Symbol:
Map3k1
Name:
mitogen-activated protein kinase kinase kinase 1
RGD ID:
620966
Description:
Enables several functions, including JUN kinase kinase kinase activity; protein kinase binding activity; and ubiquitin-protein transferase activity. Involved in several processes, including positive regulation of signal transduction; positive regulation of viral transcription; and protein modification process. Predicted to be located in tight junction. Predicted to be part of filamentous actin. Predicted to be active in cytoplasm. Human ortholog(s) of this gene implicated in 46,XY sex reversal 6; breast cancer; gastrointestinal system cancer (multiple); and lung non-small cell carcinoma. Orthologous to human MAP3K1 (mitogen-activated protein kinase kinase kinase 1); PARTICIPATES IN altered Wnt signaling, canonical pathway; adenosine signaling pathway; c-Jun N-terminal kinases MAPK signaling pathway; INTERACTS WITH 1,2,4-trimethylbenzene; 17alpha-ethynylestradiol; 2,2',4,4',5,5'-hexachlorobiphenyl.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC100912399; MAPK/ERK kinase kinase 1; MEK kinase 1; MEKK 1; Mekk1; mitogen activated protein kinase kinase kinase 1; mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase; mitogen-activated protein kinase kinase kinase 1-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 45,081,889 - 45,150,555 (-) NCBI GRCr8 mRatBN7.2 2 43,348,572 - 43,414,706 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 43,350,098 - 43,414,463 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 50,464,742 - 50,530,977 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 48,523,204 - 48,589,428 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 43,374,713 - 43,440,941 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 43,329,516 - 43,393,203 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 43,329,516 - 43,393,207 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 62,373,717 - 62,440,715 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 43,062,252 - 43,126,058 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 42,987,560 - 43,051,968 (-) NCBI Celera 2 39,134,930 - 39,199,049 (-) NCBI Celera Cytogenetic Map 2 q14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Map3k1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of MAP3K1 mRNA CTD PMID:22079256 Map3k1 Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of MAP3K1 protein CTD PMID:17337753 Map3k1 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO MAP3K1 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to MAP3K1 protein CTD PMID:32991956 Map3k1 Rat 17alpha-ethynylestradiol affects expression ISO Map3k1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of MAP3K1 mRNA CTD PMID:17555576 Map3k1 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of MAP3K1 mRNA CTD PMID:12655037 Map3k1 Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of MAP3K1 mRNA CTD PMID:20170705 Map3k1 Rat 17beta-estradiol multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 [Estradiol co-treated with IGF1R mutant form] results in increased expression of MAP3K1 mRNA CTD PMID:23094148 Map3k1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:22889935 Map3k1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Map3k1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Map3k1 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Map3k1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Map3k1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Map3k1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MAP3K1 mRNA CTD PMID:21570461 Map3k1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MAP3K1 mRNA CTD PMID:33387578 Map3k1 Rat 2,5-hexanedione increases expression EXP 6480464 2 and 5-hexanedione results in increased expression of MAP3K1 protein CTD PMID:31760062 Map3k1 Rat 2-methylcholine affects expression ISO MAP3K1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of MAP3K1 mRNA CTD PMID:21179406 Map3k1 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of MAP3K1 mRNA CTD PMID:28522335 Map3k1 Rat 4,4'-sulfonyldiphenol increases methylation ISO Map3k1 (Mus musculus) 6480464 bisphenol S results in increased methylation of MAP3K1 exon CTD PMID:33297965 Map3k1 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of MAP3K1 mRNA CTD PMID:21346803 Map3k1 Rat 5-fluorouracil affects expression ISO MAP3K1 (Homo sapiens) 6480464 Fluorouracil affects the expression of MAP3K1 mRNA CTD PMID:34151400 Map3k1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of MAP3K1 mRNA CTD PMID:24780913 Map3k1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of MAP3K1 mRNA CTD PMID:31881176 Map3k1 Rat acetazolamide increases expression ISO Map3k1 (Mus musculus) 6480464 Acetazolamide results in increased expression of MAP3K1 mRNA CTD PMID:19274763 Map3k1 Rat alachlor increases expression EXP 6480464 alachlor results in increased expression of MAP3K1 mRNA CTD PMID:12419858 Map3k1 Rat aldehydo-D-glucose increases expression ISO Map3k1 (Mus musculus) 6480464 Glucose results in increased expression of MAP3K1 mRNA CTD PMID:24659233 Map3k1 Rat aldehydo-D-glucose multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 [MAP3K1 gene mutant form results in increased activity of MAP3K1 protein] which results in increased susceptibility to Glucose CTD PMID:27278863 Map3k1 Rat aldehydo-D-glucose multiple interactions ISO Map3k1 (Mus musculus) 6480464 resveratrol inhibits the reaction [Glucose results in increased expression of MAP3K1 mRNA] CTD PMID:24659233 Map3k1 Rat all-trans-retinoic acid increases expression ISO MAP3K1 (Homo sapiens) 6480464 Tretinoin results in increased expression of MAP3K1 mRNA CTD PMID:23724009 Map3k1 Rat all-trans-retinoic acid decreases expression ISO MAP3K1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of MAP3K1 mRNA CTD PMID:33167477 Map3k1 Rat allethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of MAP3K1 protein CTD PMID:34896426 Map3k1 Rat amino acid multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 [MAP3K1 gene mutant form results in increased activity of MAP3K1 protein] which results in increased susceptibility to Amino Acids CTD PMID:27278863 Map3k1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MAP3K1 mRNA CTD PMID:16483693 Map3k1 Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 pyrazolanthrone inhibits the reaction [[MAP3K1 gene mutant form results in increased activity of MAP3K1 protein] which results in increased susceptibility to Tetradecanoylphorbol Acetate] and pyrazolanthrone inhibits the reaction [MAP3K1 protein results in increased expression of ABCB1 mRNA] CTD PMID:15604272 and PMID:27278863 Map3k1 Rat aristolochic acid A decreases expression ISO MAP3K1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of MAP3K1 mRNA CTD PMID:33212167 Map3k1 Rat arsane affects methylation ISO MAP3K1 (Homo sapiens) 6480464 Arsenic affects the methylation of MAP3K1 gene CTD PMID:25304211 Map3k1 Rat arsane multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of MAP3K1 mRNA CTD PMID:39836092 Map3k1 Rat arsenic atom affects methylation ISO MAP3K1 (Homo sapiens) 6480464 Arsenic affects the methylation of MAP3K1 gene CTD PMID:25304211 Map3k1 Rat arsenic atom multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of MAP3K1 mRNA CTD PMID:39836092 Map3k1 Rat benzo[a]pyrene increases expression ISO MAP3K1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of MAP3K1 protein CTD PMID:16041517 Map3k1 Rat benzo[a]pyrene decreases methylation ISO Map3k1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of MAP3K1 3' UTR more ... CTD PMID:27901495 Map3k1 Rat benzo[a]pyrene decreases methylation ISO MAP3K1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of MAP3K1 promoter CTD PMID:27901495 Map3k1 Rat benzo[a]pyrene multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 Nitrogen Oxides inhibits the reaction [Benzo(a)pyrene results in increased expression of MAP3K1 protein] CTD PMID:16041517 Map3k1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO MAP3K1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Map3k1 Rat bexarotene increases expression EXP 6480464 bexarotene results in increased expression of MAP3K1 mRNA CTD PMID:16648578 Map3k1 Rat bisphenol A affects expression ISO MAP3K1 (Homo sapiens) 6480464 bisphenol A affects the expression of MAP3K1 mRNA CTD PMID:20170705 Map3k1 Rat bisphenol A multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 [MAP3K1 protein co-treated with bisphenol A] results in decreased expression of APOA1 mRNA CTD PMID:31842455 Map3k1 Rat bisphenol A decreases expression ISO Map3k1 (Mus musculus) 6480464 bisphenol A results in decreased expression of MAP3K1 mRNA CTD PMID:33221593 Map3k1 Rat bisphenol A increases expression ISO MAP3K1 (Homo sapiens) 6480464 bisphenol A results in increased expression of MAP3K1 mRNA CTD PMID:29275510 and PMID:33670352 Map3k1 Rat bisphenol A decreases methylation ISO Map3k1 (Mus musculus) 6480464 bisphenol A results in decreased methylation of MAP3K1 promoter CTD PMID:27312807 Map3k1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MAP3K1 mRNA CTD PMID:25181051 Map3k1 Rat buta-1,3-diene decreases expression ISO Map3k1 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of MAP3K1 mRNA CTD PMID:29038090 Map3k1 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of MAP3K1 mRNA CTD PMID:19167457 Map3k1 Rat cadmium acetate affects expression EXP 6480464 cadmium acetate affects the expression of MAP3K1 mRNA CTD PMID:16249259 Map3k1 Rat cadmium dichloride increases expression ISO MAP3K1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of MAP3K1 mRNA CTD PMID:32512071 and PMID:38568856 Map3k1 Rat caffeine increases phosphorylation ISO MAP3K1 (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of MAP3K1 protein CTD PMID:35688186 Map3k1 Rat calcitriol increases expression ISO MAP3K1 (Homo sapiens) 6480464 Calcitriol results in increased expression of MAP3K1 mRNA CTD PMID:26485663 Map3k1 Rat carbon nanotube decreases expression ISO Map3k1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Map3k1 Rat carbon nanotube increases expression ISO Map3k1 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of MAP3K1 mRNA CTD PMID:25620056 Map3k1 Rat carboplatin decreases expression EXP 6480464 Carboplatin results in decreased expression of MAP3K1 mRNA CTD PMID:18172885 Map3k1 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of MAP3K1 mRNA CTD PMID:18172885 Map3k1 Rat CGP 52608 multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to MAP3K1 gene] CTD PMID:28238834 Map3k1 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of MAP3K1 mRNA CTD PMID:18172885 Map3k1 Rat cisplatin increases expression ISO Map3k1 (Mus musculus) 6480464 Cisplatin results in increased expression of MAP3K1 mRNA CTD PMID:26546572 Map3k1 Rat clozapine increases expression EXP 6480464 Clozapine results in increased expression of MAP3K1 mRNA CTD PMID:15860345 Map3k1 Rat copper atom multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of MAP3K1 mRNA CTD PMID:30911355 Map3k1 Rat copper(0) multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of MAP3K1 mRNA CTD PMID:30911355 Map3k1 Rat copper(II) sulfate increases expression ISO MAP3K1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of MAP3K1 mRNA CTD PMID:19549813 Map3k1 Rat curcumin multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 Curcumin inhibits the reaction [MAP3K1 protein results in increased expression of IVL mRNA] and Curcumin inhibits the reaction [Oxygen deficiency results in increased expression of MAP3K1 mRNA] CTD PMID:17148446 and PMID:23452621 Map3k1 Rat curcumin decreases expression ISO MAP3K1 (Homo sapiens) 6480464 Curcumin results in decreased expression of MAP3K1 mRNA CTD PMID:15713895 Map3k1 Rat cyclosporin A decreases expression ISO MAP3K1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of MAP3K1 mRNA CTD PMID:20106945 Map3k1 Rat cyhalothrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of MAP3K1 protein CTD PMID:34896426 Map3k1 Rat cypermethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of MAP3K1 protein CTD PMID:34896426 Map3k1 Rat D-glucose multiple interactions ISO Map3k1 (Mus musculus) 6480464 resveratrol inhibits the reaction [Glucose results in increased expression of MAP3K1 mRNA] CTD PMID:24659233 Map3k1 Rat D-glucose multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 [MAP3K1 gene mutant form results in increased activity of MAP3K1 protein] which results in increased susceptibility to Glucose CTD PMID:27278863 Map3k1 Rat D-glucose increases expression ISO Map3k1 (Mus musculus) 6480464 Glucose results in increased expression of MAP3K1 mRNA CTD PMID:24659233 Map3k1 Rat dacarbazine decreases response to substance ISO MAP3K1 (Homo sapiens) 6480464 MAP3K1 protein modified form results in decreased susceptibility to Dacarbazine CTD PMID:15123733 Map3k1 Rat Dibutyl phosphate affects expression ISO MAP3K1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MAP3K1 mRNA CTD PMID:37042841 Map3k1 Rat dibutyl phthalate increases expression ISO Map3k1 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of MAP3K1 mRNA CTD PMID:21266533 Map3k1 Rat diclofenac increases expression ISO Map3k1 (Mus musculus) 6480464 Diclofenac results in increased expression of MAP3K1 mRNA CTD PMID:26934552 Map3k1 Rat diethylstilbestrol increases expression ISO Map3k1 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of MAP3K1 mRNA CTD PMID:22467019 Map3k1 Rat dioxygen multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 3 more ... CTD PMID:23452621 Map3k1 Rat dioxygen increases expression ISO MAP3K1 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of MAP3K1 mRNA CTD PMID:23452621 Map3k1 Rat doxorubicin decreases expression ISO MAP3K1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MAP3K1 mRNA CTD PMID:29803840 Map3k1 Rat ellagic acid decreases expression ISO MAP3K1 (Homo sapiens) 6480464 Ellagic Acid results in decreased expression of MAP3K1 mRNA and Ellagic Acid results in decreased expression of MAP3K1 protein CTD PMID:23811531 Map3k1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of MAP3K1 mRNA CTD PMID:29391264 Map3k1 Rat enniatin decreases expression EXP 6480464 enniatins results in decreased expression of MAP3K1 mRNA CTD PMID:27163883 Map3k1 Rat epoxiconazole increases expression ISO Map3k1 (Mus musculus) 6480464 epoxiconazole results in increased expression of MAP3K1 mRNA CTD PMID:35436446 Map3k1 Rat fenvalerate multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of MAP3K1 protein CTD PMID:34896426 Map3k1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of MAP3K1 mRNA CTD PMID:24793618 Map3k1 Rat formaldehyde decreases expression ISO MAP3K1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of MAP3K1 mRNA CTD PMID:20655997 Map3k1 Rat FR900359 affects phosphorylation ISO MAP3K1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of MAP3K1 protein CTD PMID:37730182 Map3k1 Rat furan increases methylation EXP 6480464 furan results in increased methylation of MAP3K1 gene CTD PMID:22079235 Map3k1 Rat furan decreases expression EXP 6480464 furan results in decreased expression of MAP3K1 mRNA CTD PMID:26194646 Map3k1 Rat geldanamycin increases expression ISO MAP3K1 (Homo sapiens) 6480464 geldanamycin results in increased expression of MAP3K1 mRNA CTD PMID:26705709 Map3k1 Rat genistein multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 Genistein inhibits the reaction [Oxygen deficiency results in increased expression of MAP3K1 mRNA] CTD PMID:23452621 Map3k1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of MAP3K1 mRNA CTD PMID:22061828 Map3k1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of MAP3K1 mRNA CTD PMID:33387578 Map3k1 Rat glucose increases expression ISO Map3k1 (Mus musculus) 6480464 Glucose results in increased expression of MAP3K1 mRNA CTD PMID:24659233 Map3k1 Rat glucose multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 [MAP3K1 gene mutant form results in increased activity of MAP3K1 protein] which results in increased susceptibility to Glucose CTD PMID:27278863 Map3k1 Rat glucose multiple interactions ISO Map3k1 (Mus musculus) 6480464 resveratrol inhibits the reaction [Glucose results in increased expression of MAP3K1 mRNA] CTD PMID:24659233 Map3k1 Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of MAP3K1 mRNA CTD PMID:15860345 Map3k1 Rat heptachlor decreases expression ISO MAP3K1 (Homo sapiens) 6480464 Heptachlor results in decreased expression of MAP3K1 protein CTD PMID:9704902 Map3k1 Rat hexachlorobenzene affects expression EXP 6480464 Hexachlorobenzene affects the expression of MAP3K1 mRNA CTD PMID:15159207 Map3k1 Rat hyaluronic acid multiple interactions ISO Map3k1 (Mus musculus) 6480464 Hyaluronic Acid analog affects the localization of [MAP3K1 protein binds to CD44 protein] more ... CTD PMID:20159036 Map3k1 Rat iohexol increases expression ISO MAP3K1 (Homo sapiens) 6480464 Iohexol results in increased expression of MAP3K1 mRNA CTD PMID:29705293 Map3k1 Rat iopamidol increases expression ISO MAP3K1 (Homo sapiens) 6480464 Iopamidol results in increased expression of MAP3K1 mRNA CTD PMID:29705293 Map3k1 Rat lipopolysaccharide multiple interactions ISO Map3k1 (Mus musculus) 6480464 3 and 4-dihydroxybenzohydroxamic acid inhibits the reaction [Lipopolysaccharides results in increased expression of MAP3K1 mRNA] CTD PMID:25843059 Map3k1 Rat lipopolysaccharide increases expression ISO Map3k1 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of MAP3K1 mRNA CTD PMID:25843059 Map3k1 Rat LY294002 multiple interactions ISO Map3k1 (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [zinc chloride results in increased activity of MAP3K1 protein] CTD PMID:11306679 Map3k1 Rat microcystin-LR increases expression ISO Map3k1 (Mus musculus) 6480464 cyanoginosin LR results in increased expression of MAP3K1 mRNA CTD PMID:17654400 Map3k1 Rat monosodium L-glutamate decreases expression EXP 6480464 Sodium Glutamate results in decreased expression of MAP3K1 mRNA CTD PMID:28954212 Map3k1 Rat N-methyl-4-phenylpyridinium increases cleavage ISO MAP3K1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased cleavage of MAP3K1 protein CTD PMID:10737593 Map3k1 Rat nickel sulfate affects response to substance ISO Map3k1 (Mus musculus) 6480464 MAP3K1 protein affects the susceptibility to nickel sulfate CTD PMID:18467339 Map3k1 Rat nickel sulfate decreases expression ISO MAP3K1 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of MAP3K1 mRNA CTD PMID:22714537 Map3k1 Rat nickel sulfate multiple interactions ISO Map3k1 (Mus musculus) 6480464 [MAP3K1 protein co-treated with MAP3K2 protein] affects the susceptibility to nickel sulfate and MAP3K1 protein affects the reaction [nickel sulfate results in increased phosphorylation of MAPK8 protein] CTD PMID:18467339 Map3k1 Rat o-anisidine decreases expression ISO MAP3K1 (Homo sapiens) 6480464 2-anisidine results in decreased expression of MAP3K1 mRNA CTD PMID:28089782 Map3k1 Rat ochratoxin A decreases expression ISO MAP3K1 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of MAP3K1 mRNA CTD PMID:30763683 Map3k1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of MAP3K1 mRNA CTD PMID:25729387 Map3k1 Rat ozone multiple interactions ISO Map3k1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of MAP3K1 mRNA CTD PMID:34911549 Map3k1 Rat p-menthan-3-ol increases expression ISO MAP3K1 (Homo sapiens) 6480464 Menthol results in increased expression of MAP3K1 mRNA CTD PMID:26760959 Map3k1 Rat paclitaxel multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 aspartyl-glutamyl-valyl-aspartal inhibits the reaction [Paclitaxel results in increased cleavage of MAP3K1 protein] more ... CTD PMID:11160861 Map3k1 Rat paclitaxel increases cleavage ISO MAP3K1 (Homo sapiens) 6480464 Paclitaxel results in increased cleavage of MAP3K1 protein CTD PMID:11160861 Map3k1 Rat paclitaxel affects localization ISO MAP3K1 (Homo sapiens) 6480464 Paclitaxel affects the localization of MAP3K1 protein CTD PMID:11160861 Map3k1 Rat paracetamol affects expression ISO Map3k1 (Mus musculus) 6480464 Acetaminophen affects the expression of MAP3K1 mRNA CTD PMID:17562736 Map3k1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of MAP3K1 mRNA CTD PMID:33387578 Map3k1 Rat PCB138 multiple interactions ISO Map3k1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Map3k1 Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of MAP3K1 mRNA CTD PMID:19162173 Map3k1 Rat phenobarbital decreases expression ISO Map3k1 (Mus musculus) 6480464 Phenobarbital results in decreased expression of MAP3K1 mRNA CTD PMID:31836555 Map3k1 Rat phenylephrine multiple interactions EXP 6480464 MEKK1 protein affects the reaction [Phenylephrine results in increased expression of NPPA mRNA] CTD PMID:10727428 Map3k1 Rat phorbol 13-acetate 12-myristate multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 [MAP3K1 gene mutant form results in increased activity of MAP3K1 protein] which results in increased susceptibility to Tetradecanoylphorbol Acetate more ... CTD PMID:27278863 Map3k1 Rat potassium chromate multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of MAP3K1 mRNA CTD PMID:22079256 Map3k1 Rat potassium chromate decreases expression ISO MAP3K1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of MAP3K1 mRNA CTD PMID:22079256 Map3k1 Rat pyrethrins decreases expression EXP 6480464 Pyrethrins results in decreased expression of MAP3K1 protein CTD PMID:34896426 Map3k1 Rat quercetin increases expression ISO MAP3K1 (Homo sapiens) 6480464 Quercetin results in increased expression of MAP3K1 mRNA CTD PMID:23727915 Map3k1 Rat quercetin increases phosphorylation ISO MAP3K1 (Homo sapiens) 6480464 Quercetin results in increased phosphorylation of MAP3K1 protein CTD PMID:35688186 Map3k1 Rat resveratrol multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 resveratrol inhibits the reaction [Oxygen deficiency results in increased expression of MAP3K1 mRNA] CTD PMID:23452621 Map3k1 Rat resveratrol multiple interactions ISO Map3k1 (Mus musculus) 6480464 resveratrol inhibits the reaction [Glucose results in increased expression of MAP3K1 mRNA] CTD PMID:24659233 Map3k1 Rat SB 203580 multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 SB 203580 inhibits the reaction [[MAP3K1 gene mutant form results in increased activity of MAP3K1 protein] which results in increased susceptibility to Tetradecanoylphorbol Acetate] CTD PMID:27278863 Map3k1 Rat silver atom decreases expression ISO MAP3K1 (Homo sapiens) 6480464 Silver analog results in decreased expression of MAP3K1 mRNA CTD PMID:24462830 Map3k1 Rat silver atom decreases expression ISO Map3k1 (Mus musculus) 6480464 Silver results in decreased expression of MAP3K1 mRNA CTD PMID:27131904 Map3k1 Rat silver(0) decreases expression ISO MAP3K1 (Homo sapiens) 6480464 Silver analog results in decreased expression of MAP3K1 mRNA CTD PMID:24462830 Map3k1 Rat silver(0) decreases expression ISO Map3k1 (Mus musculus) 6480464 Silver results in decreased expression of MAP3K1 mRNA CTD PMID:27131904 Map3k1 Rat sodium arsenite decreases expression ISO MAP3K1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MAP3K1 mRNA CTD PMID:22714537 Map3k1 Rat sodium arsenite multiple interactions ISO MAP3K1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of MAP3K1 mRNA CTD PMID:39836092 Map3k1 Rat sodium arsenite affects methylation ISO MAP3K1 (Homo sapiens) 6480464 sodium arsenite affects the methylation of MAP3K1 gene CTD PMID:28589171 Map3k1 Rat sodium dichromate decreases expression ISO Map3k1 (Mus musculus) 6480464 sodium bichromate results in decreased expression of MAP3K1 mRNA CTD PMID:22155349 Map3k1 Rat sodium dodecyl sulfate decreases expression EXP 6480464 Sodium Dodecyl Sulfate results in decreased expression of MAP3K1 mRNA CTD PMID:12815608 Map3k1 Rat sodium fluoride decreases expression ISO Map3k1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of MAP3K1 mRNA CTD PMID:27862939 Map3k1 Rat sulindac sulfide decreases expression ISO MAP3K1 (Homo sapiens) 6480464 sulindac sulfide results in decreased expression of MAP3K1 mRNA CTD PMID:12734198 Map3k1 Rat tamoxifen affects expression ISO Map3k1 (Mus musculus) 6480464 Tamoxifen affects the expression of MAP3K1 mRNA CTD PMID:17555576 Map3k1 Rat Tanshinone I decreases expression ISO MAP3K1 (Homo sapiens) 6480464 tanshinone results in decreased expression of MAP3K1 mRNA CTD PMID:15849732 Map3k1 Rat temozolomide increases expression ISO MAP3K1 (Homo sapiens) 6480464 Temozolomide results in increased expression of MAP3K1 mRNA CTD PMID:31758290 Map3k1 Rat testosterone increases expression ISO Map3k1 (Mus musculus) 6480464 Testosterone deficiency results in increased expression of MAP3K1 mRNA CTD PMID:33848595 Map3k1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of MAP3K1 mRNA CTD PMID:31150632 Map3k1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of MAP3K1 mRNA CTD PMID:23411599 and PMID:34492290 Map3k1 Rat tipifarnib increases expression EXP 6480464 tipifarnib results in increased expression of MAP3K1 mRNA CTD PMID:16403772 Map3k1 Rat titanium dioxide decreases methylation ISO Map3k1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MAP3K1 gene and titanium dioxide results in decreased methylation of MAP3K1 promoter CTD PMID:35295148 Map3k1 Rat titanium dioxide increases methylation ISO Map3k1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of MAP3K1 gene CTD PMID:35295148 Map3k1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of MAP3K1 mRNA CTD PMID:25729387 Map3k1 Rat tungsten decreases expression ISO Map3k1 (Mus musculus) 6480464 Tungsten results in decreased expression of MAP3K1 mRNA CTD PMID:30912803 Map3k1 Rat undecane decreases expression EXP 6480464 undecane results in decreased expression of MAP3K1 protein CTD PMID:17337753 Map3k1 Rat urethane multiple interactions ISO Map3k1 (Mus musculus) 6480464 [Urethane co-treated with Freund's Adjuvant] results in increased expression of MAP3K1 mRNA more ... CTD PMID:11062179 and PMID:12400877 Map3k1 Rat urethane decreases expression ISO MAP3K1 (Homo sapiens) 6480464 Urethane results in decreased expression of MAP3K1 mRNA CTD PMID:28818685 Map3k1 Rat Urolithin A decreases expression ISO MAP3K1 (Homo sapiens) 6480464 3 more ... CTD PMID:23811531 Map3k1 Rat valproic acid increases methylation ISO MAP3K1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MAP3K1 gene CTD PMID:29154799 Map3k1 Rat valproic acid affects expression ISO MAP3K1 (Homo sapiens) 6480464 Valproic Acid affects the expression of MAP3K1 mRNA CTD PMID:25979313 Map3k1 Rat valproic acid decreases expression ISO MAP3K1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of MAP3K1 mRNA CTD PMID:23179753 and PMID:28001369 Map3k1 Rat vincristine decreases expression ISO MAP3K1 (Homo sapiens) 6480464 Vincristine results in decreased expression of MAP3K1 mRNA CTD PMID:23649840 Map3k1 Rat vitamin E multiple interactions ISO Map3k1 (Mus musculus) 6480464 Vitamin E inhibits the reaction [Urethane results in increased phosphorylation of and results in increased activity of MAP3K1 protein] CTD PMID:11062179 Map3k1 Rat zinc atom decreases expression EXP 6480464 Zinc results in decreased expression of MAP3K1 mRNA CTD PMID:17074742 Map3k1 Rat zinc dichloride multiple interactions ISO Map3k1 (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [zinc chloride results in increased activity of MAP3K1 protein] and PIK3CG protein affects the reaction [zinc chloride results in increased activity of MAP3K1 protein] CTD PMID:11306679 Map3k1 Rat zinc dichloride increases activity ISO Map3k1 (Mus musculus) 6480464 zinc chloride results in increased activity of MAP3K1 protein CTD PMID:11306679 Map3k1 Rat zinc sulfate decreases expression EXP 6480464 Zinc Sulfate results in decreased expression of MAP3K1 mRNA CTD PMID:17074742 Map3k1 Rat zinc(0) decreases expression EXP 6480464 Zinc results in decreased expression of MAP3K1 mRNA CTD PMID:17074742
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,2,4-trimethylbenzene (EXP) 1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP,ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,5-hexanedione (EXP) 2-methylcholine (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acetazolamide (ISO) alachlor (EXP) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) allethrin (EXP) amino acid (ISO) ammonium chloride (EXP) anthra[1,9-cd]pyrazol-6(2H)-one (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bexarotene (EXP) bisphenol A (EXP,ISO) buta-1,3-diene (ISO) C60 fullerene (EXP) cadmium acetate (EXP) cadmium dichloride (ISO) caffeine (ISO) calcitriol (ISO) carbon nanotube (ISO) carboplatin (EXP) cefaloridine (EXP) CGP 52608 (ISO) cisplatin (EXP,ISO) clozapine (EXP) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) curcumin (ISO) cyclosporin A (ISO) cyhalothrin (EXP) cypermethrin (EXP) D-glucose (ISO) dacarbazine (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) diclofenac (ISO) diethylstilbestrol (ISO) dioxygen (ISO) doxorubicin (ISO) ellagic acid (ISO) endosulfan (EXP) enniatin (EXP) epoxiconazole (ISO) fenvalerate (EXP) flutamide (EXP) formaldehyde (ISO) FR900359 (ISO) furan (EXP) geldanamycin (ISO) genistein (ISO) gentamycin (EXP) glucose (ISO) haloperidol (EXP) heptachlor (ISO) hexachlorobenzene (EXP) hyaluronic acid (ISO) iohexol (ISO) iopamidol (ISO) lipopolysaccharide (ISO) LY294002 (ISO) microcystin-LR (ISO) monosodium L-glutamate (EXP) N-methyl-4-phenylpyridinium (ISO) nickel sulfate (ISO) o-anisidine (ISO) ochratoxin A (ISO) oxaliplatin (EXP) ozone (ISO) p-menthan-3-ol (ISO) paclitaxel (ISO) paracetamol (EXP,ISO) PCB138 (ISO) phenobarbital (EXP,ISO) phenylephrine (EXP) phorbol 13-acetate 12-myristate (ISO) potassium chromate (ISO) pyrethrins (EXP) quercetin (ISO) resveratrol (ISO) SB 203580 (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium dichromate (ISO) sodium dodecyl sulfate (EXP) sodium fluoride (ISO) sulindac sulfide (ISO) tamoxifen (ISO) Tanshinone I (ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (EXP) thioacetamide (EXP) tipifarnib (EXP) titanium dioxide (ISO) topotecan (EXP) tungsten (ISO) undecane (EXP) urethane (ISO) Urolithin A (ISO) valproic acid (ISO) vincristine (ISO) vitamin E (ISO) zinc atom (EXP) zinc dichloride (ISO) zinc sulfate (EXP) zinc(0) (EXP)
1.
Direct activation of mitogen-activated protein kinase kinase kinase MEKK1 by the Ste20p homologue GCK and the adapter protein TRAF2.
Chadee DN, etal., Mol Cell Biol 2002 Feb;22(3):737-49.
2.
Signal transduction mediated by the Ras/Raf/MEK/ERK pathway from cytokine receptors to transcription factors: potential targeting for therapeutic intervention.
Chang F, etal., Leukemia 2003 Jul;17(7):1263-93.
3.
The MEKK1 PHD ubiquitinates TAB1 to activate MAPKs in response to cytokines.
Charlaftis N, etal., EMBO J. 2014 Nov 3;33(21):2581-96. doi: 10.15252/embj.201488351. Epub 2014 Sep 26.
4.
MEKK1 controls matrix degradation and tumor cell dissemination during metastasis of polyoma middle-T driven mammary cancer.
Cuevas BD, etal., Oncogene. 2006 Aug 17;25(36):4998-5010. doi: 10.1038/sj.onc.1209507. Epub 2006 Mar 27.
5.
Genome-wide association study identifies novel breast cancer susceptibility loci.
Easton DF, etal., Nature. 2007 Jun 28;447(7148):1087-93.
6.
MEK kinases are regulated by EGF and selectively interact with Rac/Cdc42.
Fanger GR, etal., EMBO J. 1997 Aug 15;16(16):4961-72.
7.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
9.
Establishment of a hepatocellular carcinoma patient-derived xenograft platform and its application in biomarker identification.
Hu B, etal., Int J Cancer. 2020 Mar 15;146(6):1606-1617. doi: 10.1002/ijc.32564. Epub 2019 Aug 9.
10.
Clinical correlates of low-risk variants in FGFR2, TNRC9, MAP3K1, LSP1 and 8q24 in a Dutch cohort of incident breast cancer cases.
Huijts PE, etal., Breast Cancer Res. 2007;9(6):R78.
11.
Differential binding of ceramide to MEKK1 in glomerular endothelial and mesangial cells.
Huwiler A, etal., Biochim Biophys Acta. 2004 Mar 22;1636(2-3):159-68.
12.
The c-jun kinase/stress-activated pathway: regulation, function and role in human disease.
Johnson GL and Nakamura K, Biochim Biophys Acta. 2007 Aug;1773(8):1341-8. Epub 2007 Jan 4.
13.
Reconstitution of mitogen-activated protein kinase phosphorylation cascades in bacteria. Efficient synthesis of active protein kinases.
Khokhlatchev A, etal., J Biol Chem. 1997 Apr 25;272(17):11057-62.
14.
Genetic variations in multiple drug action pathways and survival in advanced stage non-small cell lung cancer treated with chemotherapy.
Li Y, etal., Clin Cancer Res. 2011 Jun 1;17(11):3830-40. doi: 10.1158/1078-0432.CCR-10-2877.
15.
The PHD domain of MEKK1 acts as an E3 ubiquitin ligase and mediates ubiquitination and degradation of ERK1/2.
Lu Z, etal., Mol Cell 2002 May;9(5):945-56.
16.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
17.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
18.
Genes harbouring susceptibility SNPs are differentially expressed in the breast cancer subtypes.
Nordgard SH, etal., Breast Cancer Res. 2007;9(6):113.
19.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
20.
MEK mediates v-Src-induced disruption of the actin cytoskeleton via inactivation of the Rho-ROCK-LIM kinase pathway.
Pawlak G and Helfman DM, J Biol Chem 2002 Jul 26;277(30):26927-33.
21.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
22.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
23.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
24.
GOA pipeline
RGD automated data pipeline
25.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
26.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
27.
MAP kinase genes and colon and rectal cancer.
Slattery ML, etal., Carcinogenesis. 2012 Dec;33(12):2398-408. doi: 10.1093/carcin/bgs305. Epub 2012 Oct 1.
28.
Dietary influence on MAPK-signaling pathways and risk of colon and rectal cancer.
Slattery ML, etal., Nutr Cancer. 2013;65(5):729-38. doi: 10.1080/01635581.2013.795599.
29.
MAP3K1 functionally interacts with Axin1 in the canonical Wnt signalling pathway.
Sue Ng S, etal., Biol Chem. 2010 Feb-Mar;391(2-3):171-180. doi: 10.1515/bc.2010.028.
30.
Modulation of human cytomegalovirus immediate-early gene enhancer by mitogen-activated protein kinase kinase kinase-1.
Sun B, etal., J Cell Biochem. 2001;83(4):563-73.
31.
MAP kinase- and Rho-dependent signals interact to regulate gene expression but not actin morphology in cardiac muscle cells.
Thorburn J, etal., EMBO J. 1997 Apr 15;16(8):1888-900.
32.
MEKK1 controls neurite regrowth after experimental injury by balancing ERK1/2 and JNK2 signaling.
Waetzig V and Herdegen T, Mol Cell Neurosci. 2005 Sep;30(1):67-78.
33.
A MAP3k1 SNP predicts survival of gastric cancer in a Chinese population.
Wei X, etal., PLoS One. 2014 Apr 23;9(4):e96083. doi: 10.1371/journal.pone.0096083. eCollection 2014.
34.
MEKK1 mediates the ubiquitination and degradation of c-Jun in response to osmotic stress.
Xia Y, etal., Mol Cell Biol. 2007 Jan;27(2):510-7. Epub 2006 Nov 13.
35.
Cloning of rat MEK kinase 1 cDNA reveals an endogenous membrane-associated 195-kDa protein with a large regulatory domain.
Xu S, etal., Proc Natl Acad Sci U S A 1996 May 28;93(11):5291-5.
36.
MEKK1 phosphorylates MEK1 and MEK2 but does not cause activation of mitogen-activated protein kinase.
Xu S, etal., Proc Natl Acad Sci U S A. 1995 Jul 18;92(15):6808-12.
37.
MAP3K1 rs889312 genotypes influence survival outcomes of Chinese gastric cancer patients who received adjuvant chemotherapy based on platinum and fluorouracil regimes.
Yang J, etal., Onco Targets Ther. 2019 Aug 22;12:6843-6855. doi: 10.2147/OTT.S205438. eCollection 2019.
38.
Interaction effects between genes involved in the AKT signaling pathway and phytoestrogens in gastric carcinogenesis: a nested case-control study from the Korean Multi-Center Cancer Cohort.
Yang JJ, etal., Mol Nutr Food Res. 2012 Nov;56(11):1617-26. doi: 10.1002/mnfr.201200169. Epub 2012 Oct 5.
39.
Association Study of MAP3K1 SNPs and Risk Factors with Susceptibility to Esophageal Squamous Cell Carcinoma in a Chinese Population: A Case-Control Study.
Yang Y, etal., Pharmgenomics Pers Med. 2020 Jul 3;13:189-197. doi: 10.2147/PGPM.S256230. eCollection 2020.
40.
Role of MEKK1 in cell survival and activation of JNK and ERK pathways defined by targeted gene disruption.
Yujiri T, etal., Science 1998 Dec 4;282(5395):1911-4.
41.
Caspase-3 mediated cleavage of MEKK1 promotes p53 transcriptional activity.
Zebrowski DC, etal., J Mol Cell Cardiol. 2006 May;40(5):605-18. Epub 2006 Jan 19.
Map3k1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 45,081,889 - 45,150,555 (-) NCBI GRCr8 mRatBN7.2 2 43,348,572 - 43,414,706 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 43,350,098 - 43,414,463 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 50,464,742 - 50,530,977 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 48,523,204 - 48,589,428 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 43,374,713 - 43,440,941 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 43,329,516 - 43,393,203 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 43,329,516 - 43,393,207 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 62,373,717 - 62,440,715 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 43,062,252 - 43,126,058 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 42,987,560 - 43,051,968 (-) NCBI Celera 2 39,134,930 - 39,199,049 (-) NCBI Celera Cytogenetic Map 2 q14 NCBI
MAP3K1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 56,815,549 - 56,896,152 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 56,815,549 - 56,896,152 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 56,111,376 - 56,191,979 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 56,146,657 - 56,227,736 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 5 53,065,179 - 53,146,179 (+) NCBI Celera Cytogenetic Map 5 q11.2 NCBI HuRef 5 53,082,897 - 53,163,892 (+) NCBI HuRef CHM1_1 5 56,113,966 - 56,195,023 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 57,643,875 - 57,724,397 (+) NCBI T2T-CHM13v2.0
Map3k1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 111,882,962 - 111,954,803 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 111,882,962 - 111,945,527 (-) Ensembl GRCm39 Ensembl GRCm38 13 111,746,428 - 111,818,269 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 111,746,428 - 111,808,993 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 112,536,641 - 112,599,191 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 112,867,468 - 112,929,861 (-) NCBI MGSCv36 mm8 Celera 13 116,043,507 - 116,076,666 (-) NCBI Celera Cytogenetic Map 13 D2.2 NCBI cM Map 13 63.36 NCBI
Map3k1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955446 11,021,971 - 11,090,136 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955446 11,022,091 - 11,090,136 (-) NCBI ChiLan1.0 ChiLan1.0
MAP3K1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 57,027,936 - 57,108,549 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 55,181,567 - 55,262,180 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 57,116,405 - 57,197,017 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 58,745,573 - 58,826,959 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 58,745,579 - 58,826,959 (-) Ensembl panpan1.1 panPan2
MAP3K1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 43,918,210 - 43,996,817 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 43,917,604 - 43,995,209 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 40,979,535 - 41,058,128 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 44,400,091 - 44,478,773 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 44,400,091 - 44,476,998 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 41,477,057 - 41,555,639 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 42,280,433 - 42,359,075 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 43,100,342 - 43,179,022 (+) NCBI UU_Cfam_GSD_1.0
Map3k1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 202,144,631 - 202,220,196 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936480 11,083,605 - 11,156,691 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936480 11,082,811 - 11,156,691 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MAP3K1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 35,872,131 - 35,946,987 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 35,872,301 - 35,947,097 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 38,138,087 - 38,212,844 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MAP3K1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 53,040,731 - 53,120,784 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 53,084,023 - 53,120,772 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666049 1,934,475 - 2,010,412 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Map3k1
.
Predicted Target Of
Count of predictions: 63 Count of miRNA genes: 60 Interacting mature miRNAs: 63 Transcripts: ENSRNOT00000017968 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
2293671 Bss44 Bone structure and strength QTL 44 10.97 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 2 43162366 148478373 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2293676 Bmd19 Bone mineral density QTL 19 10.7 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 43162366 111362592 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 2293682 Bmd24 Bone mineral density QTL 24 8.9 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 2 43162366 111362592 Rat 731167 Glom4 Glomerulus QTL 4 2.4 0.0082 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 2 20304672 65304672 Rat 152025242 Bw191 Body weight QTL 191 3.62 body mass (VT:0001259) 2 38573329 122609194 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 10402051 Gdil2 Gastrointestinal dilation QTL 2 enteric ganglion morphology trait (VT:0001045) length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836) 2 24903853 74786777 Rat 70174 BpQTLCluster2 Blood pressure QTL cluster 2 4.24 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 2 40067944 102785628 Rat 731179 Mamtr3 Mammary tumor resistance QTL 3 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 32373770 43665178 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 631208 Bw1 Body weight QTL1 5.09 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 2 43171017 83575226 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1300155 Bp174 Blood pressure QTL 174 4.09 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 2 42804607 60653831 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat 2300168 Bmd47 Bone mineral density QTL 47 6.6 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 2 20662448 65662448 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1578664 Bmd9 Bone mineral QTL density 9 5 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 11852062 49003364 Rat 1357990 Ael1 Aortic elastin QTL 1 3.1 0.00091 aorta elastin amount (VT:0003905) aortic elastin 2 19076825 64076825 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 12879863 Bp402 Blood pressure QTL 402 0.003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 41125789 56532139 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 731184 Mamtr4 Mammary tumor resistance QTL 4 0.0003 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 16491740 61491740 Rat 61371 Edpm1 Estrogen-dependent pituitary mass QTL 1 4 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 35134841 88029593 Rat 10755430 Coatc6 Coat color QTL 6 0.02576 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 11591100 56591100 Rat 7387318 Stl32 Serum triglyceride level QTL 32 3.2 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 22384627 67384627 Rat 10755436 Coatc8 Coat color QTL 8 0.02431 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 35023117 80023117 Rat 10755434 Coatc7 Coat color QTL 7 0.04794 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 30648065 75648065 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300160 Hrtrt3 Heart rate QTL 3 3.62 heart pumping trait (VT:2000009) absolute change in heart rate (CMO:0000534) 2 29971593 51729300 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 738012 Anxrr3 Anxiety related response QTL 3 3.8 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 2 9023519 54023519 Rat 9685065 Swd6 Spike wave discharge measurement QTL 6 5.8 0.01 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge rate (CMO:0001739) 2 39223937 48793699 Rat 9590095 Sffal3 Serum free fatty acids level QTL 3 6.78 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 2 27157160 72157160 Rat 1643006 Pain1 Pain QTL 1 3.63 0.005 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 2 26999571 48268661 Rat 2293835 Kiddil5 Kidney dilation QTL 5 3.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 157142209 Rat 1354617 Bp240 Blood pressure QTL 240 4 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 81754745 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 1354603 Bp243 Blood pressure QTL 243 3.9 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 127469484 Rat
REN28005
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 43,413,750 - 43,413,978 (+) MAPPER mRatBN7.2 Rnor_6.0 2 43,392,495 - 43,392,722 NCBI Rnor6.0 Rnor_6.0 2 43,999,303 - 43,999,530 NCBI Rnor6.0 Rnor_5.0 2 63,045,920 - 63,046,147 UniSTS Rnor5.0 Rnor_5.0 2 62,438,893 - 62,439,120 UniSTS Rnor5.0 RGSC_v3.4 2 43,125,231 - 43,125,458 UniSTS RGSC3.4 Cytogenetic Map 2 q14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017968 ⟹ ENSRNOP00000017968
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 43,350,765 - 43,414,463 (-) Ensembl Rnor_6.0 Ensembl 2 43,329,516 - 43,393,207 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000065473 ⟹ ENSRNOP00000063470
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 43,350,765 - 43,413,000 (-) Ensembl Rnor_6.0 Ensembl 2 43,938,508 - 43,999,107 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114100 ⟹ ENSRNOP00000088035
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 43,350,098 - 43,414,463 (-) Ensembl
RefSeq Acc Id:
NM_053887 ⟹ NP_446339
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 45,081,889 - 45,148,018 (-) NCBI mRatBN7.2 2 43,348,572 - 43,414,706 (-) NCBI Rnor_6.0 2 43,329,516 - 43,393,203 (-) NCBI Rnor_5.0 2 62,373,717 - 62,440,715 (-) NCBI RGSC_v3.4 2 43,062,252 - 43,126,058 (-) RGD Celera 2 39,134,930 - 39,199,049 (-) RGD
Sequence:
GAATTCCGCACCCGGGGCGGGACAAGAGGTCTGCTTTCCAAAGAGAAGGCTTCGCGTCTGTCTGCAGCAGGCGACAGTCCCGGGCGCCACCTGCGCTTCGGGCGCGGGCCAGGCTGGTGCGCGCCGGG
hide sequence
RefSeq Acc Id:
XM_039101582 ⟹ XP_038957510
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 45,081,889 - 45,150,555 (-) NCBI mRatBN7.2 2 43,348,572 - 43,414,521 (-) NCBI
RefSeq Acc Id:
NP_446339 ⟸ NM_053887
- UniProtKB:
F1M778 (UniProtKB/TrEMBL), H9BFG7 (UniProtKB/TrEMBL)
- Sequence:
MAAAAGDRASSSGFPGAAAASPEAGGGGGALQGSGAPAAGAGLLRETGSAGRERADWRRQQLRKVRSVELDQLPEQPLFLTASPPCPSTSPSPEPADAAAGASGFQPAAGPPPPGAASRCGSHSAELA
hide sequence
Ensembl Acc Id:
ENSRNOP00000017968 ⟸ ENSRNOT00000017968
RefSeq Acc Id:
XP_038957510 ⟸ XM_039101582
- Peptide Label:
isoform X1
- UniProtKB:
F1M778 (UniProtKB/TrEMBL), H9BFG7 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000063470 ⟸ ENSRNOT00000065473
Ensembl Acc Id:
ENSRNOP00000088035 ⟸ ENSRNOT00000114100
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Map3k1
mitogen-activated protein kinase kinase kinase 1
LOC100912399
mitogen-activated protein kinase kinase kinase 1-like
Data merged from RGD:6487511
737654 PROVISIONAL
2016-03-22
Map3k1
mitogen-activated protein kinase kinase kinase 1
Map3k1
mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-12-02
Map3k1
mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase
Map3k1
mitogen activated protein kinase kinase kinase 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-07-05
LOC100912399
mitogen-activated protein kinase kinase kinase 1-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-01-20
Map3k1
mitogen activated protein kinase kinase kinase 1
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Map3k1
mitogen activated protein kinase kinase kinase 1
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_domains
contains a PHD domain that has E3 ubiquitin ligase activity
729224
gene_process
an upstream activator of the ERK and JNK through its kinase domain
729224
