Symbol:
Prkd1
Name:
protein kinase D1
RGD ID:
620964
Description:
Enables heat shock protein binding activity; protein kinase C binding activity; and protein serine/threonine kinase activity. Involved in several processes, including cellular response to peptide hormone stimulus; positive regulation of macromolecule metabolic process; and positive regulation of transport. Located in several cellular components, including Z disc; nucleus; and perinuclear region of cytoplasm. Biomarker of myocardial infarction. Human ortholog(s) of this gene implicated in congenital heart disease. Orthologous to human PRKD1 (protein kinase D1); PARTICIPATES IN insulin-like growth factor signaling pathway; INTERACTS WITH (R)-noradrenaline; 2,3',4,4',5-Pentachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
nPKC-D1; nPKC-mu; Pkcm; Prkcm; protein kinase C mu type; protein kinase C, mu; protein kinase D; serine/threonine-protein kinase D1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRKD1 (protein kinase D1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Prkd1 (protein kinase D1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Prkd1 (protein kinase D1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRKD1 (protein kinase D1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRKD1 (protein kinase D1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prkd1 (protein kinase D1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRKD1 (protein kinase D1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prkd1 (protein kinase D1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
TM2D3 (TM2 domain containing 3) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
PRKD1 (protein kinase D1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Prkd1 (protein kinase D1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prkd1 (protein kinase D1)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
dkf-1
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
PKD
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
dkf-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
prkd1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 73,460,640 - 73,774,433 (-) NCBI GRCr8 mRatBN7.2 6 67,725,193 - 68,039,002 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 67,725,905 - 68,039,042 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 68,177,553 - 68,489,871 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 68,484,172 - 68,796,501 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 67,919,348 - 68,237,248 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 71,035,017 - 71,349,531 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 71,035,332 - 71,349,249 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 80,600,725 - 80,914,319 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 70,364,135 - 70,682,006 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 70,393,721 - 70,394,895 (-) NCBI Celera 6 66,643,414 - 66,954,727 (-) NCBI Celera Cytogenetic Map 6 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prkd1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO PRKD1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PRKD1 mRNA CTD PMID:22079256 Prkd1 Rat (1->4)-beta-D-glucan multiple interactions ISO Prkd1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PRKD1 mRNA CTD PMID:36331819 Prkd1 Rat (R)-noradrenaline multiple interactions ISO PRKD1 (Homo sapiens) 6480464 PRKD1 protein affects the reaction [Norepinephrine results in increased phosphorylation of MYL1 protein] and PRKD1 protein affects the reaction [Norepinephrine results in increased phosphorylation of PPP1R12A protein] CTD PMID:37963515 Prkd1 Rat (R)-noradrenaline multiple interactions EXP 6480464 CRT 0066101 inhibits the reaction [Norepinephrine results in increased phosphorylation of PRKD1 protein] CTD PMID:37963515 Prkd1 Rat (R)-noradrenaline increases phosphorylation EXP 6480464 Norepinephrine results in increased phosphorylation of PRKD1 protein CTD PMID:37963515 Prkd1 Rat 1,1-dichloroethene decreases expression ISO Prkd1 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of PRKD1 mRNA CTD PMID:26682919 Prkd1 Rat 1,2-dimethylhydrazine increases expression ISO Prkd1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PRKD1 mRNA CTD PMID:22206623 Prkd1 Rat 17beta-estradiol decreases expression ISO Prkd1 (Mus musculus) 6480464 Estradiol results in decreased expression of PRKD1 mRNA CTD PMID:19484750 Prkd1 Rat 17beta-estradiol decreases expression ISO PRKD1 (Homo sapiens) 6480464 Estradiol results in decreased expression of PRKD1 mRNA CTD PMID:31614463 Prkd1 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:31020377 Prkd1 Rat 2,3',4,4',5-Pentachlorobiphenyl affects expression EXP 6480464 2 more ... CTD PMID:31020377 Prkd1 Rat 2,3',4,4',5-Pentachlorobiphenyl multiple interactions EXP 6480464 DAPK2 protein affects the reaction [2 more ... CTD PMID:31020377 Prkd1 Rat 2,3',4,4',5-Pentachlorobiphenyl increases phosphorylation EXP 6480464 2 more ... CTD PMID:31020377 Prkd1 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Prkd1 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Prkd1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PRKD1 mRNA CTD PMID:22298810 Prkd1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRKD1 mRNA CTD PMID:32109520 Prkd1 Rat 2-methoxyethanol increases expression EXP 6480464 methyl cellosolve metabolite results in increased expression of PRKD1 protein CTD PMID:11794376 Prkd1 Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO PRKD1 (Homo sapiens) 6480464 bisindolylmaleimide I affects the reaction [Tetradecanoylphorbol Acetate affects the phosphorylation of PRKD1 protein] CTD PMID:15380616 Prkd1 Rat 4,4'-diaminodiphenylmethane increases expression ISO Prkd1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of PRKD1 mRNA CTD PMID:18648102 Prkd1 Rat 4,4'-sulfonyldiphenol affects methylation ISO Prkd1 (Mus musculus) 6480464 bisphenol S affects the methylation of PRKD1 gene CTD PMID:31683443 Prkd1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Prkd1 (Mus musculus) 6480464 Fenretinide results in decreased expression of PRKD1 mRNA CTD PMID:28973697 Prkd1 Rat aflatoxin B1 affects methylation ISO PRKD1 (Homo sapiens) 6480464 Aflatoxin B1 affects the methylation of PRKD1 intron CTD PMID:30157460 Prkd1 Rat Aflatoxin B2 alpha decreases methylation ISO PRKD1 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of PRKD1 intron CTD PMID:30157460 Prkd1 Rat aldrin increases expression ISO Prkd1 (Mus musculus) 6480464 Aldrin results in increased expression of PRKD1 mRNA CTD PMID:18579281 Prkd1 Rat all-trans-retinoic acid increases expression ISO Prkd1 (Mus musculus) 6480464 Tretinoin results in increased expression of PRKD1 mRNA CTD PMID:16604517 Prkd1 Rat all-trans-retinoic acid increases expression ISO PRKD1 (Homo sapiens) 6480464 Tretinoin results in increased expression of PRKD1 mRNA CTD PMID:21934132 Prkd1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PRKD1 mRNA CTD PMID:16483693 Prkd1 Rat angiotensin II affects localization EXP 288084581 Angiotensin II affects localization of Prkd1 protein in cardiomyocytes RGD Prkd1 Rat antirheumatic drug increases expression ISO PRKD1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of PRKD1 mRNA CTD PMID:24449571 Prkd1 Rat aristolochic acid A decreases expression ISO PRKD1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PRKD1 mRNA CTD PMID:33212167 Prkd1 Rat arsane affects methylation ISO PRKD1 (Homo sapiens) 6480464 Arsenic affects the methylation of PRKD1 gene CTD PMID:25304211 Prkd1 Rat arsenic atom affects methylation ISO PRKD1 (Homo sapiens) 6480464 Arsenic affects the methylation of PRKD1 gene CTD PMID:25304211 Prkd1 Rat arsenite(3-) multiple interactions ISO Prkd1 (Mus musculus) 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of PRKD1 mRNA CTD PMID:15894712 Prkd1 Rat arsenite(3-) decreases expression ISO Prkd1 (Mus musculus) 6480464 arsenite results in decreased expression of PRKD1 mRNA CTD PMID:15894712 Prkd1 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of PRKD1 gene CTD PMID:35440735 Prkd1 Rat benzo[a]pyrene multiple interactions ISO Prkd1 (Mus musculus) 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of PRKD1 mRNA CTD PMID:15894712 Prkd1 Rat benzo[a]pyrene increases methylation ISO PRKD1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PRKD1 exon and Benzo(a)pyrene results in increased methylation of PRKD1 promoter CTD PMID:27901495 Prkd1 Rat benzo[a]pyrene increases expression ISO Prkd1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PRKD1 mRNA CTD PMID:22228805 Prkd1 Rat benzo[a]pyrene decreases expression ISO PRKD1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PRKD1 mRNA CTD PMID:20106945 and PMID:21632981 Prkd1 Rat benzo[a]pyrene decreases expression ISO Prkd1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PRKD1 mRNA CTD PMID:15894712 Prkd1 Rat benzo[e]pyrene increases methylation ISO PRKD1 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of PRKD1 intron CTD PMID:30157460 Prkd1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Prkd1 (Mus musculus) 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate] affects the expression of PRKD1 protein CTD PMID:38995844 Prkd1 Rat bisphenol A decreases methylation ISO PRKD1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of PRKD1 gene CTD PMID:31601247 Prkd1 Rat bisphenol A increases expression ISO PRKD1 (Homo sapiens) 6480464 bisphenol A results in increased expression of PRKD1 mRNA CTD PMID:36232920 Prkd1 Rat bisphenol F increases expression ISO Prkd1 (Mus musculus) 6480464 bisphenol F results in increased expression of PRKD1 mRNA CTD PMID:30951980 Prkd1 Rat butanal decreases expression ISO PRKD1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of PRKD1 mRNA CTD PMID:26079696 Prkd1 Rat Butylbenzyl phthalate multiple interactions ISO Prkd1 (Mus musculus) 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate] affects the expression of PRKD1 protein CTD PMID:38995844 Prkd1 Rat cadmium dichloride decreases expression ISO PRKD1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of PRKD1 mRNA CTD PMID:38568856 Prkd1 Rat calcitriol multiple interactions ISO PRKD1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of PRKD1 mRNA CTD PMID:21592394 Prkd1 Rat calcitriol decreases expression ISO PRKD1 (Homo sapiens) 6480464 Calcitriol results in decreased expression of PRKD1 mRNA CTD PMID:21592394 Prkd1 Rat calcium atom multiple interactions ISO PRKD1 (Homo sapiens) 6480464 PRKD1 promotes the reaction [Capsaicin results in increased uptake of Calcium] CTD PMID:15471852 Prkd1 Rat calcium atom multiple interactions EXP 6480464 PRKD1 mutant form inhibits the reaction [Capsaicin results in increased uptake of Calcium] CTD PMID:15471852 Prkd1 Rat calcium(0) multiple interactions ISO PRKD1 (Homo sapiens) 6480464 PRKD1 promotes the reaction [Capsaicin results in increased uptake of Calcium] CTD PMID:15471852 Prkd1 Rat calcium(0) multiple interactions EXP 6480464 PRKD1 mutant form inhibits the reaction [Capsaicin results in increased uptake of Calcium] CTD PMID:15471852 Prkd1 Rat capsaicin multiple interactions EXP 6480464 PRKD1 mutant form inhibits the reaction [Capsaicin results in increased uptake of Calcium] CTD PMID:15471852 Prkd1 Rat capsaicin multiple interactions ISO PRKD1 (Homo sapiens) 6480464 PRKD1 promotes the reaction [Capsaicin results in increased uptake of Calcium] CTD PMID:15471852 Prkd1 Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of PRKD1 mRNA CTD PMID:19368821 Prkd1 Rat cisplatin decreases expression ISO PRKD1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of PRKD1 mRNA CTD PMID:27392435 Prkd1 Rat cisplatin multiple interactions ISO PRKD1 (Homo sapiens) 6480464 Cisplatin promotes the reaction [jinfukang results in decreased expression of PRKD1 mRNA] and jinfukang promotes the reaction [Cisplatin results in decreased expression of PRKD1 mRNA] CTD PMID:27392435 Prkd1 Rat dapsone multiple interactions ISO Prkd1 (Mus musculus) 6480464 Dapsone inhibits the reaction [Paraquat results in increased phosphorylation of PRKD1 protein] CTD PMID:21765237 Prkd1 Rat DDT decreases methylation EXP 6480464 DDT results in decreased methylation of PRKD1 gene CTD PMID:31682807 Prkd1 Rat dibutyl phthalate multiple interactions ISO Prkd1 (Mus musculus) 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate] affects the expression of PRKD1 protein CTD PMID:38995844 Prkd1 Rat dibutylstannane increases phosphorylation ISO PRKD1 (Homo sapiens) 6480464 di-n-butyltin results in increased phosphorylation of PRKD1 protein CTD PMID:26228090 Prkd1 Rat dioxygen increases expression ISO PRKD1 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of PRKD1 mRNA CTD PMID:17175027 Prkd1 Rat dorsomorphin multiple interactions ISO PRKD1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PRKD1 mRNA CTD PMID:27188386 Prkd1 Rat doxorubicin decreases expression ISO PRKD1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PRKD1 mRNA CTD PMID:29803840 Prkd1 Rat Endothelin-1 affects localization EXP 288084581 Endothelin-1 affects localization of Prkd1 protein in cardiomyocytes RGD Prkd1 Rat entinostat decreases expression ISO PRKD1 (Homo sapiens) 6480464 entinostat results in decreased expression of PRKD1 mRNA CTD PMID:26272509 Prkd1 Rat entinostat multiple interactions ISO PRKD1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PRKD1 mRNA CTD PMID:27188386 Prkd1 Rat ethanol increases expression ISO Prkd1 (Mus musculus) 6480464 Ethanol results in increased expression of PRKD1 mRNA CTD PMID:30319688 Prkd1 Rat ethanol affects expression ISO Prkd1 (Mus musculus) 6480464 Ethanol affects the expression of PRKD1 mRNA CTD PMID:30319688 Prkd1 Rat fenamidone increases expression ISO Prkd1 (Mus musculus) 6480464 fenamidone results in increased expression of PRKD1 mRNA CTD PMID:27029645 Prkd1 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of PRKD1 mRNA CTD PMID:30307764 Prkd1 Rat FR900359 affects phosphorylation ISO PRKD1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of PRKD1 protein CTD PMID:37730182 Prkd1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PRKD1 mRNA CTD PMID:33387578 Prkd1 Rat Goe 6976 multiple interactions ISO Prkd1 (Mus musculus) 6480464 Go 6976 inhibits the reaction [[Tetradecanoylphorbol Acetate results in increased activity of PRKD1 protein] which affects the localization of HDAC5 protein] CTD PMID:19124542 Prkd1 Rat Ingenol 3,20-dibenzoate increases activity ISO PRKD1 (Homo sapiens) 6480464 ingenol dibenzoate results in increased activity of PRKD1 protein CTD PMID:15707588 Prkd1 Rat lipopolysaccharide decreases expression ISO PRKD1 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of PRKD1 protein CTD PMID:37182445 Prkd1 Rat lipopolysaccharide multiple interactions ISO PRKD1 (Homo sapiens) 6480464 [IL4 protein co-treated with IL13 protein] inhibits the reaction [Lipopolysaccharides results in decreased expression of PRKD1 protein] CTD PMID:37182445 Prkd1 Rat lysophosphatidic acid increases phosphorylation EXP 243065275 LPA increases phosphorylation of Prkd1 protein in neonatal ventricular myocytes RGD Prkd1 Rat malathion increases expression ISO PRKD1 (Homo sapiens) 6480464 Malathion results in increased expression of PRKD1 mRNA CTD PMID:32069766 Prkd1 Rat manganese atom increases expression ISO PRKD1 (Homo sapiens) 6480464 Manganese results in increased expression of PRKD1 mRNA CTD PMID:17175027 Prkd1 Rat manganese(0) increases expression ISO PRKD1 (Homo sapiens) 6480464 Manganese results in increased expression of PRKD1 mRNA CTD PMID:17175027 Prkd1 Rat manganese(II) chloride increases expression ISO PRKD1 (Homo sapiens) 6480464 manganese chloride results in increased expression of PRKD1 mRNA CTD PMID:17175027 Prkd1 Rat methapyrilene increases methylation ISO PRKD1 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of PRKD1 intron CTD PMID:30157460 Prkd1 Rat methoxyacetic acid increases expression EXP 6480464 methoxyacetic acid results in increased expression of PRKD1 protein CTD PMID:11794376 Prkd1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PRKD1 gene CTD PMID:35440735 Prkd1 Rat methylmercury chloride decreases expression ISO PRKD1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PRKD1 mRNA CTD PMID:28001369 Prkd1 Rat N-methyl-N'-nitro-N-nitrosoguanidine increases expression ISO PRKD1 (Homo sapiens) 6480464 Methylnitronitrosoguanidine results in increased expression of PRKD1 mRNA CTD PMID:12634122 Prkd1 Rat noradrenaline affects localization EXP 288084581 [Norepinephrine cotreated with propranolol] affects localization of Prkd1 protein in cardiomyocytes RGD Prkd1 Rat ozone multiple interactions ISO Prkd1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of PRKD1 mRNA CTD PMID:34911549 Prkd1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PRKD1 mRNA CTD PMID:33387578 Prkd1 Rat paraquat multiple interactions ISO Prkd1 (Mus musculus) 6480464 2-(1-(3-dimethylaminopropyl)-5-methoxyindol-3-yl)-3-(1H-indol-3-yl)maleimide inhibits the reaction [Paraquat results in increased phosphorylation of PRKD1 protein] and Dapsone inhibits the reaction [Paraquat results in increased phosphorylation of PRKD1 protein] CTD PMID:21765237 Prkd1 Rat paraquat increases phosphorylation ISO Prkd1 (Mus musculus) 6480464 Paraquat results in increased phosphorylation of PRKD1 protein CTD PMID:21765237 Prkd1 Rat perfluorooctane-1-sulfonic acid affects expression ISO Prkd1 (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of PRKD1 mRNA CTD PMID:19429403 Prkd1 Rat perfluorooctane-1-sulfonic acid increases phosphorylation ISO PRKD1 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased phosphorylation of PRKD1 protein CTD PMID:36106993 Prkd1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Prkd1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PRKD1 mRNA CTD PMID:36331819 Prkd1 Rat perfluorooctanoic acid affects expression ISO Prkd1 (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of PRKD1 mRNA CTD PMID:19429403 Prkd1 Rat phenylephrine affects localization ISO Prkd1 (Mus musculus) 6480464 Phenylephrine affects the localization of PRKD1 protein CTD PMID:19124542 Prkd1 Rat phenylephrine increases phosphorylation EXP 243065275 Phenylephrine increases phosphorylation of Prkd1 protein in neonatal ventricular myocytes RGD Prkd1 Rat phenylephrine multiple interactions ISO Prkd1 (Mus musculus) 6480464 [Phenylephrine results in increased activity of PRKD1 protein] which affects the localization of HDAC5 protein CTD PMID:19124542 Prkd1 Rat phenylephrine increases activity ISO Prkd1 (Mus musculus) 6480464 Phenylephrine results in increased activity of PRKD1 protein CTD PMID:19124542 Prkd1 Rat phorbol 13-acetate 12-myristate increases expression ISO PRKD1 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased expression of PRKD1 protein modified form CTD PMID:16532021 Prkd1 Rat phorbol 13-acetate 12-myristate increases phosphorylation ISO PRKD1 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased phosphorylation of PRKD1 protein CTD PMID:37562720 Prkd1 Rat phorbol 13-acetate 12-myristate increases phosphorylation EXP 243065275 PMA increases phosphorylation of Prkd1 protein in neonatal ventricular myocytes RGD Prkd1 Rat phorbol 13-acetate 12-myristate affects localization EXP 288084581 TPA affects localization of Prkd1 protein in cardiomyocytes RGD Prkd1 Rat phorbol 13-acetate 12-myristate affects localization ISO PRKD1 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate affects the localization of PRKD1 protein CTD PMID:21705328 and PMID:9852137 Prkd1 Rat phorbol 13-acetate 12-myristate increases phosphorylation ISO Prkd1 (Mus musculus) 6480464 Tetradecanoylphorbol Acetate results in increased phosphorylation of PRKD1 protein CTD PMID:21047949 Prkd1 Rat phorbol 13-acetate 12-myristate affects localization ISO Prkd1 (Mus musculus) 6480464 Tetradecanoylphorbol Acetate affects the localization of PRKD1 protein CTD PMID:19124542 Prkd1 Rat phorbol 13-acetate 12-myristate multiple interactions ISO Prkd1 (Mus musculus) 6480464 [Tetradecanoylphorbol Acetate results in increased activity of PRKD1 protein] which affects the localization of HDAC5 protein more ... CTD PMID:19124542 and PMID:21047949 Prkd1 Rat phorbol 13-acetate 12-myristate affects phosphorylation ISO PRKD1 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate affects the phosphorylation of PRKD1 protein CTD PMID:15380616 Prkd1 Rat phorbol 13-acetate 12-myristate multiple interactions ISO PRKD1 (Homo sapiens) 6480464 2-(1-(3-dimethylaminopropyl)-5-methoxyindol-3-yl)-3-(1H-indol-3-yl)maleimide affects the reaction [Tetradecanoylphorbol Acetate affects the phosphorylation of PRKD1 protein] more ... CTD PMID:15380616 more ... Prkd1 Rat potassium chromate decreases expression ISO PRKD1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of PRKD1 mRNA CTD PMID:22079256 Prkd1 Rat potassium chromate multiple interactions ISO PRKD1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PRKD1 mRNA CTD PMID:22079256 Prkd1 Rat progesterone multiple interactions ISO Prkd1 (Mus musculus) 6480464 PRKD1 protein promotes the reaction [[Tetradecanoylphorbol Acetate results in increased expression of and results in increased phosphorylation of STAR protein] which results in increased abundance of Progesterone] CTD PMID:21047949 Prkd1 Rat quercetin increases expression ISO PRKD1 (Homo sapiens) 6480464 Quercetin results in increased expression of PRKD1 mRNA CTD PMID:21632981 Prkd1 Rat resveratrol multiple interactions ISO PRKD1 (Homo sapiens) 6480464 resveratrol results in decreased phosphorylation of and results in decreased activity of PRKD1 protein CTD PMID:11008129 Prkd1 Rat resveratrol multiple interactions ISO Prkd1 (Mus musculus) 6480464 resveratrol results in decreased phosphorylation of and results in decreased activity of PRKD1 protein CTD PMID:23514766 Prkd1 Rat resveratrol multiple interactions EXP 6480464 resveratrol results in decreased phosphorylation of and results in decreased activity of PRKD1 protein CTD PMID:23514766 Prkd1 Rat resveratrol decreases phosphorylation ISO PRKD1 (Homo sapiens) 6480464 resveratrol analog results in decreased phosphorylation of PRKD1 protein CTD PMID:24832111 Prkd1 Rat SB 431542 multiple interactions ISO PRKD1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PRKD1 mRNA CTD PMID:27188386 Prkd1 Rat serpentine asbestos increases phosphorylation ISO Prkd1 (Mus musculus) 6480464 Asbestos and Serpentine results in increased phosphorylation of PRKD1 protein CTD PMID:19116364 Prkd1 Rat serpentine asbestos multiple interactions ISO Prkd1 (Mus musculus) 6480464 Asbestos more ... CTD PMID:19116364 Prkd1 Rat silicon dioxide decreases expression ISO PRKD1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of PRKD1 mRNA CTD PMID:25895662 Prkd1 Rat sodium arsenate decreases expression ISO Prkd1 (Mus musculus) 6480464 sodium arsenate results in decreased expression of PRKD1 mRNA CTD PMID:30953684 Prkd1 Rat sunitinib decreases expression ISO PRKD1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of PRKD1 mRNA CTD PMID:31533062 Prkd1 Rat testosterone multiple interactions ISO PRKD1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of PRKD1 mRNA CTD PMID:21592394 Prkd1 Rat testosterone decreases expression ISO PRKD1 (Homo sapiens) 6480464 Testosterone results in decreased expression of PRKD1 mRNA CTD PMID:21592394 Prkd1 Rat tetrachloromethane affects expression ISO Prkd1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of PRKD1 mRNA CTD PMID:17484886 Prkd1 Rat titanium dioxide increases methylation ISO Prkd1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of PRKD1 promoter CTD PMID:35295148 Prkd1 Rat titanium dioxide decreases methylation ISO Prkd1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PRKD1 promoter CTD PMID:35295148 Prkd1 Rat tributylstannane increases phosphorylation ISO PRKD1 (Homo sapiens) 6480464 tributyltin results in increased phosphorylation of PRKD1 protein CTD PMID:26228090 Prkd1 Rat urethane increases expression ISO PRKD1 (Homo sapiens) 6480464 Urethane results in increased expression of PRKD1 mRNA CTD PMID:28818685 Prkd1 Rat valproic acid increases expression ISO PRKD1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PRKD1 mRNA CTD PMID:29154799 Prkd1 Rat valproic acid affects expression ISO PRKD1 (Homo sapiens) 6480464 Valproic Acid affects the expression of PRKD1 mRNA CTD PMID:25979313 Prkd1 Rat vanadium atom decreases expression ISO PRKD1 (Homo sapiens) 6480464 Vanadium results in decreased expression of PRKD1 mRNA CTD PMID:19000753 Prkd1 Rat vanadium(0) decreases expression ISO PRKD1 (Homo sapiens) 6480464 Vanadium results in decreased expression of PRKD1 mRNA CTD PMID:19000753
Imported Annotations - PID (archival)
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) (R)-noradrenaline (EXP,ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2-methoxyethanol (EXP) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aldrin (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) angiotensin II (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (EXP) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (ISO) bisphenol F (ISO) butanal (ISO) Butylbenzyl phthalate (ISO) cadmium dichloride (ISO) calcitriol (ISO) calcium atom (EXP,ISO) calcium(0) (EXP,ISO) capsaicin (EXP,ISO) chlorpyrifos (EXP) cisplatin (ISO) dapsone (ISO) DDT (EXP) dibutyl phthalate (ISO) dibutylstannane (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) Endothelin-1 (EXP) entinostat (ISO) ethanol (ISO) fenamidone (ISO) fenvalerate (EXP) FR900359 (ISO) gentamycin (EXP) Goe 6976 (ISO) Ingenol 3,20-dibenzoate (ISO) lipopolysaccharide (ISO) lysophosphatidic acid (EXP) malathion (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) methoxyacetic acid (EXP) methoxychlor (EXP) methylmercury chloride (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) noradrenaline (EXP) ozone (ISO) paracetamol (EXP) paraquat (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenylephrine (EXP,ISO) phorbol 13-acetate 12-myristate (EXP,ISO) potassium chromate (ISO) progesterone (ISO) quercetin (ISO) resveratrol (EXP,ISO) SB 431542 (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sunitinib (ISO) testosterone (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) tributylstannane (ISO) urethane (ISO) valproic acid (ISO) vanadium atom (ISO) vanadium(0) (ISO)
Biological Process
angiogenesis (IEA) apoptotic process (IEA) cell differentiation (IEA) cellular response to amino acid starvation (IEA,ISO) cellular response to angiotensin (IDA) cellular response to endothelin (IDA) cellular response to hydroperoxide (IEA,ISO) cellular response to norepinephrine stimulus (IDA) cellular response to oxidative stress (IEA,ISO,ISS) cellular response to phorbol 13-acetate 12-myristate (IDA) cellular response to vascular endothelial growth factor stimulus (IEA,ISO,ISS) defense response to Gram-negative bacterium (IEA,ISO) Golgi organization (IEA,ISO,ISS) Golgi vesicle transport (IEA,ISO,ISS) immune system process (IEA) inflammatory response (IEA) innate immune response (IEA) intracellular signal transduction (IBA,IDA,IEA,ISO) nervous system development (IEA) peptidyl-serine phosphorylation (ISO) peptidyl-threonine phosphorylation (ISO) phospholipase C-activating G protein-coupled receptor signaling pathway (IBA) positive regulation of angiogenesis (IEA,ISO,ISS) positive regulation of autophagy (IEA,ISO) positive regulation of blood vessel endothelial cell migration (IEA,ISO) positive regulation of canonical NF-kappaB signal transduction (IEA,ISO,ISS) positive regulation of cell size (IMP) positive regulation of endothelial cell chemotaxis (IEA,ISO) positive regulation of endothelial cell migration (IEA,ISO,ISS) positive regulation of endothelial cell proliferation (IEA,ISO) positive regulation of gene expression (IMP) positive regulation of neuron projection development (IEA,ISO,ISS) positive regulation of NF-kappaB transcription factor activity (ISO,ISS) positive regulation of NLRP3 inflammasome complex assembly (IEA,ISO,ISS) positive regulation of osteoblast differentiation (IEA,ISO,ISS) positive regulation of peptide hormone secretion (IMP) positive regulation of peptidyl-serine phosphorylation (IMP) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IEA,ISO) positive regulation of protein export from nucleus (IMP) positive regulation of protein import into nucleus (IEA,ISO) positive regulation of sarcomere organization (IMP) positive regulation of transcription by RNA polymerase II (IEA,ISO) protein autophosphorylation (ISO,ISS) regulation of keratinocyte proliferation (IEA,ISO,ISS) regulation of release of sequestered calcium ion into cytosol (IEA,ISO) regulation of skeletal muscle contraction by modulation of calcium ion sensitivity of myofibril (IMP) response to norepinephrine (IDA) vascular endothelial growth factor receptor signaling pathway (IEA,ISO)
Cellular Component
autophagosome membrane (IEA,ISO) cell cortex (IEA,ISO) cell-cell junction (IEA,ISO) cytoplasm (IDA,IEA,ISO) cytosol (IBA,IEA,ISO,ISS) Golgi apparatus (IEA,ISO) membrane (IDA,IEA) nucleus (IDA,IEA,ISO) perinuclear region of cytoplasm (IDA) plasma membrane (IEA,ISO,ISS) trans-Golgi network (IEA,ISO,ISS) Z disc (IDA)
1.
Protein Kinase D1 Regulates Cardiac Hypertrophy, Potassium Channel Remodeling, and Arrhythmias in Heart Failure.
Bossuyt J, etal., J Am Heart Assoc. 2022 Oct 4;11(19):e027573. doi: 10.1161/JAHA.122.027573. Epub 2022 Sep 29.
2.
P2X7 receptors activate protein kinase D and p42/p44 mitogen-activated protein kinase (MAPK) downstream of protein kinase C.
Bradford MD and Soltoff SP, Biochem J 2002 Sep 15;366(Pt 3):745-55.
3.
Protein kinase-D1 overexpression prevents lipid-induced cardiac insulin resistance.
Dirkx E, etal., J Mol Cell Cardiol. 2014 Nov;76:208-17. doi: 10.1016/j.yjmcc.2014.08.017. Epub 2014 Aug 28.
4.
Requirement of protein kinase D1 for pathological cardiac remodeling.
Fielitz J, etal., Proc Natl Acad Sci U S A. 2008 Feb 26;105(8):3059-63. doi: 10.1073/pnas.0712265105. Epub 2008 Feb 14.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Novel function of cardiac protein kinase D1 as a dynamic regulator of Ca2+ sensitivity of contraction.
Goodall MH, etal., J Biol Chem. 2010 Dec 31;285(53):41686-700. doi: 10.1074/jbc.M110.179648. Epub 2010 Nov 1.
7.
Regulation of cardiac stress signaling by protein kinase d1.
Harrison BC, etal., Mol Cell Biol. 2006 May;26(10):3875-88. doi: 10.1128/MCB.26.10.3875-3888.2006.
8.
PKCepsilon-PKD1 signaling complex at Z-discs plays a pivotal role in the cardiac hypertrophy induced by G-protein coupling receptor agonists.
Iwata M, etal., Biochem Biophys Res Commun. 2005 Feb 25;327(4):1105-13. doi: 10.1016/j.bbrc.2004.12.128.
9.
Compatibility of Astragalus and Salvia extract inhibits myocardial fibrosis and ventricular remodeling by regulation of protein kinase D1 protein.
Mao B, etal., Int J Clin Exp Med. 2015 Mar 15;8(3):3716-24. eCollection 2015.
10.
Novel Autosomal Recessive Splice-Altering Variant in PRKD1 Is Associated with Congenital Heart Disease.
Massadeh S, etal., Genes (Basel). 2021 Apr 21;12(5):612. doi: 10.3390/genes12050612.
11.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
12.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
14.
GOA pipeline
RGD automated data pipeline
15.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Distinct genetic architectures for syndromic and nonsyndromic congenital heart defects identified by exome sequencing.
Sifrim A, etal., Nat Genet. 2016 Sep;48(9):1060-5. doi: 10.1038/ng.3627. Epub 2016 Aug 1.
18.
Small heat shock protein 20 (Hsp20) facilitates nuclear import of protein kinase D 1 (PKD1) during cardiac hypertrophy.
Sin YY, etal., Cell Commun Signal. 2015 Mar 7;13:16. doi: 10.1186/s12964-015-0094-x.
19.
The C-terminus of the long AKAP13 isoform (AKAP-Lbc) is critical for development of compensatory cardiac hypertrophy.
Taglieri DM, etal., J Mol Cell Cardiol. 2014 Jan;66:27-40. doi: 10.1016/j.yjmcc.2013.10.010. Epub 2013 Oct 23.
20.
Thrombin rapidly induces protein kinase D phosphorylation, and protein kinase C delta mediates the activation.
Tan M, etal., J Biol Chem 2003 Jan 31;278(5):2824-8.
21.
PLCε, PKD1, and SSH1L transduce RhoA signaling to protect mitochondria from oxidative stress in the heart.
Xiang SY, etal., Sci Signal. 2013 Dec 17;6(306):ra108. doi: 10.1126/scisignal.2004405.
22.
Angiotensin II stimulates protein kinase D-dependent histone deacetylase 5 phosphorylation and nuclear export leading to vascular smooth muscle cell hypertrophy.
Xu X, etal., Arterioscler Thromb Vasc Biol. 2007 Nov;27(11):2355-62. doi: 10.1161/ATVBAHA.107.151704. Epub 2007 Sep 6.
Prkd1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 73,460,640 - 73,774,433 (-) NCBI GRCr8 mRatBN7.2 6 67,725,193 - 68,039,002 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 67,725,905 - 68,039,042 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 68,177,553 - 68,489,871 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 68,484,172 - 68,796,501 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 67,919,348 - 68,237,248 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 71,035,017 - 71,349,531 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 71,035,332 - 71,349,249 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 80,600,725 - 80,914,319 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 70,364,135 - 70,682,006 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 70,393,721 - 70,394,895 (-) NCBI Celera 6 66,643,414 - 66,954,727 (-) NCBI Celera Cytogenetic Map 6 q22 NCBI
PRKD1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 29,576,479 - 29,927,847 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 29,576,479 - 30,191,898 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 30,045,685 - 30,397,053 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 29,115,436 - 29,466,650 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 29,115,439 - 29,466,652 NCBI Celera 14 9,911,927 - 10,263,081 (-) NCBI Celera Cytogenetic Map 14 q12 NCBI HuRef 14 10,161,470 - 10,512,671 (-) NCBI HuRef CHM1_1 14 30,044,967 - 30,396,713 (-) NCBI CHM1_1 T2T-CHM13v2.0 14 23,774,515 - 24,125,722 (-) NCBI T2T-CHM13v2.0
Prkd1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 50,388,009 - 50,696,075 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 50,388,014 - 50,695,881 (-) Ensembl GRCm39 Ensembl GRCm38 12 50,341,226 - 50,649,271 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 50,341,231 - 50,649,098 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 51,442,218 - 51,750,210 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 51,217,854 - 51,571,105 (-) NCBI MGSCv36 mm8 Celera 12 51,654,217 - 51,955,593 (-) NCBI Celera Cytogenetic Map 12 B3 NCBI cM Map 12 21.78 NCBI
Prkd1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955409 30,554,013 - 30,860,649 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955409 30,554,095 - 30,860,588 (+) NCBI ChiLan1.0 ChiLan1.0
PRKD1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 30,905,194 - 31,258,408 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 30,122,170 - 30,474,871 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 10,353,284 - 10,707,841 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 28,499,753 - 28,650,036 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 28,496,282 - 28,650,030 (-) Ensembl panpan1.1 panPan2
PRKD1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 9,004,641 - 9,327,054 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 9,005,115 - 9,328,358 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 8,933,899 - 9,256,073 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 9,106,948 - 9,429,506 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 9,107,422 - 9,430,511 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 8,787,713 - 9,109,715 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 8,868,816 - 9,191,637 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 9,140,306 - 9,462,703 (-) NCBI UU_Cfam_GSD_1.0
Prkd1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 40,963,196 - 41,207,484 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936494 4,469,089 - 4,601,214 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936494 4,469,092 - 4,601,183 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRKD1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 69,527,811 - 69,872,863 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 69,527,743 - 69,872,374 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 74,585,433 - 74,730,165 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
Prkd1
.
Assembly: mRatBN7.2
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
6
67777941
67777942
C
A
snv
European Variation Archive Release 3 , WKY/NCrl (2019NG), European Variation Archive Release 6, ACI/EurMcwi (2019), ACI/N (2020), BUF/N (2020), DA/OlaHsd (2019), LH/MavRrrcAek (2020), LL/MavRrrcAek (2020), LN/MavRrrcAek (2020), M520/NRrrcMcwi (2019), M520/N (2020), MWF/Hsd (2019), PVG/Seac (2019), SR/JrHsd (2020), SS/JrHsdMcwi (2019), WKY/NCrl (2019), WKY/N (2020), WN/N (2020), ACI/EurMcwi (2019NG), BDIX/NemOdaMcwi (2022), BUF/MnaMcwi (2022), DA/OlaHsd (2019NG), M520/NRrrcMcwi (2019NG), MWF/SimwMcwi (2019NG), MWF/SimwMcwi (2019), SHR/NHsd (2021), SS/HsdMcwiCrl (2021), SS/JrHsdMcwi (2019NG), SS/JrHsd (2021), European Variation Archive Release 4 View more Information
Assembly: Rnor_5.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
6
80652945
80652946
C
A
snv
ACI/EurMcwi (MCW) , KFRS3B/Kyo (KyushuU), SR/JrHsd (MCW), SS/JrHsdMcwi (MCW), WN/N (KNAW), LH/MavRrrc (KNAW), LL/MavRrrc (KNAW), LN/MavRrrc (KNAW), MHS/Gib (KNAW), SR/JrHsd (KNAW), SS/Jr (KNAW), SS/JrHsdMcwi (KNAW), ACI/N (KNAW), ACI/EurMcwi (KNAW), BUF/N (KNAW), DA/BklArbNsi (KNAW), M520/N (KNAW), WKY/Gcrc (KNAW), WKY/N (KNAW), WKY/NCrl (KNAW), WKY/NHsd (KNAW), BUF/MNa (KyushuU), HWY/Slc (KyushuU), BDIX/NemOda (KyushuU), BDIX.Cg-Tal/NemOda (KyushuU), COP/CrCrl (MCW & UW) View more Information
Assembly: Rnor_6.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
6
71087728
71087729
C
A
snv
European Variation Archive Release 3 , WN/N (2020), European Variation Archive Release 6, ACI/EurMcwi (MCW), COP/CrCrl (MCW & UW), SR/JrHsd (MCW), SS/JrHsdMcwi (MCW), ACI/N (MCW), Buf/N (MCW), M520/N (MCW), WKY/N (MCW), WN/N (MCW), ACI/EurMcwi (RGD), LH/MavRrrc (RGD), LN/MavRrrc (RGD), LL/MavRrrc (RGD), MHS/Gib (RGD), SR/JrHsd (RGD), SS/JrHsdMcwi (RGD), WKY/NCrl (RGD), WKY/Gcrc (RGD), WKY/NHsd (RGD), ACI/EurMcwi (2019), ACI/N (2020), BUF/N (2020), DA/OlaHsd (2019), LH/MavRrrcAek (2020), LL/MavRrrcAek (2020), LN/MavRrrcAek (2020), M520/NRrrcMcwi (2019), M520/N (2020), MWF/Hsd (2019), PVG/Seac (2019), SR/JrHsd (2020), SS/JrHsdMcwi (2019), WKY/NCrl (2019), WKY/N (2020), European Variation Archive Release 4 View more Information
Predicted Target Of
Count of predictions: 22 Count of miRNA genes: 21 Interacting mature miRNAs: 22 Transcripts: ENSRNOT00000068077 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
9590290 Uminl2 Urine mineral level QTL 2 3.96 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 6 38783989 83783989 Rat 2293088 Iddm28 Insulin dependent diabetes mellitus QTL 28 5.21 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 6 63040562 71636266 Rat 634307 Bp141 Blood pressure QTL 141 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 35230417 80230417 Rat 634330 Pia16 Pristane induced arthritis QTL 16 3.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 6 45790088 104200226 Rat 1331779 Rf38 Renal function QTL 38 2.876 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 32074428 72227641 Rat 1354632 Scl29 Serum cholesterol level QTL 29 3.74 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 6 35098709 71636405 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 70176 Mcsm1 Mammary carcinoma susceptibility modifier QTL 1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 58632962 103632962 Rat 1558641 Cm47 Cardiac mass QTL 47 2.9 0.001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 6 57730540 104085867 Rat 1641904 Alcrsp4 Alcohol response QTL 4 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 6 67262953 112262953 Rat 2293839 Kiddil2 Kidney dilation QTL 2 4.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 9590140 Scort4 Serum corticosterone level QTL 4 14.49 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 38783989 83783989 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 9590306 Scort18 Serum corticosterone level QTL 18 2.88 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 38783989 83783989 Rat 1578665 Bss16 Bone structure and strength QTL 16 4.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 6 11735669 72593685 Rat 2293841 Kiddil4 Kidney dilation QTL 4 4.4 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 4889848 Pur25 Proteinuria QTL 25 14 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 56728562 90198260 Rat 1578668 Bmd14 Bone mineral density QTL 14 3.8 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 6 11735669 72593685 Rat 6893340 Cm77 Cardiac mass QTL 77 0.26 0.57 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 33309549 81132889 Rat 2301972 Bp325 Blood pressure QTL 325 4.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 1 72227641 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 1354664 Slep2 Serum leptin concentration QTL 2 4.49 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 6 16536140 71636405 Rat 1300143 Rf14 Renal function QTL 14 2.92 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 34434137 77102317 Rat 12801471 Schws9 Schwannoma susceptibility QTL 9 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 61747639 106747639 Rat 6893332 Cm74 Cardiac mass QTL 74 0.4 0.64 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 57730540 104085867 Rat
D6Got79
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 68,030,865 - 68,031,133 (+) MAPPER mRatBN7.2 mRatBN7.2 6 68,030,865 - 68,031,246 (+) MAPPER mRatBN7.2 Rnor_6.0 6 71,341,109 - 71,341,685 NCBI Rnor6.0 Rnor_6.0 6 71,341,109 - 71,341,376 NCBI Rnor6.0 Rnor_5.0 6 80,905,903 - 80,906,479 UniSTS Rnor5.0 Rnor_5.0 6 80,905,903 - 80,906,170 UniSTS Rnor5.0 RGSC_v3.4 6 70,674,174 - 70,674,442 RGD RGSC3.4 RGSC_v3.4 6 70,674,175 - 70,674,442 UniSTS RGSC3.4 RGSC_v3.1 6 70,677,301 - 70,677,568 RGD RH 3.4 Map 6 491.4 RGD RH 3.4 Map 6 491.4 UniSTS RH 2.0 Map 6 664.5 RGD Cytogenetic Map 6 q22 UniSTS
Prkcm
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 67,725,799 - 67,726,005 (+) MAPPER mRatBN7.2 Rnor_6.0 6 71,035,620 - 71,035,825 NCBI Rnor6.0 Rnor_5.0 6 80,600,837 - 80,601,042 UniSTS Rnor5.0 RGSC_v3.4 6 70,363,966 - 70,364,171 UniSTS RGSC3.4 Celera 6 66,643,245 - 66,643,450 UniSTS Cytogenetic Map 6 q22 UniSTS
BQ209938
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 67,728,118 - 67,728,268 (+) MAPPER mRatBN7.2 Rnor_6.0 6 71,037,939 - 71,038,088 NCBI Rnor6.0 Rnor_5.0 6 80,603,156 - 80,603,305 UniSTS Rnor5.0 RGSC_v3.4 6 70,366,285 - 70,366,434 UniSTS RGSC3.4 Celera 6 66,645,564 - 66,645,713 UniSTS RH 3.4 Map 6 489.3 UniSTS Cytogenetic Map 6 q22 UniSTS
UniSTS:224841
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 67,725,747 - 67,725,901 (+) MAPPER mRatBN7.2 Rnor_6.0 6 71,035,568 - 71,035,721 NCBI Rnor6.0 Rnor_5.0 6 80,600,785 - 80,600,938 UniSTS Rnor5.0 RGSC_v3.4 6 70,363,914 - 70,364,067 UniSTS RGSC3.4 Celera 6 66,643,193 - 66,643,346 UniSTS Cytogenetic Map 6 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000068077 ⟹ ENSRNOP00000063159
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 67,725,905 - 68,039,042 (-) Ensembl Rnor_6.0 Ensembl 6 71,035,789 - 71,349,249 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000081883 ⟹ ENSRNOP00000074836
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 67,725,905 - 67,889,169 (-) Ensembl Rnor_6.0 Ensembl 6 71,035,332 - 71,199,110 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100654 ⟹ ENSRNOP00000089750
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 67,725,905 - 68,039,042 (-) Ensembl
RefSeq Acc Id:
NM_001276715 ⟹ NP_001263644
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 73,460,640 - 73,774,406 (-) NCBI mRatBN7.2 6 67,725,197 - 68,038,978 (-) NCBI Rnor_6.0 6 71,035,789 - 71,349,249 (-) NCBI Rnor_5.0 6 80,600,725 - 80,914,319 (-) NCBI Celera 6 66,643,414 - 66,954,727 (-) NCBI
Sequence:
ATGAGCGCCCCTCCGCTACTACGGCCGCCTAGCCCGCTGCTGCCCGCCGCGGCCGCTGTGGCCGCCGCCGCTGCTGCGCTGGTCCCGGGCTCCGGGCCCGCGCCCTTCCCAGCGCCTGGGGCCGCCCC
hide sequence
RefSeq Acc Id:
NM_001412095 ⟹ NP_001399024
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 73,460,640 - 73,774,406 (-) NCBI mRatBN7.2 6 67,725,197 - 68,038,978 (-) NCBI
RefSeq Acc Id:
XM_039113014 ⟹ XP_038968942
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 73,461,119 - 73,774,432 (-) NCBI mRatBN7.2 6 67,725,193 - 68,039,000 (-) NCBI
RefSeq Acc Id:
XM_039113015 ⟹ XP_038968943
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 73,461,119 - 73,774,432 (-) NCBI mRatBN7.2 6 67,725,193 - 68,039,000 (-) NCBI
RefSeq Acc Id:
XM_039113017 ⟹ XP_038968945
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 73,461,119 - 73,629,382 (-) NCBI mRatBN7.2 6 67,725,193 - 67,893,935 (-) NCBI
RefSeq Acc Id:
XM_039113018 ⟹ XP_038968946
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 73,461,119 - 73,629,412 (-) NCBI mRatBN7.2 6 67,725,193 - 67,893,977 (-) NCBI
RefSeq Acc Id:
XM_039113019 ⟹ XP_038968947
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 73,461,119 - 73,642,466 (-) NCBI mRatBN7.2 6 67,725,193 - 67,907,036 (-) NCBI
RefSeq Acc Id:
XM_039113020 ⟹ XP_038968948
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 73,461,119 - 73,532,579 (-) NCBI mRatBN7.2 6 67,725,193 - 67,797,125 (-) NCBI
RefSeq Acc Id:
XM_039113021 ⟹ XP_038968949
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 73,461,119 - 73,532,579 (-) NCBI mRatBN7.2 6 67,725,193 - 67,797,124 (-) NCBI
RefSeq Acc Id:
XM_039113022 ⟹ XP_038968950
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 73,461,119 - 73,530,232 (-) NCBI mRatBN7.2 6 67,725,193 - 67,794,811 (-) NCBI
RefSeq Acc Id:
XM_063262561 ⟹ XP_063118631
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 73,470,282 - 73,774,433 (-) NCBI
RefSeq Acc Id:
XM_063262562 ⟹ XP_063118632
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 73,461,119 - 73,629,412 (-) NCBI
RefSeq Acc Id:
XM_063262563 ⟹ XP_063118633
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 73,461,119 - 73,532,579 (-) NCBI
RefSeq Acc Id:
XM_063262564 ⟹ XP_063118634
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 73,461,119 - 73,532,579 (-) NCBI
RefSeq Acc Id:
XR_005505595
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 73,487,336 - 73,774,433 (-) NCBI mRatBN7.2 6 67,751,895 - 68,039,002 (-) NCBI
RefSeq Acc Id:
NP_001263644 ⟸ NM_001276715
- Peptide Label:
isoform 1
- UniProtKB:
Q9WTQ1 (UniProtKB/Swiss-Prot), A6HBG5 (UniProtKB/TrEMBL)
- Sequence:
MSAPPLLRPPSPLLPAAAAVAAAAAALVPGSGPAPFPAPGAAPAGGISFHLQIGLSREPVLLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGLYDKILLFRHDPASENILQLVKIASDIQEGDLIE
hide sequence
Ensembl Acc Id:
ENSRNOP00000074836 ⟸ ENSRNOT00000081883
Ensembl Acc Id:
ENSRNOP00000063159 ⟸ ENSRNOT00000068077
RefSeq Acc Id:
XP_038968943 ⟸ XM_039113015
- Peptide Label:
isoform X2
- UniProtKB:
A6HBG5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038968942 ⟸ XM_039113014
- Peptide Label:
isoform X1
- UniProtKB:
A6HBG5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038968947 ⟸ XM_039113019
- Peptide Label:
isoform X4
- UniProtKB:
A6HBG5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038968946 ⟸ XM_039113018
- Peptide Label:
isoform X4
- UniProtKB:
A6HBG5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038968945 ⟸ XM_039113017
- Peptide Label:
isoform X4
- UniProtKB:
A6HBG5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038968948 ⟸ XM_039113020
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_038968949 ⟸ XM_039113021
- Peptide Label:
isoform X8
RefSeq Acc Id:
XP_038968950 ⟸ XM_039113022
- Peptide Label:
isoform X8
Ensembl Acc Id:
ENSRNOP00000089750 ⟸ ENSRNOT00000100654
RefSeq Acc Id:
NP_001399024 ⟸ NM_001412095
- Peptide Label:
isoform 2
- UniProtKB:
A0A8I6A9E1 (UniProtKB/TrEMBL), A6HBG5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063118632 ⟸ XM_063262562
- Peptide Label:
isoform X5
- UniProtKB:
A0A0G2K928 (UniProtKB/TrEMBL), A6HBG5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063118633 ⟸ XM_063262563
- Peptide Label:
isoform X7
RefSeq Acc Id:
XP_063118634 ⟸ XM_063262564
- Peptide Label:
isoform X8
RefSeq Acc Id:
XP_063118631 ⟸ XM_063262561
- Peptide Label:
isoform X3
- UniProtKB:
A6HBG5 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-17
Prkd1
protein kinase D1
Prkcm
protein kinase C, mu
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Prkcm
protein kinase C, mu
Pkcm
Symbol updated
1299863 APPROVED
2002-08-07
Pkcm
protein kinase C, mu
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_cellular_localization
localized to Golgi apparatus and cytosol
724658
gene_regulation
activation mediated by P2X7 receptors
724658
