Advanced Search (OLGA)

Gene: Prkcq (protein kinase C, theta) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Prkcq

Name:

protein kinase C, theta

RGD ID:

620968

Description:

Enables protein serine/threonine kinase activity. Involved in several processes, including positive regulation of cellular component biogenesis; positive regulation of protein transport; and response to insulin. Located in neuromuscular junction and sarcolemma. Biomarker of hyperinsulinism and prostate adenocarcinoma. Orthologous to human PRKCQ (protein kinase C theta); PARTICIPATES IN eicosanoid signaling pathway; endothelin signaling pathway; insulin signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acetamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

nPKC-theta; Pkcq; protein kinase C theta type

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PRKCQ (protein kinase C theta)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Prkcq (protein kinase C, theta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Prkcq (protein kinase C theta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PRKCQ (protein kinase C theta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PRKCQ (protein kinase C theta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Prkcq (protein kinase C theta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PRKCQ (protein kinase C theta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PRKCQ (protein kinase C theta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Prkcq (protein kinase C theta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PRKCQ (protein kinase C theta)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Prkcq (protein kinase C, theta)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	prkcq (protein kinase C, theta)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PKC1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tpa-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	prkcq	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	72,156,215 - 72,288,508 (-)	NCBI		GRCr8
mRatBN7.2	17	67,246,394 - 67,379,049 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	67,246,394 - 67,378,704 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	70,722,219 - 70,854,437 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	74,551,031 - 74,683,236 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	68,594,018 - 68,726,228 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	70,971,915 - 71,105,286 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	70,971,915 - 71,105,286 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	72,669,688 - 72,800,895 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	78,486,998 - 78,566,741 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	78,497,951 - 78,520,090 (-)	NCBI
Celera	17	66,745,895 - 66,876,546 (-)	NCBI		Celera
Cytogenetic Map	17	q12.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Prkcq	Rat	Hyperammonemia		IEP		1625610	protein:altered localization:neuron	RGD
Prkcq	Rat	hyperinsulinism		IEP		1625605	associated with Diabetes Mellitus more ...	RGD
Prkcq	Rat	Insulin Resistance		IEP		1625604	protein:altered localization:skeletal muscle	RGD
Prkcq	Rat	Insulin Resistance		IEP		1625603	associated with Obesity and protein:decreased expression:skeletal muscle	RGD
Prkcq	Rat	prostate adenocarcinoma		IEP		1625625	mRNA:increased expression:prostate	RGD
Prkcq	Rat	Sepsis		IEP		1625613	protein:decreased expression:lymphocyte	RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Prkcq	Rat	Crohn's disease		ISO	PRKCQ (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inflammatory bowel disease 1	ClinVar	PMID:25741868
Prkcq	Rat	hypoparathyroidism-deafness-renal disease syndrome		ISO	PRKCQ (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hypoparathyroidism more ...	ClinVar	PMID:25741868
Prkcq	Rat	inflammatory bowel disease 1		ISO	PRKCQ (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inflammatory bowel disease 1	ClinVar	PMID:25741868

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Prkcq	Rat	primary cutaneous T-cell non-Hodgkin lymphoma		ISO	PRKCQ (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:26192916
Prkcq	Rat	retinal detachment		ISO	PRKCQ (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:26978024
Prkcq	Rat	rheumatoid arthritis		ISO	PRKCQ (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:18794853 more ...
Prkcq	Rat	type 1 diabetes mellitus		ISO	PRKCQ (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:18978792

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Prkcq	Rat	retinal detachment		ISS	Prkcq (Mus musculus)	13592920		MouseDO

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Prkcq	Rat	1,2-dichloroethane	increases expression	ISO	Prkcq (Mus musculus)	6480464	ethylene dichloride results in increased expression of PRKCQ mRNA	CTD	PMID:28960355
Prkcq	Rat	1,2-dimethylhydrazine	increases expression	ISO	Prkcq (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of PRKCQ mRNA	CTD	PMID:22206623
Prkcq	Rat	17beta-estradiol	multiple interactions	ISO	PRKCQ (Homo sapiens)	6480464	[Estradiol co-treated with Progesterone] results in increased expression of PRKCQ mRNA	CTD	PMID:20660070
Prkcq	Rat	17beta-estradiol	decreases expression	ISO	Prkcq (Mus musculus)	6480464	Estradiol results in decreased expression of PRKCQ mRNA	CTD	PMID:39298647
Prkcq	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	PRKCQ (Homo sapiens)	6480464	Tetrachlorodibenzodioxin promotes the reaction [VAV1 protein binds to PRKCQ protein]	CTD	PMID:20561557
Prkcq	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Prkcq (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of PRKCQ mRNA	CTD	PMID:33956508
Prkcq	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of PRKCQ mRNA	CTD	PMID:32109520 and PMID:34747641
Prkcq	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases activity	ISO	PRKCQ (Homo sapiens)	6480464	Tetrachlorodibenzodioxin results in increased activity of PRKCQ protein	CTD	PMID:15691325
Prkcq	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects localization	ISO	PRKCQ (Homo sapiens)	6480464	Tetrachlorodibenzodioxin affects the localization of PRKCQ protein	CTD	PMID:15691325
Prkcq	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases response to substance	ISO	PRKCQ (Homo sapiens)	6480464	PRKCQ protein mutant form results in decreased susceptibility to Tetrachlorodibenzodioxin	CTD	PMID:15691325
Prkcq	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of PRKCQ mRNA	CTD	PMID:24780913
Prkcq	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of PRKCQ mRNA	CTD	PMID:31881176
Prkcq	Rat	acrylamide	affects expression	EXP		6480464	Acrylamide affects the expression of PRKCQ mRNA	CTD	PMID:28959563
Prkcq	Rat	aflatoxin B1	increases methylation	ISO	PRKCQ (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of PRKCQ exon and Aflatoxin B1 results in increased methylation of PRKCQ intron	CTD	PMID:30157460
Prkcq	Rat	Aflatoxin B2 alpha	affects methylation	ISO	PRKCQ (Homo sapiens)	6480464	aflatoxin B2 affects the methylation of PRKCQ intron	CTD	PMID:30157460
Prkcq	Rat	all-trans-retinoic acid	multiple interactions	ISO	PRKCQ (Homo sapiens)	6480464	[Tretinoin co-treated with Ascorbic Acid] results in increased expression of PRKCQ mRNA	CTD	PMID:16443354
Prkcq	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PRKCQ mRNA	CTD	PMID:35163327
Prkcq	Rat	alpha-Zearalanol	increases expression	EXP		6480464	Zeranol results in increased expression of PRKCQ mRNA	CTD	PMID:35163327
Prkcq	Rat	alpha-Zearalanol	decreases expression	EXP		6480464	Zeranol results in decreased expression of PRKCQ mRNA	CTD	PMID:35163327
Prkcq	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of PRKCQ mRNA	CTD	PMID:16483693
Prkcq	Rat	aristolochic acid A	decreases expression	ISO	PRKCQ (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of PRKCQ mRNA	CTD	PMID:33212167
Prkcq	Rat	arsane	affects methylation	ISO	PRKCQ (Homo sapiens)	6480464	Arsenic affects the methylation of PRKCQ gene	CTD	PMID:25304211
Prkcq	Rat	arsane	multiple interactions	ISO	PRKCQ (Homo sapiens)	6480464	[Coal results in increased abundance of Arsenic] which results in decreased expression of and results in decreased phosphorylation of PRKCQ protein and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PRKCQ mRNA	CTD	PMID:28823652 and PMID:39836092
Prkcq	Rat	arsenic atom	affects methylation	ISO	PRKCQ (Homo sapiens)	6480464	Arsenic affects the methylation of PRKCQ gene	CTD	PMID:25304211
Prkcq	Rat	arsenic atom	multiple interactions	ISO	PRKCQ (Homo sapiens)	6480464	[Coal results in increased abundance of Arsenic] which results in decreased expression of and results in decreased phosphorylation of PRKCQ protein and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PRKCQ mRNA	CTD	PMID:28823652 and PMID:39836092
Prkcq	Rat	arsenite(3-)	increases expression	ISO	Prkcq (Mus musculus)	6480464	arsenite results in increased expression of PRKCQ mRNA	CTD	PMID:33053406
Prkcq	Rat	atorvastatin calcium	increases expression	EXP		6480464	Atorvastatin results in increased expression of PRKCQ mRNA and Atorvastatin results in increased expression of PRKCQ protein	CTD	PMID:27377005
Prkcq	Rat	Azoxymethane	multiple interactions	ISO	Prkcq (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PRKCQ mRNA	CTD	PMID:29950665
Prkcq	Rat	benzo[a]pyrene	decreases expression	ISO	PRKCQ (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of PRKCQ mRNA	CTD	PMID:21871943
Prkcq	Rat	benzo[a]pyrene	affects methylation	ISO	PRKCQ (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of PRKCQ 5' UTR	CTD	PMID:27901495
Prkcq	Rat	benzo[a]pyrene	decreases expression	ISO	Prkcq (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of PRKCQ mRNA	CTD	PMID:21569818
Prkcq	Rat	benzo[b]fluoranthene	increases expression	ISO	Prkcq (Mus musculus)	6480464	benzo(b)fluoranthene results in increased expression of PRKCQ mRNA	CTD	PMID:26377693
Prkcq	Rat	benzo[e]pyrene	increases methylation	ISO	PRKCQ (Homo sapiens)	6480464	benzo(e)pyrene results in increased methylation of PRKCQ intron	CTD	PMID:30157460
Prkcq	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of PRKCQ mRNA	CTD	PMID:25181051 and PMID:34947998
Prkcq	Rat	cannabidiol	affects expression	EXP		6480464	Cannabidiol affects the expression of PRKCQ mRNA	CTD	PMID:38182033
Prkcq	Rat	carbon nanotube	decreases expression	ISO	Prkcq (Mus musculus)	6480464	Nanotubes and Carbon results in decreased expression of PRKCQ mRNA	CTD	PMID:25554681
Prkcq	Rat	CGP 52608	multiple interactions	ISO	PRKCQ (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to PRKCQ gene]	CTD	PMID:28238834
Prkcq	Rat	cisplatin	increases expression	ISO	PRKCQ (Homo sapiens)	6480464	Cisplatin results in increased expression of PRKCQ mRNA	CTD	PMID:27392435
Prkcq	Rat	copper atom	decreases expression	EXP		6480464	Copper results in decreased expression of PRKCQ mRNA	CTD	PMID:22465980
Prkcq	Rat	copper atom	multiple interactions	ISO	PRKCQ (Homo sapiens)	6480464	[Chelating Agents binds to Copper] which results in decreased expression of PRKCQ mRNA	CTD	PMID:30911355
Prkcq	Rat	copper(0)	decreases expression	EXP		6480464	Copper results in decreased expression of PRKCQ mRNA	CTD	PMID:22465980
Prkcq	Rat	copper(0)	multiple interactions	ISO	PRKCQ (Homo sapiens)	6480464	[Chelating Agents binds to Copper] which results in decreased expression of PRKCQ mRNA	CTD	PMID:30911355
Prkcq	Rat	curcumin	multiple interactions	EXP		6480464	Curcumin inhibits the reaction [Fructose results in increased phosphorylation of PRKCQ protein]	CTD	PMID:26713546
Prkcq	Rat	cyclosporin A	increases methylation	ISO	PRKCQ (Homo sapiens)	6480464	Cyclosporine results in increased methylation of PRKCQ promoter	CTD	PMID:27989131
Prkcq	Rat	dextran sulfate	multiple interactions	ISO	Prkcq (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PRKCQ mRNA	CTD	PMID:29950665
Prkcq	Rat	diazinon	decreases expression	EXP		6480464	Diazinon results in decreased expression of PRKCQ mRNA	CTD	PMID:17452286
Prkcq	Rat	dibutyl phthalate	increases expression	EXP		6480464	Dibutyl Phthalate results in increased expression of PRKCQ mRNA	CTD	PMID:21266533
Prkcq	Rat	disodium selenite	decreases expression	ISO	Prkcq (Mus musculus)	6480464	Sodium Selenite results in decreased expression of PRKCQ mRNA	CTD	PMID:23274088
Prkcq	Rat	diuron	increases expression	EXP		6480464	Diuron results in increased expression of PRKCQ mRNA	CTD	PMID:25152437
Prkcq	Rat	entinostat	increases expression	ISO	PRKCQ (Homo sapiens)	6480464	entinostat results in increased expression of PRKCQ mRNA	CTD	PMID:27188386
Prkcq	Rat	ethanol	increases expression	EXP		6480464	Ethanol results in increased expression of PRKCQ mRNA	CTD	PMID:20655511
Prkcq	Rat	folic acid	decreases expression	ISO	Prkcq (Mus musculus)	6480464	Folic Acid results in decreased expression of PRKCQ mRNA	CTD	PMID:25629700
Prkcq	Rat	fructose	increases phosphorylation	EXP		6480464	Fructose results in increased phosphorylation of PRKCQ protein	CTD	PMID:26713546
Prkcq	Rat	fructose	multiple interactions	EXP		6480464	Curcumin inhibits the reaction [Fructose results in increased phosphorylation of PRKCQ protein]	CTD	PMID:26713546
Prkcq	Rat	genistein	increases expression	ISO	Prkcq (Mus musculus)	6480464	Genistein results in increased expression of PRKCQ mRNA	CTD	PMID:32186404
Prkcq	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of PRKCQ mRNA	CTD	PMID:22061828
Prkcq	Rat	hydrogen peroxide	increases activity	ISO	Prkcq (Mus musculus)	6480464	Hydrogen Peroxide results in increased activity of PRKCQ protein	CTD	PMID:12626342
Prkcq	Rat	ionomycin	multiple interactions	ISO	PRKCQ (Homo sapiens)	6480464	[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased activity of PRKCQ protein and pomalidomide promotes the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased activity of PRKCQ protein]	CTD	PMID:16241859
Prkcq	Rat	L-ascorbic acid	multiple interactions	ISO	PRKCQ (Homo sapiens)	6480464	[Tretinoin co-treated with Ascorbic Acid] results in increased expression of PRKCQ mRNA	CTD	PMID:16443354
Prkcq	Rat	lead diacetate	decreases expression	ISO	Prkcq (Mus musculus)	6480464	lead acetate results in decreased expression of PRKCQ mRNA	CTD	PMID:22613225
Prkcq	Rat	manganese(II) chloride	decreases expression	EXP		6480464	manganese chloride results in decreased expression of PRKCQ mRNA	CTD	PMID:28801915
Prkcq	Rat	manganese(II) chloride	increases methylation	EXP		6480464	manganese chloride results in increased methylation of PRKCQ gene	CTD	PMID:28801915
Prkcq	Rat	mercury atom	decreases expression	ISO	Prkcq (Mus musculus)	6480464	Mercury analog results in decreased expression of PRKCQ mRNA	CTD	PMID:25056781
Prkcq	Rat	mercury(0)	decreases expression	ISO	Prkcq (Mus musculus)	6480464	Mercury analog results in decreased expression of PRKCQ mRNA	CTD	PMID:25056781
Prkcq	Rat	methapyrilene	increases methylation	ISO	PRKCQ (Homo sapiens)	6480464	Methapyrilene results in increased methylation of PRKCQ intron	CTD	PMID:30157460
Prkcq	Rat	N,N-diethyl-m-toluamide	multiple interactions	EXP		6480464	[Permethrin co-treated with DEET] results in increased methylation of PRKCQ gene	CTD	PMID:33148267
Prkcq	Rat	N-methyl-4-phenylpyridinium	decreases expression	EXP		6480464	1-Methyl-4-phenylpyridinium results in decreased expression of PRKCQ mRNA	CTD	PMID:28801915
Prkcq	Rat	N-methyl-4-phenylpyridinium	increases methylation	EXP		6480464	1-Methyl-4-phenylpyridinium results in increased methylation of PRKCQ gene	CTD	PMID:28801915
Prkcq	Rat	nickel atom	increases expression	ISO	PRKCQ (Homo sapiens)	6480464	Nickel results in increased expression of PRKCQ mRNA	CTD	PMID:24768652 and PMID:25583101
Prkcq	Rat	niclosamide	increases expression	ISO	PRKCQ (Homo sapiens)	6480464	Niclosamide results in increased expression of PRKCQ mRNA	CTD	PMID:22576131
Prkcq	Rat	nitrofen	decreases expression	EXP		6480464	nitrofen results in decreased expression of PRKCQ mRNA	CTD	PMID:33484710
Prkcq	Rat	Nor-9-carboxy-delta9-THC	multiple interactions	ISO	PRKCQ (Homo sapiens)	6480464	[Cannabinoids results in increased abundance of 11-nor-delta(9)-tetrahydrocannabinol-9-carboxylic acid] which affects the methylation of PRKCQ gene	CTD	PMID:30521419
Prkcq	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of PRKCQ mRNA	CTD	PMID:25729387
Prkcq	Rat	ozone	multiple interactions	ISO	Prkcq (Mus musculus)	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of PRKCQ mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of PRKCQ mRNA	CTD	PMID:34911549
Prkcq	Rat	paracetamol	multiple interactions	ISO	PRKCQ (Homo sapiens)	6480464	[Dietary Carbohydrates co-treated with Acetaminophen] results in decreased expression of PRKCQ mRNA	CTD	PMID:17093179
Prkcq	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PRKCQ mRNA	CTD	PMID:35163327
Prkcq	Rat	permethrin	multiple interactions	EXP		6480464	[Permethrin co-treated with DEET] results in increased methylation of PRKCQ gene	CTD	PMID:33148267
Prkcq	Rat	phorbol 13-acetate 12-myristate	multiple interactions	ISO	PRKCQ (Homo sapiens)	6480464	[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased activity of PRKCQ protein and pomalidomide promotes the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased activity of PRKCQ protein]	CTD	PMID:16241859
Prkcq	Rat	pioglitazone	multiple interactions	ISO	Prkcq (Mus musculus)	6480464	[N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of PRKCQ mRNA	CTD	PMID:27935865
Prkcq	Rat	pomalidomide	multiple interactions	ISO	PRKCQ (Homo sapiens)	6480464	pomalidomide promotes the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased activity of PRKCQ protein]	CTD	PMID:16241859
Prkcq	Rat	progesterone	multiple interactions	ISO	PRKCQ (Homo sapiens)	6480464	[Estradiol co-treated with Progesterone] results in increased expression of PRKCQ mRNA	CTD	PMID:20660070
Prkcq	Rat	quercetin	increases expression	ISO	PRKCQ (Homo sapiens)	6480464	Quercetin results in increased expression of PRKCQ mRNA	CTD	PMID:15309432
Prkcq	Rat	quercetin	multiple interactions	ISO	PRKCQ (Homo sapiens)	6480464	Quercetin inhibits the reaction [IL1A protein results in increased expression of PRKCQ protein modified form]	CTD	PMID:16532021
Prkcq	Rat	resveratrol	decreases expression	EXP		6480464	resveratrol results in decreased expression of PRKCQ protein	CTD	PMID:17112897
Prkcq	Rat	resveratrol	multiple interactions	EXP		6480464	resveratrol results in decreased phosphorylation of and results in decreased activity of PRKCQ protein	CTD	PMID:23514766
Prkcq	Rat	rottlerin	decreases activity	ISO	PRKCQ (Homo sapiens)	6480464	rottlerin results in decreased activity of PRKCQ protein	CTD	PMID:15691325
Prkcq	Rat	silicon dioxide	increases expression	ISO	Prkcq (Mus musculus)	6480464	Silicon Dioxide results in increased expression of PRKCQ mRNA	CTD	PMID:29341224
Prkcq	Rat	sodium arsenite	affects methylation	ISO	PRKCQ (Homo sapiens)	6480464	sodium arsenite affects the methylation of PRKCQ gene	CTD	PMID:28589171
Prkcq	Rat	sodium arsenite	decreases expression	ISO	Prkcq (Mus musculus)	6480464	sodium arsenite results in decreased expression of PRKCQ mRNA	CTD	PMID:37682722
Prkcq	Rat	sodium arsenite	multiple interactions	ISO	PRKCQ (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PRKCQ mRNA	CTD	PMID:39836092
Prkcq	Rat	sodium fluoride	decreases expression	ISO	Prkcq (Mus musculus)	6480464	Sodium Fluoride results in decreased expression of PRKCQ mRNA	CTD	PMID:21340527
Prkcq	Rat	temozolomide	increases expression	ISO	PRKCQ (Homo sapiens)	6480464	Temozolomide results in increased expression of PRKCQ mRNA	CTD	PMID:31758290
Prkcq	Rat	tert-butyl hydroperoxide	decreases expression	ISO	PRKCQ (Homo sapiens)	6480464	tert-Butylhydroperoxide results in decreased expression of PRKCQ mRNA	CTD	PMID:27509014
Prkcq	Rat	tert-butyl hydroperoxide	increases methylation	ISO	PRKCQ (Homo sapiens)	6480464	tert-Butylhydroperoxide results in increased methylation of PRKCQ gene	CTD	PMID:27509014
Prkcq	Rat	titanium dioxide	multiple interactions	ISO	Prkcq (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PRKCQ mRNA	CTD	PMID:29950665
Prkcq	Rat	titanium dioxide	decreases methylation	ISO	Prkcq (Mus musculus)	6480464	titanium dioxide results in decreased methylation of PRKCQ promoter	CTD	PMID:35295148
Prkcq	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of PRKCQ mRNA	CTD	PMID:25729387
Prkcq	Rat	Tributyltin oxide	decreases expression	ISO	Prkcq (Mus musculus)	6480464	bis(tri-n-butyltin)oxide results in decreased expression of PRKCQ mRNA	CTD	PMID:18958704
Prkcq	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of PRKCQ mRNA	CTD	PMID:33387578
Prkcq	Rat	trichostatin A	increases expression	ISO	PRKCQ (Homo sapiens)	6480464	trichostatin A results in increased expression of PRKCQ mRNA	CTD	PMID:27188386
Prkcq	Rat	triphenyl phosphate	affects expression	ISO	PRKCQ (Homo sapiens)	6480464	triphenyl phosphate affects the expression of PRKCQ mRNA	CTD	PMID:37042841
Prkcq	Rat	triptonide	increases expression	ISO	Prkcq (Mus musculus)	6480464	triptonide results in increased expression of PRKCQ mRNA	CTD	PMID:33045310
Prkcq	Rat	valproic acid	increases expression	ISO	PRKCQ (Homo sapiens)	6480464	Valproic Acid results in increased expression of PRKCQ mRNA	CTD	PMID:23179753 and PMID:24383497
Prkcq	Rat	valproic acid	affects expression	ISO	PRKCQ (Homo sapiens)	6480464	Valproic Acid affects the expression of PRKCQ mRNA	CTD	PMID:25979313
Prkcq	Rat	vanadium atom	decreases expression	ISO	PRKCQ (Homo sapiens)	6480464	Vanadium results in decreased expression of PRKCQ mRNA	CTD	PMID:19000753
Prkcq	Rat	vanadium(0)	decreases expression	ISO	PRKCQ (Homo sapiens)	6480464	Vanadium results in decreased expression of PRKCQ mRNA	CTD	PMID:19000753

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Prkcq	Rat	CD4-positive, alpha-beta T cell proliferation	acts_upstream_of	ISO	Prkcq (Mus musculus)	1624291	MGI:2664379 PMID:12867038	RGD	PMID:12867038
Prkcq	Rat	CD4-positive, alpha-beta T cell proliferation	acts_upstream_of	IEA	UniProtKB:Q02111 and ensembl:ENSMUSP00000028118	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	cell chemotaxis	involved_in	IEA	UniProtKB:Q04759 and ensembl:ENSP00000263125	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	cell chemotaxis	involved_in	ISO	PRKCQ (Homo sapiens)	1624291	PMID:24008408	RGD	PMID:24008408
Prkcq	Rat	immune system process	involved_in	IEA	UniProtKB-KW:KW-0391	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Prkcq	Rat	inflammatory response	involved_in	IEA	UniProtKB-KW:KW-0395	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Prkcq	Rat	intracellular signal transduction		IDA		724661		RGD
Prkcq	Rat	intracellular signal transduction	acts_upstream_of_or_within	ISO	Prkcq (Mus musculus)	1624291	MGI:2664379 PMID:12867038	RGD	PMID:12867038
Prkcq	Rat	intracellular signal transduction	involved_in	IBA	FB:FBgn0003744 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Prkcq	Rat	intracellular signal transduction	acts_upstream_of_or_within	IEA	UniProtKB:Q02111 and ensembl:ENSMUSP00000028118	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	membrane protein ectodomain proteolysis	involved_in	IEA	UniProtKB:Q02111 and ensembl:ENSMUSP00000028118	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	membrane protein ectodomain proteolysis	involved_in	ISO	Prkcq (Mus musculus)	1624291	PMID:9857183	RGD	PMID:9857183
Prkcq	Rat	negative regulation of insulin receptor signaling pathway	involved_in	IEA	UniProtKB:Q04759 and ensembl:ENSP00000263125	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	negative regulation of insulin receptor signaling pathway	involved_in	ISO	PRKCQ (Homo sapiens)	1624291	PMID:15364919	RGD	PMID:15364919
Prkcq	Rat	negative regulation of insulin receptor signaling pathway	involved_in	ISS	UniProtKB:Q04759	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Prkcq	Rat	negative regulation of T cell apoptotic process	involved_in	IEA	UniProtKB:Q04759 and ensembl:ENSP00000263125	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	negative regulation of T cell apoptotic process	involved_in	ISO	PRKCQ (Homo sapiens)	1624291	PMID:11342610 and PMID:16709830	RGD	PMID:11342610 and PMID:16709830
Prkcq	Rat	negative regulation of T cell apoptotic process	involved_in	ISS	UniProtKB:Q04759	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Prkcq	Rat	neuron differentiation		IEP		1625618		RGD
Prkcq	Rat	positive regulation of CD4-positive, alpha-beta T cell proliferation	acts_upstream_of_or_within	IEA	UniProtKB:Q02111 and ensembl:ENSMUSP00000028118	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	positive regulation of CD4-positive, alpha-beta T cell proliferation	acts_upstream_of_or_within	ISO	Prkcq (Mus musculus)	1624291	MGI:2664379 PMID:12867038	RGD	PMID:12867038
Prkcq	Rat	positive regulation of filopodium assembly		IMP		1625621		RGD
Prkcq	Rat	positive regulation of interleukin-17 production	involved_in	ISO	Prkcq (Mus musculus)	1624291	PMID:16493044	RGD	PMID:16493044
Prkcq	Rat	positive regulation of interleukin-17 production	involved_in	IEA	UniProtKB:Q02111 and ensembl:ENSMUSP00000028118	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	positive regulation of interleukin-17 production	involved_in	ISS	UniProtKB:Q02111	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Prkcq	Rat	positive regulation of interleukin-2 production	acts_upstream_of_or_within	ISO	Prkcq (Mus musculus)	1624291	MGI:2664379 PMID:12867038	RGD	PMID:12867038
Prkcq	Rat	positive regulation of interleukin-2 production	acts_upstream_of_or_within	IEA	UniProtKB:Q02111 and ensembl:ENSMUSP00000028118	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	positive regulation of interleukin-4 production	involved_in	ISS	UniProtKB:Q02111	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Prkcq	Rat	positive regulation of interleukin-4 production	involved_in	ISO	Prkcq (Mus musculus)	1624291	PMID:15263025	RGD	PMID:15263025
Prkcq	Rat	positive regulation of interleukin-4 production	involved_in	IEA	UniProtKB:Q02111 and ensembl:ENSMUSP00000028118	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	positive regulation of NF-kappaB transcription factor activity	involved_in	ISO	Prkcq (Mus musculus)	1624291	PMID:12782715	RGD	PMID:12782715
Prkcq	Rat	positive regulation of NF-kappaB transcription factor activity	involved_in	ISO	PRKCQ (Homo sapiens)	1624291	PMID:16356855	RGD	PMID:16356855
Prkcq	Rat	positive regulation of NF-kappaB transcription factor activity	involved_in	ISS	UniProtKB:Q04759	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Prkcq	Rat	positive regulation of protein import into nucleus		IMP		724661		RGD
Prkcq	Rat	positive regulation of protein secretion		IDA		1625617		RGD
Prkcq	Rat	positive regulation of stress fiber assembly		IMP		1625621		RGD
Prkcq	Rat	positive regulation of T cell activation	involved_in	ISS	UniProtKB:Q02111	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Prkcq	Rat	positive regulation of T cell activation	acts_upstream_of_or_within	IEA	UniProtKB:Q02111 and ensembl:ENSMUSP00000028118	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	positive regulation of T cell activation	acts_upstream_of_or_within	ISO	Prkcq (Mus musculus)	1624291	MGI:2664379 PMID:12867038	RGD	PMID:12867038
Prkcq	Rat	positive regulation of T cell activation	involved_in	ISO	Prkcq (Mus musculus)	1624291	PMID:12782715	RGD	PMID:12782715
Prkcq	Rat	positive regulation of T-helper 17 type immune response	involved_in	ISO	Prkcq (Mus musculus)	1624291	PMID:16493044	RGD	PMID:16493044
Prkcq	Rat	positive regulation of T-helper 17 type immune response	involved_in	ISS	UniProtKB:Q02111	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Prkcq	Rat	positive regulation of T-helper 17 type immune response	involved_in	IEA	UniProtKB:Q02111 and ensembl:ENSMUSP00000028118	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	positive regulation of T-helper 2 cell activation	involved_in	ISO	Prkcq (Mus musculus)	1624291	PMID:15263025	RGD	PMID:15263025
Prkcq	Rat	positive regulation of T-helper 2 cell activation	involved_in	ISS	UniProtKB:Q02111	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Prkcq	Rat	positive regulation of T-helper 2 cell activation	involved_in	IEA	UniProtKB:Q02111 and ensembl:ENSMUSP00000028118	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	positive regulation of telomere maintenance	acts_upstream_of_or_within	ISO	PRKCQ (Homo sapiens)	1624291	PMID:21531765	RGD	PMID:21531765
Prkcq	Rat	positive regulation of telomere maintenance	acts_upstream_of_or_within	IEA	UniProtKB:Q04759 and ensembl:ENSP00000263125	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	protein phosphorylation	involved_in	ISO	PRKCQ (Homo sapiens)	1624291	PMID:34593629	RGD	PMID:34593629
Prkcq	Rat	protein phosphorylation	acts_upstream_of_or_within	ISO	Prkcq (Mus musculus)	1624291	PMID:12618484	RGD	PMID:12618484
Prkcq	Rat	regulation of DNA-templated transcription	involved_in	ISS	UniProtKB:Q02111	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Prkcq	Rat	regulation of DNA-templated transcription	involved_in	ISO	Prkcq (Mus musculus)	1624291	PMID:12782715	RGD	PMID:12782715
Prkcq	Rat	regulation of DNA-templated transcription	involved_in	IEA	UniProtKB:Q02111 and ensembl:ENSMUSP00000028118	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	regulation of G2/M transition of mitotic cell cycle		IMP		1625621		RGD
Prkcq	Rat	regulation of platelet aggregation	involved_in	ISO	Prkcq (Mus musculus)	1624291	PMID:19433059	RGD	PMID:19433059
Prkcq	Rat	regulation of platelet aggregation	involved_in	IEA	UniProtKB:Q02111 and ensembl:ENSMUSP00000028118	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	regulation of platelet aggregation	involved_in	ISS	UniProtKB:Q02111	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Prkcq	Rat	regulation of vasoconstriction		IEP		1625607		RGD
Prkcq	Rat	respiratory burst		IEP		1625619		RGD
Prkcq	Rat	response to glucose		IEP		1625601		RGD
Prkcq	Rat	response to hypoxia		IEP		1625608		RGD
Prkcq	Rat	response to insulin		IEP		1625623		RGD
Prkcq	Rat	T cell activation	acts_upstream_of	ISO	Prkcq (Mus musculus)	1624291	MGI:2664379 PMID:12867038	RGD	PMID:12867038
Prkcq	Rat	T cell activation	acts_upstream_of	IEA	UniProtKB:Q02111 and ensembl:ENSMUSP00000028118	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	tissue regeneration		IEP		1625612		RGD

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Prkcq	Rat	aggresome	located_in	IEA	UniProtKB:Q04759 and ensembl:ENSP00000263125	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	aggresome	located_in	ISO	PRKCQ (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Prkcq	Rat	centriolar satellite	located_in	IEA	UniProtKB:Q04759 and ensembl:ENSP00000263125	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	centriolar satellite	located_in	ISO	PRKCQ (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Prkcq	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Prkcq	Rat	cytoplasm	located_in	IEA	UniProtKB:Q02111 and ensembl:ENSMUSP00000028118	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Prkcq	Rat	cytoplasm	located_in	ISO	Prkcq (Mus musculus)	1624291	PMID:12618484 and PMID:12867038	RGD	PMID:12618484 and PMID:12867038
Prkcq	Rat	immunological synapse	located_in	IEA	UniProtKB:Q02111 and ensembl:ENSMUSP00000028118	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	immunological synapse	located_in	ISO	Prkcq (Mus musculus)	1624291	PMID:11728336 more ...	RGD	PMID:11728336 more ...
Prkcq	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Prkcq	Rat	neuromuscular junction		IDA		1625624		RGD
Prkcq	Rat	plasma membrane	located_in	ISO	Prkcq (Mus musculus)	1624291	PMID:12618484 and PMID:12867038	RGD	PMID:12618484 and PMID:12867038
Prkcq	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Prkcq	Rat	plasma membrane	located_in	IEA	UniProtKB:Q02111 and ensembl:ENSMUSP00000028118	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Prkcq	Rat	sarcolemma		IDA		1625624		RGD

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Prkcq	Rat	ATP binding	enables	IEA	UniRule:UR001503341	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Prkcq	Rat	ATP binding	enables	IEA	InterPro:IPR000719 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Prkcq	Rat	ATP binding	enables	IEA	UniProtKB-KW:KW-0067	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Prkcq	Rat	diacylglycerol-dependent serine/threonine kinase activity	enables	IEA	InterPro:IPR034668	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Prkcq	Rat	diacylglycerol-dependent serine/threonine kinase activity	enables	IEA	InterPro:IPR014376 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Prkcq	Rat	diacylglycerol-dependent serine/threonine kinase activity	enables	IEA	UniProtKB:Q02111 and ensembl:ENSMUSP00000028118	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	diacylglycerol-dependent serine/threonine kinase activity	enables	ISO	Prkcq (Mus musculus)	1624291	PMID:12618484	RGD	PMID:12618484
Prkcq	Rat	diacylglycerol-dependent serine/threonine kinase activity	enables	IEA	EC:2.7.11.13	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Prkcq	Rat	diacylglycerol-dependent serine/threonine kinase activity	enables	ISO	PRKCQ (Homo sapiens)	1624291	PMID:16356856	RGD	PMID:16356856
Prkcq	Rat	kinase activity	enables	IEA	UniProtKB-KW:KW-0418	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Prkcq	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Prkcq	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Prkcq	Rat	nucleotide binding	enables	IEA	UniRule:UR001503341	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Prkcq	Rat	protein binding		IPI	C1qbp (Rattus norvegicus)	1625615		RGD
Prkcq	Rat	protein binding	enables	ISO	Prkcq (Mus musculus)	1624291	UniProtKB:P26645 more ...	RGD	PMID:20178747 more ...
Prkcq	Rat	protein binding	enables	ISO	PRKCQ (Homo sapiens)	1624291	UniProtKB:C0HM02 more ...	RGD	PMID:10383400 more ...
Prkcq	Rat	protein kinase activity	enables	ISO	PRKCQ (Homo sapiens)	1624291	PMID:34593629	RGD	PMID:34593629
Prkcq	Rat	protein kinase activity	enables	IEA	UniProtKB:Q04759 and ensembl:ENSP00000263125	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Prkcq	Rat	protein kinase activity	enables	IEA	InterPro:IPR000719 and InterPro:IPR008271	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Prkcq	Rat	protein serine kinase activity	enables	IEA	RHEA:17989	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Prkcq	Rat	protein serine/threonine kinase activity		IDA		724661		RGD
Prkcq	Rat	protein serine/threonine kinase activity	enables	IEA	InterPro:IPR000961 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Prkcq	Rat	protein serine/threonine kinase activity	enables	IEA	InterPro:IPR000961 and InterPro:IPR017892	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Prkcq	Rat	protein serine/threonine kinase activity	enables	IBA	CGD:CAL0000179865 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Prkcq	Rat	protein serine/threonine kinase activity	enables	IEA	UniProtKB-KW:KW-0723	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Prkcq	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Prkcq	Rat	zinc ion binding	enables	IEA	UniProtKB-KW:KW-0863	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Prkcq	Rat	insulin signaling pathway		ISO	PRKCQ (Homo sapiens)	1625124		RGD
Prkcq	Rat	protein kinase C (PKC) signaling pathway		ISO	PRKCQ (Homo sapiens)	5131489		RGD

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Prkcq	Rat	measles pathway		IEA		6907045		KEGG	rno:05162

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Prkcq	Rat	eicosanoid signaling pathway		ISO	PRKCQ (Homo sapiens)	6484113		PID	PID:200082
Prkcq	Rat	endothelin signaling pathway		ISO	PRKCQ (Homo sapiens)	6484113		PID	PID:200005

#	Reference Title	Reference Citation
1.	Insulin increases mRNA levels of protein kinase C-alpha and -beta in rat adipocytes and protein kinase C-alpha, -beta and -theta in rat skeletal muscle.	Avignon A, etal., Biochem J. 1995 May 15;308 ( Pt 1):181-7.
2.	Chronic activation of protein kinase C in soleus muscles and other tissues of insulin-resistant type II diabetic Goto-Kakizaki (GK), obese/aged, and obese/Zucker rats. A mechanism for inhibiting glycogen synthesis.	Avignon A, etal., Diabetes. 1996 Oct;45(10):1396-404.
3.	Heat shock pretreatment influences the expression of PKC isoforms during sepsis.	Chen HW, etal., J Surg Res. 2001 Dec;101(2):202-9.
4.	Regulation of conjunctival goblet cell secretion by Ca(2+)and protein kinase C.	Dartt DA, etal., Exp Eye Res. 2000 Dec;71(6):619-28.
5.	Mitogenic signals through CD28 activate the protein kinase Ctheta-NF-kappaB pathway in primary peripheral T cells.	Dennehy KM, etal., Int Immunol 2003 May;15(5):655-63.
6.	Effect of ageing on the expression of protein kinase C and its activation by 1,25(OH)2-vitamin D3 in rat skeletal muscle.	Facchinetti MM and de Boland AR, Cell Signal. 1999 Jan;11(1):39-44.
7.	Activation of PKC modulates blood-brain barrier endothelial cell permeability changes induced by hypoxia and posthypoxic reoxygenation.	Fleegal MA, etal., Am J Physiol Heart Circ Physiol. 2005 Nov;289(5):H2012-9. Epub 2005 Jul 1.
8.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.	Chronic exposure to ammonia induces isoform-selective alterations in the intracellular distribution and NMDA receptor-mediated translocation of protein kinase C in cerebellar neurons in culture.	Giordano G, etal., J Neurochem. 2005 Jan;92(1):143-57.
10.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
11.	Developmental regulation of a protein kinase C isoform localized in the neuromuscular junction.	Hilgenberg L and Miles K, J Cell Sci. 1995 Jan;108 ( Pt 1):51-61.
12.	Prolonged glucose infusion into conscious rats inhibits early steps in insulin signalling and induces translocation of GLUT4 and protein kinase C in skeletal muscle.	Houdali B, etal., Diabetologia. 2002 Mar;45(3):356-68.
13.	Involvement of protein kinase C in human skeletal muscle insulin resistance and obesity.	Itani SI, etal., Diabetes. 2000 Aug;49(8):1353-8.
14.	Inhibition of insulin signaling and glycogen synthesis by phorbol dibutyrate in rat skeletal muscle.	Lin Y, etal., Am J Physiol Endocrinol Metab. 2001 Jul;281(1):E8-E15.
15.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
16.	Differential changes in protein kinase C associated with regeneration of rat extensor digitorum longus and soleus muscles.	Moraczewski J, etal., Int J Biochem Cell Biol. 2002 Aug;34(8):938-49.
17.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
18.	Protein kinase C: poised to signal.	Newton AC Am J Physiol Endocrinol Metab. 2010 Mar;298(3):E395-402. Epub 2009 Nov 24.
19.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
20.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
21.	Differential expression of protein kinase C isozyme messenger RNAs in dunning R-3327 rat prostatic tumors.	Powell CT, etal., Cell Growth Differ. 1994 Feb;5(2):143-9.
22.	GOA pipeline	RGD automated data pipeline
23.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
24.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
25.	p32 (gC1qBP) is a general protein kinase C (PKC)-binding protein; interaction and cellular localization of P32-PKC complexes in ray hepatocytes.	Robles-Flores M, etal., J Biol Chem. 2002 Feb 15;277(7):5247-55. Epub 2001 Nov 6.
26.	Alterations in the expression and cellular localization of protein kinase C isozymes epsilon and theta are associated with insulin resistance in skeletal muscle of the high-fat-fed rat.	Schmitz-Peiffer C, etal., Diabetes. 1997 Feb;46(2):169-78.
27.	Neuronal differentiation of PC12 cells involves changes in protein kinase C-theta distribution and molecular properties.	Sparatore B, etal., Biochem Biophys Res Commun. 2000 Aug 18;275(1):149-53.
28.	Requirement for protein kinase C theta for cell cycle progression and formation of actin stress fibers and filopodia in vascular endothelial cells.	Tang S, etal., J Biol Chem. 1997 Nov 7;272(45):28704-11.
29.	Stimulation of respiratory burst by cyclocommunin in rat neutrophils is associated with the increase in cellular Ca2+ and protein kinase C activity.	Wang JP, etal., Free Radic Biol Med. 1999 Mar;26(5-6):580-8.
30.	Role of PKC in the novel synergistic action of urotensin II and angiotensin II and in urotensin II-induced vasoconstriction.	Wang YX, etal., Am J Physiol Heart Circ Physiol. 2007 Jan;292(1):H348-59. Epub 2006 Sep 1.
31.	Regulation of insulin receptor function.	Youngren JF Cell Mol Life Sci. 2007 Apr;64(7-8):873-91.

PMID:9857183	PMID:11220785	PMID:11342610	PMID:11728336	PMID:12618484	PMID:12782715	PMID:12867038	PMID:15057822	PMID:15117976	PMID:15128768	PMID:15263025	PMID:15364919
PMID:16356855	PMID:16356856	PMID:16419034	PMID:16493044	PMID:16709830	PMID:17112897	PMID:18248621	PMID:18992015	PMID:19433059	PMID:19929130	PMID:20691763	PMID:21531765
PMID:21683791	PMID:22881371	PMID:23295188	PMID:23712979	PMID:23793062	PMID:24008408	PMID:26019328	PMID:34418453

Prkcq
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	72,156,215 - 72,288,508 (-)	NCBI		GRCr8
mRatBN7.2	17	67,246,394 - 67,379,049 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	67,246,394 - 67,378,704 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	70,722,219 - 70,854,437 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	74,551,031 - 74,683,236 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	68,594,018 - 68,726,228 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	70,971,915 - 71,105,286 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	70,971,915 - 71,105,286 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	72,669,688 - 72,800,895 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	78,486,998 - 78,566,741 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	78,497,951 - 78,520,090 (-)	NCBI
Celera	17	66,745,895 - 66,876,546 (-)	NCBI		Celera
Cytogenetic Map	17	q12.3	NCBI

PRKCQ
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	6,394,097 - 6,580,646 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	6,427,143 - 6,580,301 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	6,436,059 - 6,622,608 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	6,509,111 - 6,662,244 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	6,509,110 - 6,662,244	NCBI
Celera	10	6,391,714 - 6,479,754 (-)	NCBI		Celera
Cytogenetic Map	10	p15.1	NCBI
HuRef	10	6,388,053 - 6,541,112 (-)	NCBI		HuRef
CHM1_1	10	6,468,923 - 6,622,208 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	10	6,394,273 - 6,580,768 (-)	NCBI		T2T-CHM13v2.0

Prkcq
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	11,176,922 - 11,306,033 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	11,176,919 - 11,306,033 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	11,171,905 - 11,301,226 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	11,172,108 - 11,301,222 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	11,094,009 - 11,222,853 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	11,090,235 - 11,219,079 (+)	NCBI		MGSCv36	mm8
Celera	2	11,093,754 - 11,222,740 (+)	NCBI		Celera
Cytogenetic Map	2	A1	NCBI
cM Map	2	8.42	NCBI

Prkcq
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955421	23,070,955 - 23,175,699 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955421	23,072,607 - 23,151,591 (-)	NCBI	ChiLan1.0	ChiLan1.0

PRKCQ
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	18,971,178 - 19,127,387 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	18,976,501 - 19,132,710 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	6,458,138 - 6,610,781 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	6,440,316 - 6,528,828 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	6,440,316 - 6,593,900 (-)	Ensembl	panpan1.1		panPan2

PRKCQ
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	29,319,123 - 29,505,338 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	29,318,870 - 29,505,337 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	26,357,031 - 26,536,629 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	29,699,579 - 29,881,298 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	29,699,661 - 29,881,826 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	26,803,522 - 26,983,171 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	27,646,081 - 27,819,412 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	28,365,332 - 28,538,905 (+)	NCBI		UU_Cfam_GSD_1.0

Prkcq
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	31,883,098 - 32,000,850 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936484	8,048,132 - 8,167,636 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936484	8,048,239 - 8,166,058 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PRKCQ
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	64,458,180 - 64,600,339 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	10	64,442,588 - 64,596,528 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	70,558,968 - 70,659,135 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PRKCQ
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	6,532,438 - 6,675,708 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	6,532,319 - 6,621,487 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666051	11,850,149 - 11,993,985 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Prkcq
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624775	1,419,509 - 1,502,064 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624775	1,419,596 - 1,543,805 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Prkcq
1135 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	65
Count of miRNA genes:	56
Interacting mature miRNAs:	60
Transcripts:	ENSRNOT00000025901
Prediction methods:	Microtar, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1358295	Aocep1	Aortic cell protein QTL 1	6.1	7e-07	thoracic aorta cellular protein amount (VT:0010598)	aortic cell percentage	17	40990005	85990005	Rat
70210	Cm15	Cardiac mass QTL 15	6.5		heart right ventricle mass (VT:0007033)	heart right ventricle wet weight (CMO:0000072)	17	57246723	70156904	Rat
152023626	Bp403	Blood pressure QTL 403	3.86		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
7411575	Bw140	Body weight QTL 140	30.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	17	48560935	86533673	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	37479847	82479847	Rat
631502	Cm26	Cardiac mass QTL 26	3.71		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	65703580	81153923	Rat
1354588	Bvd4	Brain ventricular dilatation QTL 4	5.31	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	53498828	82479847	Rat
7411577	Bw141	Body weight QTL 141		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	17	62619516	86533673	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	28409147	73409147	Rat
2317038	Ginf3	Gastrointestinal inflammation QTL 3	2.89	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	17	49920154	86533673	Rat
724549	Niddm56	Non-insulin dependent diabetes mellitus QTL 56		0.03	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	31990784	76990784	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40540041	80387013	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1600398	Edcs5	Endometrial carcinoma susceptibility QTL 5	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	17	57246723	70852846	Rat
2317045	Aia11	Adjuvant induced arthritis QTL 11	4.06		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	60781426	86533673	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	68653184	Rat
152025238	Slep14	Serum leptin concentration QTL 14	4.62		blood leptin amount (VT:0005667)		17	24184890	79524188	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
2317054	Aia12	Adjuvant induced arthritis QTL 12	4.24		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	38281509	83281509	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	42073160	69599340	Rat
8694181	Bw151	Body weight QTL 151	4.36	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	17	48560935	86533673	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	28409147	73409147	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	34550843	73951021	Rat
2317060	Aia26	Adjuvant induced arthritis QTL 26	3.22		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	38281509	83281509	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23653184	68653184	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23653184	68653184	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23653184	70974005	Rat
4889894	Eae33	Experimental allergic encephalomyelitis QTL 33	5.2	0.0001	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	50909099	86022412	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23653184	68653184	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	31368391	73951021	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23653184	68653184	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	24599340	69599340	Rat
1300131	Bp193	Blood pressure QTL 193	3.3		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	63640009	73951021	Rat
7488963	Bp369	Blood pressure QTL 369		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	59005649	77910000	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
152023740	Bp406	Blood pressure QTL 406	6.06		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	31990784	81292925	Rat
152023737	Bp405	Blood pressure QTL 405	5.06		arterial blood pressure trait (VT:2000000)			23930421	79524188	Rat
152023736	Bp404	Blood pressure QTL 404	3.78		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	35837085	69599340	Rat
2302365	Gluco40	Glucose level QTL 40	4.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	57246843	82046127	Rat
2303580	Gluco49	Glucose level QTL 49	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	50040271	86533673	Rat

D17Got86

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	17	72,693,842 - 72,694,003	NCBI	Rnor5.0
Rnor_5.0	17	72,693,842 - 72,694,005	NCBI	Rnor5.0
RGSC_v3.4	17	78,512,934 - 78,513,200	RGD	RGSC3.4
RGSC_v3.4	17	78,512,935 - 78,513,202	UniSTS	RGSC3.4
RGSC_v3.1	17	78,523,767 - 78,524,035	RGD
Celera	17	66,769,592 - 66,769,859	UniSTS
Cytogenetic Map	17	q12.3	UniSTS

RH134411

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	67,246,579 - 67,246,799 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	70,972,101 - 70,972,320	NCBI	Rnor6.0
Rnor_5.0	17	72,669,874 - 72,670,093	UniSTS	Rnor5.0
RGSC_v3.4	17	78,486,122 - 78,486,341	UniSTS	RGSC3.4
Celera	17	66,746,081 - 66,746,300	UniSTS
RH 3.4 Map	17	635.8	UniSTS
Cytogenetic Map	17	q12.3	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001276721	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096127	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB020614	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473990	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025901 ⟹ ENSRNOP00000025902

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	67,246,394 - 67,378,704 (-)	Ensembl
Rnor_6.0 Ensembl	17	70,971,915 - 71,105,286 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114215 ⟹ ENSRNOP00000083951

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	67,246,394 - 67,302,230 (-)	Ensembl

RefSeq Acc Id:

NM_001276721 ⟹ NP_001263650

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	72,156,215 - 72,288,508 (-)	NCBI
mRatBN7.2	17	67,246,394 - 67,378,704 (-)	NCBI
Rnor_6.0	17	70,971,915 - 71,105,286 (-)	NCBI
Rnor_5.0	17	72,669,688 - 72,800,895 (-)	NCBI
Celera	17	66,745,895 - 66,876,546 (-)	NCBI

Sequence:

show sequence

GAGGAAGGCCGAGAGCGCTCGTGGAACGCAACTAGGCGCGCGTCCCTGAGCCGGCGTGGCGAGCGCCCTCTGGCCGGTGTCGCCGCCCGGAGTACCCTCGGGTCGCCAGGCCCGCGCCAGTCCCCGCC
ATCGGAGCAGCAGCGGCACTGCGCTGGGACTGCGGCCACGACACCAGGGAACAACCATGTCACCGTTTCTTCGAATTGGTTTATCCAACTTTGACTGTGGGACCTGTCAAGCTTGTCAGGGAGAGGCG
GTGAACCCCTACTGTGCCGTGCTTGTCAAAGAGTATGTGGAATCAGAAAACGGGCAGATGTACATCCAGAAAAAGCCGACCATGTACCCGCCTTGGGACAGCACCTTTGATGCCCACATTAACAAGGG
AAGGGTGATGCAGATCATCGTGAAAGGCAAAAATGTAGACCTCATATCAGAAACCACCGTGGAGCTCTACTCCCTGGCAGAGAGATGCCGCAAGAACAATGGGCGGACAGAAATATGGTTAGAGCTGA
AACCTCAAGGCCGAATGCTAATGAATGCAAGATACTTTCTGGAAATGAGTGACACAAAGGACATGAGTGAATTTGAGAACGAAGGATTCTTTGCACTGCATCACCGCCGAGGCGCCATCAAACAAGCC
AAAGTCCACCACGTCAAGTGTCACGAGTTCACAGCCACCTTTTTCCCTCAACCCACGTTCTGCTCTGTCTGCCATGAATTTGTCTGGGGGCTGAACAAGCAGGGCTACCAGTGCCGACAATGTAATGC
AGCGATTCACAAGAAGTGCATCGATAAAGTGATAGCCAAGTGCACAGGATCGGCGATCAATAGTCGAGAGACCATGTTCCACAAGGAGAGATTCAAGATCGACATGCCACACAGATTCAAAGTCTACA
ACTACAAGAGTCCAACCTTCTGTGAGCACTGTGGTACCCTGCTATGGGGGCTGGCGAGGCAAGGTCTCAAGTGTGATGCATGTGGCATGAACGTCCACCACCGATGCCAGACAAAGGTTGCCAACCTC
TGTGGTATAAACCAGAAGCTAATGGCTGAAGCGCTAGCAATGATTGAAAGCACTCAACAGGCTCGCACCTTAAGAGATTCAGAACACATCTTCCGAGAAGGACCAATTGAAATCAGTTTCCCGCGCTC
CATCAAAAGTGAAACCAGGCCACCATGCGTACCAACACCTGGGAAAAAAGAACCCCAGGGAATTTGCTGGGAGTCCCCTTTGGATGGGGCAGATAAAACGGCCCAGCCTCCTGAACCTGAAGTGAACT
TGCAAAGGGCTTCTCTGCAACTGAAACTGAAGATCGATGACTTCATCCTGCACAAGATGCTGGGGAAAGGAAGTTTTGGCAAGGTCTTCCTGGCAGAGTTCAAGAGAACCAAACAGTTTTTCGCAATA
AAAGCCTTAAAGAAAGATGTGGTGTTGATGGACGATGACGTCGAGTGCACGATGGTGGAGAAGAGAGTTCTGTCCTTGGCCTGGGAGCATCCGTTTCTTACACACATGTTCTGCACATTCCAGACCAA
GGAAAATCTCTTTTTCGTGATGGAGTATCTCAATGGAGGAGACTTAATGTACCACATCCAAAGTTGCCACAAATTTGATCTTTCCAGAGCCACGTTTTATGCTGCTGAGATCATCCTTGGTCTACAGT
TCCTTCATTCCAAAGGAATTGTCTACAGGGACCTGAAGCTAGATAATATCCTGTTAGACAGAGATGGCCATATCAAAATAGCAGACTTTGGGATGTGCAAAGAGAATATGCTGGGAGATGCGAAGACA
AATACTTTCTGTGGGACGCCTGACTACATCGCTCCGGAGATCTTGCTGGGTCAGAAATACAACCATTCCGTTGACTGGTGGTCCTTTGGGGTTCTTCTTTACGAGATGCTGATTGGCCAGTCGCCTTT
CCACGGGCAGGACGAAGAGGAGCTTTTCCACTCCATCCGCATGGACAATCCCTTTTACCCAAGGTGGCTAGAAAGGGAGGCCAAGGATCTTCTAGTGAAGCTTTTTGTGAGAGAGCCTGAAAAGAGGC
TGGGAGTGAGAGGAGACATCCGCCAGCATCCTTTGTTTCGAGAGATCAACTGGGAAGAGCTTGAGAGAAAAGAGATTGACCCACCCTTCAGACCAAAAGTGAAATCACCATATGACTGTAGCAATTTC
GACAAGGAATTCCTAAGTGAGAAACCCCGGCTATCGTTCGCTGACAGAGCACTCATCAACAGCATGGACCAGAACATGTTCAGCAACTTCTCCTTCATTAACCCGGGGATGGAGACTCTCATTTGCTC
CTGAACCTCATCCCTCTTCCCCAGACTGGAAGAAATTCGCCTTCTCTCTGGGAACTGGTTCAAGTAACACTTCTGGGGGTCTCTTTTTCACGTTGGAGAAGAGAAGAAACACTCAACCTCGAAAGCAG
GGAGGACCGCTGAGCTCCTCGAGGGACACGCAGCACAAACCATGTCTCCTTCACTAATGGCATCATCCTGTTATATCTCCTGGAATCTCTCTCACCGCAGCCCTAGAAGTTAGACCATTGTTAACTCT
AGTCATTTACTTGAAAGATGGTTCCCGATCCTGCGAACGATTCGAAATGTAATTCTGCTCTTGTCGTTGACAAGAGCTGCTGGTTGGTGACGAACCAAGGTGCAAGTGGAACAGATTTCTCAAGACCG
GGAGGGCAGATTGCCTGTCATGGAAGTCGATTCCACTCAACCACAGAGAAGGACCCACTAACCCGCATCGTCCTGCGCATGTCTGTGGAAATGTCGATGGCAGAAGGGAGGGAAAGGGATGTGATGGG
ATGTTCTCCAATAAACTTAGCGTGAAACTTGAGATTTACAAACCCGTTCGTTCTGGCCAGCCCTGAAATTCACAAGGCAGCGGAAAGTAAGGGGTGAGGTGCAGAGCCTTTGTCACCAACAGGAAGGG
TAAGGATGTTTCGGATGTGGTGCATCTCATTCCCACAGAAGTAAAGTCCAACCAACGAAGGCAGGGCAGTTTACTGCTGCCAATCAAACCTTCTCTTCCCTCTTGTTCTGGCTGATTTCTCTGTCAGC
GTCGGCATTCGTCATCGTCCTCCCGTTGCACAAGAAATGAAGTACATGACTCTTGTGAGAGAAAGAAAACCAATCCCATATCATGTTGCTCCTGGTGATTCGGTGACAAATAAGTCCCTCTTTAGGCA
TCCTGCAAGACAAACGACCCACGCATGCTATTTCCACTAGTCAGCCCTGTTGAGTTGGAGTACTAATTAGACACTTAGAGTCTCGCGTGCTGTTTGTATATTTTGATGGGATGTTGTGATGATGACGT
ACGTGGACGTGTAAAACGGAATAAAAGAAGAAAAGAAAGATG

hide sequence

RefSeq Acc Id:

XM_039096127 ⟹ XP_038952055

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	72,156,219 - 72,212,090 (-)	NCBI
mRatBN7.2	17	67,246,395 - 67,302,583 (-)	NCBI


Protein RefSeqs	NP_001263650	(Get FASTA)	NCBI Sequence Viewer
	XP_038952055	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA78371	(Get FASTA)	NCBI Sequence Viewer
	EDL78611	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025902
GenBank Protein	Q9WTQ0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001263650 ⟸ NM_001276721

- UniProtKB:

Q9WTQ0 (UniProtKB/Swiss-Prot), F1LM10 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSPFLRIGLSNFDCGTCQACQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGRTEIWLELKPQGRMLMNARYFLEMSDT
KDMSEFENEGFFALHHRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGLA
RQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQARTLRDSEHIFREGPIEISFPRSIKSETRPPCVPTPGKKEPQGICWESPLDGADKTAQPPEPEVNLQRASLQLKLKIDDFILHK
MLGKGSFGKVFLAEFKRTKQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILL
DRDGHIKIADFGMCKENMLGDAKTNTFCGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEREAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWE
ELERKEIDPPFRPKVKSPYDCSNFDKEFLSEKPRLSFADRALINSMDQNMFSNFSFINPGMETLICS

hide sequence

Ensembl Acc Id:

ENSRNOP00000025902 ⟸ ENSRNOT00000025901

RefSeq Acc Id:	XP_038952055 ⟸ XM_039096127
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A0B5 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000083951 ⟸ ENSRNOT00000114215

Protein Domains

AGC-kinase C-terminal C2 Phorbol-ester/DAG-type Protein kinase

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9WTQ0-F1-model_v2	AlphaFold	Q9WTQ0	1-707	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-8789	BioCyc
Ensembl Genes	ENSRNOG00000019057	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000025901	ENTREZGENE
Gene3D-CATH	2.60.40.150	UniProtKB/Swiss-Prot
	3.30.60.20	UniProtKB/Swiss-Prot
	Phosphorylase Kinase, domain 1	UniProtKB/Swiss-Prot
	Transferase(Phosphotransferase) domain 1	UniProtKB/Swiss-Prot
InterPro	AGC-kinase_C	UniProtKB/Swiss-Prot
	C1-like_sf	UniProtKB/Swiss-Prot
	C2_dom	UniProtKB/Swiss-Prot
	C2_domain_sf	UniProtKB/Swiss-Prot
	DAG/PE-bd	UniProtKB/Swiss-Prot
	Kinase-like_dom_sf	UniProtKB/Swiss-Prot
	nPKC_theta	UniProtKB/Swiss-Prot
	PE/DAG-bd	UniProtKB/Swiss-Prot
	PKC_theta	UniProtKB/Swiss-Prot
	Pkinase_C	UniProtKB/Swiss-Prot
	Prot_kin_PKC_delta	UniProtKB/Swiss-Prot
	Prot_kinase_dom	UniProtKB/Swiss-Prot
	Protein_kinase_ATP_BS	UniProtKB/Swiss-Prot
	Ser/Thr_kinase_AS	UniProtKB/Swiss-Prot
NCBI Gene	85420	ENTREZGENE
PANTHER	RIBOSOMAL PROTEIN S6 KINASE	UniProtKB/Swiss-Prot
Pfam	C1_1	UniProtKB/Swiss-Prot
	PKC_C2	UniProtKB/Swiss-Prot
	Pkinase	UniProtKB/Swiss-Prot
	Pkinase_C	UniProtKB/Swiss-Prot
PharmGKB	PRKCQ	RGD
PhenoGen	Prkcq	PhenoGen
PIRSF	PKC_delta	UniProtKB/Swiss-Prot
	Protein_kin_C_theta	UniProtKB/Swiss-Prot
PRINTS	DAGPEDOMAIN	UniProtKB/Swiss-Prot
PROSITE	AGC_KINASE_CTER	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_ATP	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_DOM	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_ST	UniProtKB/Swiss-Prot
	PS50004	UniProtKB/Swiss-Prot
	ZF_DAG_PE_1	UniProtKB/Swiss-Prot
	ZF_DAG_PE_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000019057	RatGTEx
SMART	S_TK_X	UniProtKB/Swiss-Prot
	S_TKc	UniProtKB/Swiss-Prot
	SM00109	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF49562	UniProtKB/Swiss-Prot
	SSF56112	UniProtKB/Swiss-Prot
	SSF57889	UniProtKB/Swiss-Prot
UniProt	A0A8I6A0B5	ENTREZGENE, UniProtKB/TrEMBL
	A6JLT4_RAT	UniProtKB/TrEMBL
	F1LM10	ENTREZGENE, UniProtKB/TrEMBL
	KPCT_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2007-09-21	Prkcq		PRKCQ	protein kinase C, theta	Symbol updated	1299863	APPROVED
2004-09-10	PRKCQ	protein kinase C, theta	Pkcq		Symbol updated	1299863	APPROVED
2002-08-07	Pkcq	protein kinase C, theta			Symbol and Name status set to provisional	70820	PROVISIONAL

Note Type	Note	Reference
gene_regulation	activated by CD28 stimulation	724661

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)