (Homo sapiens) 6480464 Azathioprine results in decreased expression of BARD1 mRNA CTD PMID:22623647 Bard1 Rat benzo[a]pyrene decreases expression ISO BARD1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of BARD1 mRNA CTD PMID:20064835 Bard1 Rat benzo[a]pyrene increases expression ISO BARD1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of BARD1 mRNA CTD PMID:32234424 Bard1 Rat benzo[a]pyrene affects methylation ISO BARD1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of BARD1 promoter CTD PMID:27901495 Bard1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO BARD1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20382639 Bard1 Rat benzo[b]fluoranthene increases expression ISO Bard1 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of BARD1 mRNA CTD PMID:26377693 Bard1 Rat bicalutamide decreases expression ISO BARD1 (Homo sapiens) 6480464 bicalutamide results in decreased expression of BARD1 mRNA CTD PMID:15638997 Bard1 Rat bis(2-chloroethyl) sulfide decreases expression ISO BARD1 (Homo sapiens) 6480464 Mustard Gas results in decreased expression of BARD1 mRNA CTD PMID:33491125 Bard1 Rat bisphenol A increases expression ISO BARD1 (Homo sapiens) 6480464 bisphenol A results in increased expression of BARD1 mRNA CTD PMID:22576693 Bard1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of BARD1 mRNA CTD PMID:32145629 Bard1 Rat bisphenol A decreases expression ISO BARD1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of BARD1 mRNA CTD PMID:29275510 Bard1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of BARD1 mRNA CTD PMID:25181051 Bard1 Rat bortezomib increases response to substance ISO BARD1 (Homo sapiens) 6480464 BARD1 mutant form results in increased susceptibility to Bortezomib CTD PMID:25522274 Bard1 Rat cadmium dichloride decreases expression ISO BARD1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of BARD1 mRNA CTD PMID:12160620 and PMID:38568856 Bard1 Rat caffeine decreases phosphorylation ISO BARD1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of BARD1 protein CTD PMID:35688186 Bard1 Rat calcitriol decreases expression ISO BARD1 (Homo sapiens) 6480464 Calcitriol results in decreased expression of BARD1 mRNA CTD PMID:21592394 Bard1 Rat calcitriol multiple interactions ISO BARD1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of BARD1 mRNA CTD PMID:21592394 Bard1 Rat carbamazepine affects expression ISO BARD1 (Homo sapiens) 6480464 Carbamazepine affects the expression of BARD1 mRNA CTD PMID:24752500 Bard1 Rat carbon nanotube increases expression ISO Bard1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Bard1 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of BARD1 mRNA CTD PMID:18500788 Bard1 Rat cisplatin increases phosphorylation ISO Bard1 (Mus musculus) 6480464 Cisplatin results in increased phosphorylation of BARD1 protein CTD PMID:22006019 Bard1 Rat cisplatin decreases expression ISO BARD1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of BARD1 mRNA CTD PMID:27392435 Bard1 Rat cisplatin multiple interactions ISO BARD1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of BARD1 mRNA CTD PMID:27392435 Bard1 Rat cisplatin increases expression ISO BARD1 (Homo sapiens) 6480464 Cisplatin results in increased expression of BARD1 mRNA CTD PMID:27594783 Bard1 Rat citalopram decreases expression EXP 6480464 Citalopram results in decreased expression of BARD1 mRNA CTD PMID:28467792 Bard1 Rat citalopram decreases expression ISO BARD1 (Homo sapiens) 6480464 Citalopram results in decreased expression of BARD1 mRNA CTD PMID:28467792 Bard1 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of BARD1 mRNA CTD PMID:24386269 Bard1 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of BARD1 mRNA CTD PMID:26033743 Bard1 Rat copper atom multiple interactions ISO BARD1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of BARD1 mRNA CTD PMID:20971185 Bard1 Rat copper atom multiple interactions EXP 6480464 [Copper co-treated with Dietary Sucrose] results in increased expression of BARD1 mRNA CTD PMID:26033743 Bard1 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of BARD1 mRNA CTD PMID:26033743 Bard1 Rat copper(0) multiple interactions ISO BARD1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of BARD1 mRNA CTD PMID:20971185 Bard1 Rat copper(0) multiple interactions EXP 6480464 [Copper co-treated with Dietary Sucrose] results in increased expression of BARD1 mRNA CTD PMID:26033743 Bard1 Rat copper(II) sulfate increases expression ISO BARD1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of BARD1 mRNA CTD PMID:19549813 Bard1 Rat coumestrol multiple interactions ISO BARD1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Bard1 Rat coumestrol increases expression ISO BARD1 (Homo sapiens) 6480464 Coumestrol results in increased expression of BARD1 mRNA CTD PMID:19167446 Bard1 Rat CU-O LINKAGE decreases expression ISO BARD1 (Homo sapiens) 6480464 cupric oxide results in decreased expression of BARD1 mRNA CTD PMID:22077320 Bard1 Rat cyclosporin A decreases expression ISO BARD1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of BARD1 mRNA CTD PMID:20106945 and PMID:21632981 Bard1 Rat cyclosporin A affects expression ISO BARD1 (Homo sapiens) 6480464 Cyclosporine affects the expression of BARD1 mRNA CTD PMID:25562108 Bard1 Rat daunorubicin affects expression ISO BARD1 (Homo sapiens) 6480464 Daunorubicin affects the expression of BARD1 mRNA CTD PMID:12656675 Bard1 Rat dibenzofuran decreases expression EXP 6480464 dibenzofuran analog results in decreased expression of BARD1 mRNA CTD PMID:20566336 Bard1 Rat dichloroacetic acid increases expression ISO Bard1 (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of BARD1 mRNA CTD PMID:28962523 Bard1 Rat diclofenac affects expression ISO BARD1 (Homo sapiens) 6480464 Diclofenac affects the expression of BARD1 mRNA CTD PMID:24752500 Bard1 Rat doxorubicin multiple interactions EXP 6480464 Fungal Polysaccharides inhibits the reaction [Doxorubicin results in decreased expression of BARD1 mRNA] CTD PMID:27181935 Bard1 Rat doxorubicin decreases expression ISO BARD1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of BARD1 mRNA CTD PMID:36634904 Bard1 Rat doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of BARD1 mRNA CTD PMID:27181935 Bard1 Rat elemental selenium decreases expression ISO BARD1 (Homo sapiens) 6480464 Selenium results in decreased expression of BARD1 mRNA CTD PMID:19244175 Bard1 Rat Enterolactone multiple interactions ISO BARD1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of BARD1 mRNA CTD PMID:19167446 Bard1 Rat escitalopram decreases expression EXP 6480464 Escitalopram results in decreased expression of BARD1 mRNA CTD PMID:28467792 Bard1 Rat escitalopram decreases expression ISO BARD1 (Homo sapiens) 6480464 Escitalopram results in decreased expression of BARD1 mRNA CTD PMID:28467792 Bard1 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of BARD1 mRNA CTD PMID:18035473 Bard1 Rat folic acid decreases expression ISO Bard1 (Mus musculus) 6480464 Folic Acid results in decreased expression of BARD1 mRNA CTD PMID:25629700 Bard1 Rat formaldehyde decreases expression ISO BARD1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of BARD1 mRNA CTD PMID:23649840 Bard1 Rat FR900359 affects phosphorylation ISO BARD1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of BARD1 protein CTD PMID:37730182 Bard1 Rat furan increases expression EXP 6480464 furan results in increased expression of BARD1 mRNA CTD PMID:25539665 Bard1 Rat gallic acid decreases expression ISO BARD1 (Homo sapiens) 6480464 Gallic Acid results in decreased expression of BARD1 mRNA CTD PMID:34408198 Bard1 Rat Lasiocarpine multiple interactions ISO BARD1 (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of lasiocarpine] which results in decreased expression of BARD1 mRNA CTD PMID:33884520 Bard1 Rat manganese atom multiple interactions ISO BARD1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of BARD1 mRNA CTD PMID:39836092 Bard1 Rat manganese(0) multiple interactions ISO BARD1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of BARD1 mRNA CTD PMID:39836092 Bard1 Rat manganese(II) chloride multiple interactions ISO BARD1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of BARD1 mRNA CTD PMID:39836092 Bard1 Rat mercaptopurine decreases expression EXP 6480464 Mercaptopurine results in decreased expression of BARD1 mRNA CTD PMID:23358152 Bard1 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of BARD1 mRNA CTD PMID:28341135 Bard1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of BARD1 mRNA CTD PMID:30047161 Bard1 Rat methyl methanesulfonate increases expression ISO BARD1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of BARD1 mRNA CTD PMID:23649840 Bard1 Rat methylmercury chloride decreases expression ISO BARD1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of BARD1 mRNA CTD PMID:28001369 Bard1 Rat mono(2-ethylhexyl) phthalate decreases expression ISO BARD1 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of BARD1 mRNA CTD PMID:38685446 Bard1 Rat monocrotaline multiple interactions ISO BARD1 (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of Monocrotaline] which results in decreased expression of BARD1 mRNA CTD PMID:33884520 Bard1 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of BARD1 mRNA CTD PMID:23358140 Bard1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of BARD1 mRNA CTD PMID:25729387 Bard1 Rat ozone multiple interactions ISO Bard1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of BARD1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of BARD1 mRNA CTD PMID:34911549 Bard1 Rat palbociclib decreases expression ISO BARD1 (Homo sapiens) 6480464 palbociclib results in decreased expression of BARD1 mRNA CTD PMID:22869556 and PMID:28620137 Bard1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of BARD1 mRNA CTD PMID:33387578 Bard1 Rat paraquat multiple interactions ISO Bard1 (Mus musculus) 6480464 [ATG7 protein affects the susceptibility to Paraquat] which affects the expression of BARD1 mRNA CTD PMID:28012437 Bard1 Rat PCB138 multiple interactions ISO Bard1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Bard1 Rat piroxicam decreases expression ISO BARD1 (Homo sapiens) 6480464 Piroxicam results in decreased expression of BARD1 mRNA CTD PMID:21858171 Bard1 Rat pravastatin decreases expression EXP 6480464 Pravastatin results in decreased expression of BARD1 mRNA CTD PMID:27225895 Bard1 Rat pravastatin affects expression ISO Bard1 (Mus musculus) 6480464 Pravastatin affects the expression of BARD1 mRNA CTD PMID:27225895 Bard1 Rat propanal decreases expression ISO BARD1 (Homo sapiens) 6480464 propionaldehyde results in decreased expression of BARD1 mRNA CTD PMID:26079696 Bard1 Rat purine-6-thiol decreases expression EXP 6480464 Mercaptopurine results in decreased expression of BARD1 mRNA CTD PMID:23358152 Bard1 Rat rac-lactic acid decreases expression ISO BARD1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of BARD1 mRNA CTD PMID:30851411 Bard1 Rat resveratrol multiple interactions ISO BARD1 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of BARD1 mRNA CTD PMID:19167446 Bard1 Rat resveratrol decreases expression EXP 6480464 Resveratrol results in decreased expression of BARD1 mRNA CTD PMID:33775663 Bard1 Rat riddelliine multiple interactions ISO BARD1 (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of riddelliine] which results in decreased expression of BARD1 mRNA CTD PMID:33884520 Bard1 Rat rotenone increases expression ISO BARD1 (Homo sapiens) 6480464 Rotenone results in increased expression of BARD1 mRNA CTD PMID:18191903 Bard1 Rat selenium atom decreases expression ISO BARD1 (Homo sapiens) 6480464 Selenium results in decreased expression of BARD1 mRNA CTD PMID:19244175 Bard1 Rat silver atom decreases expression ISO BARD1 (Homo sapiens) 6480464 Silver results in decreased expression of BARD1 mRNA CTD PMID:26014281 Bard1 Rat silver(0) decreases expression ISO BARD1 (Homo sapiens) 6480464 Silver results in decreased expression of BARD1 mRNA CTD PMID:26014281 Bard1 Rat sodium arsenite decreases expression ISO Bard1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of BARD1 mRNA CTD PMID:36209798 Bard1 Rat sodium arsenite multiple interactions ISO BARD1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of BARD1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of BARD1 mRNA CTD PMID:39836092 Bard1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of BARD1 mRNA CTD PMID:30047161 Bard1 Rat tamoxifen increases expression ISO BARD1 (Homo sapiens) 6480464 Tamoxifen results in increased expression of BARD1 mRNA CTD PMID:15590111 Bard1 Rat temozolomide increases expression ISO BARD1 (Homo sapiens) 6480464 Temozolomide results in increased expression of BARD1 mRNA CTD PMID:31758290 Bard1 Rat testosterone multiple interactions ISO BARD1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of BARD1 mRNA CTD PMID:21592394 Bard1 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of BARD1 mRNA CTD PMID:32741896 Bard1 Rat testosterone decreases expression ISO BARD1 (Homo sapiens) 6480464 Testosterone results in decreased expression of BARD1 mRNA CTD PMID:21592394 Bard1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of BARD1 mRNA CTD PMID:22659510 Bard1 Rat titanium dioxide multiple interactions ISO BARD1 (Homo sapiens) 6480464 [Vitallium analog binds to titanium dioxide] which results in decreased expression of BARD1 mRNA CTD PMID:23825117 Bard1 Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of BARD1 mRNA CTD PMID:30012374 Bard1 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of BARD1 mRNA CTD PMID:25729387 Bard1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of BARD1 mRNA CTD PMID:25729387 Bard1 Rat triadimefon increases expression EXP 6480464 triadimefon results in increased expression of BARD1 mRNA CTD PMID:30047161 Bard1 Rat trichloroethene increases expression ISO Bard1 (Mus musculus) 6480464 Trichloroethylene results in increased expression of BARD1 mRNA CTD PMID:25549359 Bard1 Rat trimellitic anhydride increases expression ISO Bard1 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of BARD1 mRNA CTD PMID:19042947 Bard1 Rat triphenyl phosphate affects expression ISO BARD1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of BARD1 mRNA CTD PMID:37042841 Bard1 Rat trovafloxacin decreases expression ISO Bard1 (Mus musculus) 6480464 trovafloxacin results in decreased expression of BARD1 mRNA CTD PMID:35537566 Bard1 Rat valproic acid decreases expression ISO BARD1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of BARD1 mRNA CTD PMID:23179753 and PMID:28001369 Bard1 Rat valproic acid increases expression ISO BARD1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of BARD1 mRNA CTD PMID:29154799 Bard1 Rat valproic acid affects expression ISO BARD1 (Homo sapiens) 6480464 Valproic Acid affects the expression of BARD1 mRNA CTD PMID:25979313 Bard1 Rat vincristine decreases expression ISO BARD1 (Homo sapiens) 6480464 Vincristine results in decreased expression of BARD1 mRNA CTD PMID:23649840 Bard1 Rat vitamin E decreases expression ISO BARD1 (Homo sapiens) 6480464 Vitamin E results in decreased expression of BARD1 mRNA CTD PMID:19244175 Bard1 Rat zaragozic acid A decreases expression EXP 6480464 squalestatin 1 results in decreased expression of BARD1 mRNA CTD PMID:27225895 Bard1 Rat zaragozic acid A decreases expression ISO Bard1 (Mus musculus) 6480464 squalestatin 1 results in decreased expression of BARD1 mRNA CTD PMID:27225895
(+)-catechin (ISO) (-)-demecolcine (ISO) 1,2-dichloroethane (ISO) 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (EXP,ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 3,7-dihydropurine-6-thione (EXP) 4,4'-diaminodiphenylmethane (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (EXP) amitrole (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) azathioprine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (ISO) bicalutamide (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bortezomib (ISO) cadmium dichloride (ISO) caffeine (ISO) calcitriol (ISO) carbamazepine (ISO) carbon nanotube (ISO) cefaloridine (EXP) cisplatin (ISO) citalopram (EXP,ISO) cobalt dichloride (EXP) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (ISO) coumestrol (ISO) CU-O LINKAGE (ISO) cyclosporin A (ISO) daunorubicin (ISO) dibenzofuran (EXP) dichloroacetic acid (ISO) diclofenac (ISO) doxorubicin (EXP,ISO) elemental selenium (ISO) Enterolactone (ISO) escitalopram (EXP,ISO) flavonoids (EXP) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) furan (EXP) gallic acid (ISO) Lasiocarpine (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercaptopurine (EXP) methamphetamine (EXP) methimazole (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) monocrotaline (ISO) ochratoxin A (EXP) oxaliplatin (EXP) ozone (ISO) palbociclib (ISO) paracetamol (EXP) paraquat (ISO) PCB138 (ISO) piroxicam (ISO) pravastatin (EXP,ISO) propanal (ISO) purine-6-thiol (EXP) rac-lactic acid (ISO) resveratrol (EXP,ISO) riddelliine (ISO) rotenone (ISO) selenium atom (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) tamoxifen (ISO) temozolomide (ISO) testosterone (EXP,ISO) thioacetamide (EXP) titanium dioxide (EXP,ISO) topotecan (EXP) triadimefon (EXP) trichloroethene (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) trovafloxacin (ISO) valproic acid (ISO) vincristine (ISO) vitamin E (ISO) zaragozic acid A (EXP,ISO)
Biological Process
cellular response to follicle-stimulating hormone stimulus (IEP) cellular response to ionizing radiation (IEA,ISO) cellular response to oxidative stress (IEP) cellular response to testosterone stimulus (IEP) DNA damage response (IEA) DNA repair (IEA) negative regulation of apoptotic process (IEA,ISO,ISS) negative regulation of protein export from nucleus (IEA,ISO,ISS) positive regulation of apoptotic process (IDA,IEA,ISO,ISS) protein K6-linked ubiquitination (IBA,IEA,ISO,ISS) protein ubiquitination (IEA) regulation of phosphorylation (ISO,ISS) response to aldosterone (IEP) spermatogenesis (IEP)
Cellular Component
BRCA1-A complex (IBA,IEA,ISO) BRCA1-B complex (IEA,ISO) BRCA1-BARD1 complex (IBA,IEA,ISO,ISS) BRCA1-C complex (IEA,ISO) cytoplasm (IEA,ISO,ISS) cytoplasmic ribonucleoprotein granule (IEA,ISO) nuclear speck (IEA,ISO) nuclear ubiquitin ligase complex (IEA,ISO) nucleoplasm (IEA,ISO) nucleus (IEA,ISO,ISS)
1.
BARD1 expression during spermatogenesis is associated with apoptosis and hormonally regulated.
Feki A, etal., Biol Reprod. 2004 Nov;71(5):1614-24. Epub 2004 Jul 7.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Identification of an apoptotic cleavage product of BARD1 as an autoantigen: a potential factor in the antitumoral response mediated by apoptotic bodies.
Gautier F, etal., Cancer Res 2000 Dec 15;60(24):6895-900.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
BARD1 variants are not associated with breast cancer risk in Australian familial breast cancer.
Gorringe KL, etal., Breast Cancer Res Treat. 2008 Oct;111(3):505-9. Epub 2007 Oct 31.
6.
Assignment of the BRCA1-associated RING domain gene (Bard1) to rat chromosome 9q34 by in situ hybridization and radiation hybrid mapping.
Gratas C, etal., Cytogenet Cell Genet 2001;94(3-4):250-1.
7.
Common non-synonymous polymorphisms in the BRCA1 Associated RING Domain (BARD1) gene are associated with breast cancer susceptibility: a case-control analysis.
Huo X, etal., Breast Cancer Res Treat. 2007 May;102(3):329-37. Epub 2006 Sep 21.
8.
BARD1 content correlates with increased DNA fragmentation associated with muscle wasting in tumour-bearing rats.
Irminger-Finger I, etal., Oncol Rep. 2006 Jun;15(6):1425-8.
9.
Mutational analysis of BARD1 in familial breast cancer patients in Japan.
Ishitobi M, etal., Cancer Lett. 2003 Oct 8;200(1):1-7.
10.
BARD1 and breast cancer in Poland.
Jakubowska A, etal., Breast Cancer Res Treat. 2008 Jan;107(1):119-22. Epub 2007 Feb 27.
11.
Effect of propofol on cardiac function and gene expression after ischemic-reperfusion in isolated rat heart.
Kim YJ, etal., Korean J Anesthesiol. 2010 Feb;58(2):153-61. doi: 10.4097/kjae.2010.58.2.153. Epub 2010 Feb 28.
12.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
13.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
15.
Gene expression changes in the retina after systemic administration of aldosterone.
Ono A, etal., Jpn J Ophthalmol. 2018 Jul;62(4):499-507. doi: 10.1007/s10384-018-0595-4. Epub 2018 Apr 30.
16.
GOA pipeline
RGD automated data pipeline
17.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
18.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
19.
Comprehensive gene review and curation
RGD comprehensive gene curation
20.
Assessment of citalopram and escitalopram on neuroblastoma cell lines. Cell toxicity and gene modulation.
Sakka L, etal., Oncotarget. 2017 Jun 27;8(26):42789-42807. doi: 10.18632/oncotarget.17050.
21.
The basal-like mammary carcinomas induced by Brca1 or Bard1 inactivation implicate the BRCA1/BARD1 heterodimer in tumor suppression.
Shakya R, etal., Proc Natl Acad Sci U S A. 2008 May 13;105(19):7040-5. Epub 2008 Apr 28.
22.
miR-21 enhances the protective effect of loperamide on rat cardiomyocytes against hypoxia/reoxygenation, reactive oxygen species production and apoptosis via regulating Akap8 and Bard1 expression.
Shen H, etal., Exp Ther Med. 2019 Feb;17(2):1312-1320. doi: 10.3892/etm.2018.7047. Epub 2018 Dec 5.
23.
The BARD1 Cys557Ser variant and breast cancer risk in Iceland.
Stacey SN, etal., PLoS Med. 2006 Jul;3(7):e217.
24.
BARD1 variants Cys557Ser and Val507Met in breast cancer predisposition.
Vahteristo P, etal., Eur J Hum Genet. 2006 Feb;14(2):167-72.
25.
Aberrant expression of BARD1 in breast and ovarian cancers with poor prognosis.
Wu JY, etal., Int J Cancer. 2006 Mar 1;118(5):1215-26.
26.
BARD1: an independent predictor of survival in non-small cell lung cancer.
Zhang YQ, etal., Int J Cancer. 2012 Jul 1;131(1):83-94. doi: 10.1002/ijc.26346. Epub 2011 Dec 21.
Bard1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 80,069,960 - 80,144,167 (-) NCBI GRCr8 mRatBN7.2 9 72,616,070 - 72,694,553 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 72,623,155 - 72,694,265 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 81,082,647 - 81,149,936 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 86,211,538 - 86,278,825 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 84,594,537 - 84,662,040 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 78,297,723 - 78,368,777 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 78,294,834 - 78,369,031 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 78,074,908 - 78,145,962 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 70,120,151 - 70,198,591 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 70,267,132 - 70,345,573 (-) NCBI Celera 9 70,040,784 - 70,110,644 (-) NCBI Celera Cytogenetic Map 9 q33 NCBI
BARD1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 214,725,646 - 214,809,683 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 214,725,646 - 214,809,683 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 215,590,370 - 215,674,407 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 215,301,507 - 215,382,673 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 215,418,782 - 215,499,872 NCBI Celera 2 209,361,498 - 209,442,679 (-) NCBI Celera Cytogenetic Map 2 q35 NCBI HuRef 2 207,449,412 - 207,530,541 (-) NCBI HuRef CHM1_1 2 215,599,651 - 215,680,793 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 215,210,222 - 215,294,294 (-) NCBI T2T-CHM13v2.0
Bard1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 71,066,694 - 71,142,300 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 71,066,657 - 71,142,305 (-) Ensembl GRCm39 Ensembl GRCm38 1 71,027,535 - 71,103,141 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 71,027,498 - 71,103,146 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 71,074,109 - 71,149,546 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 70,963,575 - 71,036,126 (-) NCBI MGSCv36 mm8 Celera 1 71,583,694 - 71,658,621 (-) NCBI Celera Cytogenetic Map 1 C3 NCBI cM Map 1 35.67 NCBI
Bard1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955457 1,187,942 - 1,253,803 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955457 1,187,942 - 1,258,475 (+) NCBI ChiLan1.0 ChiLan1.0
BARD1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 117,351,232 - 117,435,613 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 117,366,194 - 117,450,575 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 101,984,287 - 102,068,523 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 220,456,972 - 220,541,145 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 220,456,972 - 220,541,145 (-) Ensembl panpan1.1 panPan2
LOC102156002 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 2,420,559 - 2,423,280 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 2,362,772 - 2,365,405 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 2,529,629 - 2,532,157 (-) NCBI ROS_Cfam_1.0 UNSW_CanFamBas_1.0 8 2,279,602 - 2,282,127 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 2,546,112 - 2,548,640 (-) NCBI UU_Cfam_GSD_1.0
Bard1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 170,353,079 - 170,425,653 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936586 2,200,205 - 2,273,307 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936586 2,200,211 - 2,272,781 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BARD1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 117,047,845 - 117,175,851 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 117,049,483 - 117,135,889 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 129,595,080 - 129,678,129 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BARD1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 100,539,827 - 100,627,718 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 100,539,527 - 100,627,675 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 98,755,214 - 98,840,147 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bard1
.
Predicted Target Of
Count of predictions: 98 Count of miRNA genes: 86 Interacting mature miRNAs: 89 Transcripts: ENSRNOT00000020414 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7411571 Bw138 Body weight QTL 138 14.3 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 9 32535505 77535505 Rat 11353957 Bmd92 Bone mineral density QTL 92 0.01 tibia mineral mass (VT:1000283) volumetric bone mineral density (CMO:0001553) 9 46114199 91114199 Rat 61385 Edpm9 Estrogen-dependent pituitary mass QTL 9 3.43 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 63869687 108869687 Rat 70218 Cm28 Cardiac mass QTL 28 8.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 9 25268044 79271759 Rat 724544 Uae9 Urinary albumin excretion QTL 9 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 9 25268044 114175309 Rat 1578760 Cm53 Cardiac mass QTL 53 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 9 56771635 101771635 Rat 1581580 Uae34 Urinary albumin excretion QTL 34 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 62072275 96470995 Rat 12879506 Pur33 Proteinuria QTL 33 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 44649921 89649921 Rat 731164 Uae25 Urinary albumin excretion QTL 25 3.5 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 25661188 100929786 Rat 10058949 Gmadr5 Adrenal mass QTL 5 2 0.014 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 9 42791513 87976209 Rat 1578757 Pur6 Proteinuria QTL 6 3.3 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 62072275 96470995 Rat 631656 Bp108 Blood pressure QTL 108 5.97 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 48598251 93598251 Rat 2303170 Bp332 Blood pressure QTL 332 3.73 0.027 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 9 55847841 77026453 Rat 8662828 Vetf6 Vascular elastic tissue fragility QTL 6 3.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 9 36962359 92058970 Rat 61352 Bp34 Blood pressure QTL 34 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 42495343 79271511 Rat 724515 Uae16 Urinary albumin excretion QTL 16 8 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 58163035 100929646 Rat 731171 Glom6 Glomerulus QTL 6 2.8 0.0003 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 9 64573531 109573531 Rat 1598834 Memor11 Memory QTL 11 2.5 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 9 36962359 77814038 Rat 70186 Niddm26 Non-insulin dependent diabetes mellitus QTL 26 3.87 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 9 22071169 86369743 Rat 7207814 Bmd91 Bone mineral density QTL 91 3.5 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 9 23754144 83851531 Rat 6903941 Pur31 Proteinuria QTL 31 0.036 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 9 40194188 85194188 Rat 2303180 Bp333 Blood pressure QTL 333 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 56627713 78595166 Rat 2290450 Scl57 Serum cholesterol level QTL 57 4.15 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 9 36962359 95410867 Rat 11353949 Bp393 Blood pressure QTL 393 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 40194188 85194188 Rat 11353951 Bp394 Blood pressure QTL 394 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 44649921 89649921 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 1300134 Bp185 Blood pressure QTL 185 3.73 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 9 61381434 104821652 Rat 7411656 Foco26 Food consumption QTL 26 9.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 32535505 77535505 Rat
D9Rat155
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 9 80,074,851 - 80,075,066 (+) Marker Load Pipeline mRatBN7.2 9 72,625,378 - 72,625,593 (+) MAPPER mRatBN7.2 Rnor_6.0 9 78,299,947 - 78,300,161 NCBI Rnor6.0 Rnor_5.0 9 78,077,132 - 78,077,346 UniSTS Rnor5.0 RGSC_v3.4 9 70,122,374 - 70,122,589 RGD RGSC3.4 RGSC_v3.4 9 70,122,375 - 70,122,589 UniSTS RGSC3.4 RGSC_v3.1 9 70,269,356 - 70,269,571 RGD Celera 9 70,043,008 - 70,043,222 UniSTS SHRSP x BN Map 9 50.0498 UniSTS SHRSP x BN Map 9 50.0498 RGD Cytogenetic Map 9 q33 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
49
113
90
89
58
25
58
6
216
96
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020414 ⟹ ENSRNOP00000020414
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 72,623,178 - 72,694,265 (-) Ensembl Rnor_6.0 Ensembl 9 78,297,871 - 78,368,777 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000087870 ⟹ ENSRNOP00000075183
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 72,623,155 - 72,694,265 (-) Ensembl Rnor_6.0 Ensembl 9 78,294,834 - 78,369,031 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106928 ⟹ ENSRNOP00000097768
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 72,623,155 - 72,674,328 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000116643 ⟹ ENSRNOP00000079501
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 72,623,155 - 72,694,265 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119929 ⟹ ENSRNOP00000088768
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 72,623,155 - 72,694,265 (-) Ensembl
RefSeq Acc Id:
NM_022622 ⟹ NP_072144
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 80,069,960 - 80,143,755 (-) NCBI mRatBN7.2 9 72,620,487 - 72,694,285 (-) NCBI Rnor_6.0 9 78,297,723 - 78,368,777 (-) NCBI Rnor_5.0 9 78,074,908 - 78,145,962 (-) NCBI RGSC_v3.4 9 70,120,151 - 70,198,591 (-) RGD Celera 9 70,040,784 - 70,110,644 (-) RGD
Sequence:
GAATTCACTAGTGATTATGCCACGCCGGCCGCCGAGGGTCTGCTCCGGGAACAAGCCTCCTCCCGTGCCCGCCATGGAACCAGCTACCGACGGGCTTTGGGCCCACAGCCGTGCGGCGCTTGCCCGTC
hide sequence
RefSeq Acc Id:
XM_039084173 ⟹ XP_038940101
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 80,069,966 - 80,144,167 (-) NCBI mRatBN7.2 9 72,616,070 - 72,694,553 (-) NCBI
RefSeq Acc Id:
XM_039084174 ⟹ XP_038940102
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 80,069,966 - 80,144,167 (-) NCBI mRatBN7.2 9 72,616,070 - 72,694,552 (-) NCBI
RefSeq Acc Id:
XM_039084175 ⟹ XP_038940103
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 80,069,966 - 80,144,167 (-) NCBI mRatBN7.2 9 72,616,070 - 72,694,550 (-) NCBI
RefSeq Acc Id:
XM_039084176 ⟹ XP_038940104
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 80,069,966 - 80,144,167 (-) NCBI mRatBN7.2 9 72,616,070 - 72,694,105 (-) NCBI
RefSeq Acc Id:
XM_063267688 ⟹ XP_063123758
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 80,069,966 - 80,144,167 (-) NCBI
RefSeq Acc Id:
XM_063267689 ⟹ XP_063123759
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 80,096,410 - 80,144,167 (-) NCBI
RefSeq Acc Id:
NP_072144 ⟸ NM_022622
- UniProtKB:
Q9QZH2 (UniProtKB/Swiss-Prot), A0A0G2K9Y6 (UniProtKB/TrEMBL), A6KFF8 (UniProtKB/TrEMBL)
- Sequence:
MPRRPPRVCSGNKPPPVPAMEPATDGLWAHSRAALARLEKLLRCSRCANILREPVCLGGCEHIFCSGCISDCVGSGCPVCHTPAWILDLKINRQLDSMIQLYSKLQNLLHDNKGSDSKDDTSRASLFG
hide sequence
Ensembl Acc Id:
ENSRNOP00000075183 ⟸ ENSRNOT00000087870
Ensembl Acc Id:
ENSRNOP00000020414 ⟸ ENSRNOT00000020414
RefSeq Acc Id:
XP_038940101 ⟸ XM_039084173
- Peptide Label:
isoform X1
- UniProtKB:
Q9QZH2 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038940102 ⟸ XM_039084174
- Peptide Label:
isoform X2
- UniProtKB:
Q9QZH2 (UniProtKB/Swiss-Prot), A0A8I6A6U6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038940103 ⟸ XM_039084175
- Peptide Label:
isoform X4
- UniProtKB:
Q6J724 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038940104 ⟸ XM_039084176
- Peptide Label:
isoform X5
- UniProtKB:
G3V7X7 (UniProtKB/TrEMBL), Q6J724 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000088768 ⟸ ENSRNOT00000119929
Ensembl Acc Id:
ENSRNOP00000079501 ⟸ ENSRNOT00000116643
Ensembl Acc Id:
ENSRNOP00000097768 ⟸ ENSRNOT00000106928
RefSeq Acc Id:
XP_063123758 ⟸ XM_063267688
- Peptide Label:
isoform X3
- UniProtKB:
Q9QZH2 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063123759 ⟸ XM_063267689
- Peptide Label:
isoform X6
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Bard1
BRCA1 associated RING domain 1
BRCA1-associated RING domain protein 1
Name updated
1299863 APPROVED
2002-08-07
Bard1
BRCA1-associated RING domain protein 1
Symbol and Name status set to provisional
70820 PROVISIONAL
