Symbol:
Prkci
Name:
protein kinase C, iota
RGD ID:
620961
Description:
Predicted to enable diacylglycerol-dependent, calcium-independent serine/threonine kinase activity and phospholipid binding activity. Involved in several processes, including Golgi vesicle budding; cellular response to insulin stimulus; and response to interleukin-1. Located in bicellular tight junction and cell leading edge. Is active in Schaffer collateral - CA1 synapse and glutamatergic synapse. Orthologous to human PRKCI (protein kinase C iota); PARTICIPATES IN insulin responsive facilitative sugar transporter mediated glucose transport pathway; insulin signaling pathway; interleukin-1 signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrobenzenesulfonic acid.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
aPKC-lambda/iota; atypical protein kinase C-lambda/iota; nPKC-iota; Pkcl; protein kinase C iota type; protein kinase C, lambda
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRKCI (protein kinase C iota) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Prkci (protein kinase C, iota) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Prkci (protein kinase C iota) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRKCI (protein kinase C iota) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRKCI (protein kinase C iota) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prkci (protein kinase C iota) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRKCI (protein kinase C iota) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PRKCI (protein kinase C iota) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prkci (protein kinase C iota) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PRKCZ (protein kinase C zeta) HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
PRKCI (protein kinase C iota)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Prkci (protein kinase C, iota)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prkci (protein kinase C, iota)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PKC1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
aPKC
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pkc-3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
prkci
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 114,250,398 - 114,310,784 (-) NCBI GRCr8 mRatBN7.2 2 112,321,919 - 112,382,305 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 112,321,929 - 112,382,352 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 118,969,610 - 119,036,697 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 117,082,171 - 117,149,259 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 111,791,942 - 111,852,081 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 115,941,998 - 116,002,550 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 115,941,993 - 116,002,561 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 135,636,956 - 135,697,732 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 116,739,625 - 116,801,084 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 116,686,636 - 116,699,453 (-) NCBI Celera 2 107,508,914 - 107,569,241 (-) NCBI Celera Cytogenetic Map 2 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
Biological Process
actin filament organization (IEA,ISO) cell migration (IMP) cell-cell junction organization (IEA,ISO) cellular response to insulin stimulus (IBA,IEA,IMP,ISO) establishment of apical/basal cell polarity (IEA,ISO) establishment of cell polarity (IBA) establishment or maintenance of epithelial cell apical/basal polarity (IEA,ISO) eye photoreceptor cell development (IEA,ISO) Golgi vesicle budding (IDA) intracellular signal transduction (IBA) negative regulation of glial cell apoptotic process (IEA,ISO,ISS) negative regulation of neuron apoptotic process (IEA,ISO,ISS) positive regulation of D-glucose import (IEA,ISO) positive regulation of endothelial cell apoptotic process (IEA,ISO,ISS) positive regulation of glial cell proliferation (IEA,ISO,ISS) positive regulation of neuron projection development (IEA,ISO,ISS) positive regulation of NF-kappaB transcription factor activity (ISO,ISS) positive regulation of protein localization to plasma membrane (IEA,ISO) protein localization to plasma membrane (IBA) protein phosphorylation (ISO) regulation of postsynaptic membrane neurotransmitter receptor levels (EXP,IDA,IEP,IMP) response to interleukin-1 (IMP) response to peptide hormone (IDA)
Cellular Component
apical part of cell (IEA,ISO) apical plasma membrane (IEA,ISO) bicellular tight junction (IDA) brush border (IEA,ISO) cell leading edge (IDA) cilium (IEA,ISO) cytoplasm (IEA,ISO) cytosol (IEA,ISO,ISS) endosome (IEA) glutamatergic synapse (EXP,IDA,IEP,IMP) Golgi membrane (IEA) intercellular bridge (IEA,ISO) intracellular membrane-bounded organelle (IEA,ISO) membrane (IEA) microtubule cytoskeleton (IEA,ISO) nucleus (IEA,ISO,ISS) PAR polarity complex (IEA,ISO) Schaffer collateral - CA1 synapse (EXP,IDA,IEP,IMP) Schmidt-Lanterman incisure (IEA,ISO)
1.
Protein kinase C translocation and PKC-dependent protein phosphorylation during myocardial ischemia.
Albert CJ and Ford DA, Am J Physiol. 1999 Feb;276(2 Pt 2):H642-50.
2.
Skin immunosenescence: decreased receptor for activated C kinase-1 expression correlates with defective tumour necrosis factor-alpha production in epidermal cells.
Corsini E, etal., Br J Dermatol. 2009 Jan;160(1):16-25. Epub 2008 Oct 11.
3.
Corticotropin-releasing hormone activates protein kinase C in an isoenzyme-specific manner.
Dermitzaki E, etal., Biochem Biophys Res Commun. 2005 Feb 18;327(3):828-36.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
An atypical PKC directly associates and colocalizes at the epithelial tight junction with ASIP, a mammalian homologue of Caenorhabditis elegans polarity protein PAR-3.
Izumi Y, etal., J Cell Biol 1998 Oct 5;143(1):95-106.
7.
Fatty acid infusion selectively impairs insulin action on Akt1 and protein kinase C lambda /zeta but not on glycogen synthase kinase-3.
Kim YB, etal., J Biol Chem 2002 Sep 6;277(36):32915-22.
8.
The overexpression and altered localization of the atypical protein kinase C lambda/iota in breast cancer correlates with the pathologic type of these tumors.
Kojima Y, etal., Hum Pathol. 2008 Jun;39(6):824-31.
9.
PKClambda in liver mediates insulin-induced SREBP-1c expression and determines both hepatic lipid content and overall insulin sensitivity.
Matsumoto M, etal., J Clin Invest. 2003 Sep;112(6):935-44.
10.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
11.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.
Protein kinase C: poised to signal.
Newton AC Am J Physiol Endocrinol Metab. 2010 Mar;298(3):E395-402. Epub 2009 Nov 24.
13.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
14.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
15.
PKC¿ is critical in AMPA receptor phosphorylation and synaptic incorporation during LTP.
Ren SQ, etal., EMBO J. 2013 May 15;32(10):1365-80. doi: 10.1038/emboj.2013.60. Epub 2013 Mar 19.
16.
GOA pipeline
RGD automated data pipeline
17.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
18.
Comprehensive gene review and curation
RGD comprehensive gene curation
19.
An aPKC-exocyst complex controls paxillin phosphorylation and migration through localised JNK1 activation.
Rosse C, etal., PLoS Biol. 2009 Nov;7(11):e1000235. Epub 2009 Nov 3.
20.
Differential contributions of protein kinase C isoforms in the regulation of group IIA secreted phospholipase A(2) expression in cytokine-stimulated rat fibroblasts.
Sugita M, etal., Biochim Biophys Acta. 2010 Jan;1801(1):70-6. Epub 2009 Sep 24.
21.
The PAR-aPKC system: lessons in polarity.
Suzuki A and Ohno S, J Cell Sci. 2006 Mar 15;119(Pt 6):979-87.
22.
Atypical protein kinase C plays a critical role in protein transport from pre-Golgi intermediates.
Tisdale EJ, etal., J Biol Chem 2003 Sep 26;278(39):38015-21.
23.
Protein kinase C modulation of the regulation of sarcoplasmic reticular function by protein kinase A-mediated phospholamban phosphorylation in diabetic rats.
Watanuki S, etal., Br J Pharmacol. 2004 Jan;141(2):347-59. Epub 2003 Dec 22.
24.
Protein kinase C isoform expression in ovarian carcinoma correlates with indicators of poor prognosis.
Weichert W, etal., Int J Oncol. 2003 Sep;23(3):633-9.
Prkci Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 114,250,398 - 114,310,784 (-) NCBI GRCr8 mRatBN7.2 2 112,321,919 - 112,382,305 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 112,321,929 - 112,382,352 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 118,969,610 - 119,036,697 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 117,082,171 - 117,149,259 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 111,791,942 - 111,852,081 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 115,941,998 - 116,002,550 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 115,941,993 - 116,002,561 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 135,636,956 - 135,697,732 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 116,739,625 - 116,801,084 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 116,686,636 - 116,699,453 (-) NCBI Celera 2 107,508,914 - 107,569,241 (-) NCBI Celera Cytogenetic Map 2 q24 NCBI
PRKCI Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 170,222,424 - 170,305,977 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 170,222,424 - 170,305,977 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 169,940,212 - 170,023,765 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 171,422,914 - 171,506,464 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 171,422,926 - 171,506,466 NCBI Celera 3 168,339,909 - 168,423,454 (+) NCBI Celera Cytogenetic Map 3 q26.2 NCBI HuRef 3 167,310,436 - 167,393,660 (+) NCBI HuRef CHM1_1 3 169,903,696 - 169,987,264 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 173,007,078 - 173,090,623 (+) NCBI T2T-CHM13v2.0
Prkci Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 31,049,893 - 31,106,889 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 31,049,896 - 31,107,108 (+) Ensembl GRCm39 Ensembl GRCm38 3 30,995,742 - 31,052,740 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 30,995,747 - 31,052,959 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 30,894,693 - 30,951,662 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 31,186,790 - 31,243,616 (+) NCBI MGSCv36 mm8 Celera 3 30,907,826 - 30,963,884 (+) NCBI Celera Cytogenetic Map 3 A3 NCBI cM Map 3 14.65 NCBI
Prkci Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955420 423,140 - 489,592 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955420 423,406 - 486,676 (+) NCBI ChiLan1.0 ChiLan1.0
PRKCI Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 168,117,174 - 168,201,113 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 168,122,382 - 168,205,837 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 167,237,093 - 167,320,522 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 175,426,774 - 175,510,072 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 175,426,774 - 175,510,072 (+) Ensembl panpan1.1 panPan2
PRKCI Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 34 34,767,066 - 34,839,823 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 34 34,766,801 - 34,837,605 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 34 43,779,787 - 43,851,893 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 34 34,847,084 - 34,921,270 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 34 34,846,775 - 34,923,810 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 34 34,792,870 - 34,864,800 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 34 34,760,842 - 34,834,497 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 34 35,025,008 - 35,098,029 (+) NCBI UU_Cfam_GSD_1.0
Prkci Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 101,385,061 - 101,451,426 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936593 2,170,808 - 2,236,673 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936593 2,170,539 - 2,236,904 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRKCI Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 108,913,173 - 108,997,931 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 108,913,018 - 108,997,934 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 117,694,977 - 117,742,789 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRKCI
Prkci
.
Predicted Target Of
Count of predictions: 380 Count of miRNA genes: 203 Interacting mature miRNAs: 261 Transcripts: ENSRNOT00000012924 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
2293671 Bss44 Bone structure and strength QTL 44 10.97 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 2 43162366 148478373 Rat 631566 Bp90 Blood pressure QTL 90 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 102803808 147803808 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1598865 Bp296 Blood pressure QTL 296 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 81018907 126018907 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1578772 Stresp14 Stress response QTL 14 5 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 2 82345893 130923501 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 152025242 Bw191 Body weight QTL 191 3.62 body mass (VT:0001259) 2 38573329 122609194 Rat 1598862 Glom9 Glomerulus QTL 9 3.5 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 2 92337601 137337601 Rat 631198 Cm22 Cardiac mass QTL 22 4.3 0.0008 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 76539322 150540526 Rat 1598863 Cm65 Cardiac mass QTL 65 2.3 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 92337601 137337601 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 2300165 Bmd49 Bone mineral density QTL 49 4.8 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 2 88862519 133862519 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 2300170 Bmd45 Bone mineral density QTL 45 12.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 2 88862519 133862519 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 7411551 Bw131 Body weight QTL 131 29.6 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 2 67942638 112942638 Rat 8662836 Vetf8 Vascular elastic tissue fragility QTL 8 0.66 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 104559726 149559726 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 2299162 Iddm32 Insulin dependent diabetes mellitus QTL 32 2.36 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 78665616 143657569 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 2300185 Bmd46 Bone mineral density QTL 46 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 88862519 133862519 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 61392 Bp6 Blood pressure QTL 6 7 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 2 80270434 125270434 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 2293835 Kiddil5 Kidney dilation QTL 5 3.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 157142209 Rat 1581552 Pur12 Proteinuria QTL 12 5.19 0.0009 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 2 112103657 148076632 Rat 1558653 Prcr1 Prostate cancer resistance QTL 1 5 prostate integrity trait (VT:0010571) area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899) 2 72532993 157142209 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 7207808 Bmd89 Bone mineral density QTL 89 4.1 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 2 88862519 133862519 Rat 1558648 Smcn1 Smooth muscle cell number QTL 1 0.039 blood vessel smooth muscle cell quantity (VT:0010525) aorta smooth muscle cell count per unit vessel length (CMO:0001646) 2 59134147 127460910 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 61438 Cia7 Collagen induced arthritis QTL 7 4.6 0.0001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 2 59324377 141596857 Rat 1354603 Bp243 Blood pressure QTL 243 3.9 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 127469484 Rat
RH143812
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 112,322,042 - 112,322,150 (+) MAPPER mRatBN7.2 Rnor_6.0 2 115,942,122 - 115,942,229 NCBI Rnor6.0 Rnor_5.0 2 135,637,080 - 135,637,187 UniSTS Rnor5.0 RGSC_v3.4 2 116,739,749 - 116,739,856 UniSTS RGSC3.4 Celera 2 107,509,038 - 107,509,145 UniSTS RH 3.4 Map 2 719.4 UniSTS Cytogenetic Map 2 q24 UniSTS
AI406627
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 112,322,077 - 112,322,223 (+) MAPPER mRatBN7.2 Rnor_6.0 2 115,942,157 - 115,942,302 NCBI Rnor6.0 Rnor_5.0 2 135,637,115 - 135,637,260 UniSTS Rnor5.0 RGSC_v3.4 2 116,739,784 - 116,739,929 UniSTS RGSC3.4 Celera 2 107,509,073 - 107,509,218 UniSTS RH 3.4 Map 2 721.5 UniSTS Cytogenetic Map 2 q24 UniSTS
AI007955
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 112,377,692 - 112,377,852 (+) MAPPER mRatBN7.2 Rnor_6.0 2 115,997,940 - 115,998,099 NCBI Rnor6.0 Rnor_5.0 2 135,693,122 - 135,693,281 UniSTS Rnor5.0 RGSC_v3.4 2 116,796,473 - 116,796,632 UniSTS RGSC3.4 Celera 2 107,564,634 - 107,564,793 UniSTS RH 3.4 Map 2 722.3 UniSTS Cytogenetic Map 2 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012924 ⟹ ENSRNOP00000012924
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 112,321,929 - 112,382,352 (-) Ensembl Rnor_6.0 Ensembl 2 115,941,993 - 116,002,561 (-) Ensembl
RefSeq Acc Id:
NM_032059 ⟹ NP_114448
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 114,250,398 - 114,310,784 (-) NCBI mRatBN7.2 2 112,321,919 - 112,382,305 (-) NCBI Rnor_6.0 2 115,941,998 - 116,002,550 (-) NCBI Rnor_5.0 2 135,636,956 - 135,697,732 (-) NCBI RGSC_v3.4 2 116,739,625 - 116,801,084 (-) RGD Celera 2 107,508,914 - 107,569,241 (-) RGD
Sequence:
TCGCTCTGGCGGGTTAGGCGTGTTGGTCCGGGAGGCGGGCGGCCACGGCTTCCCGACAGGCTCGGGAGGCCGAGACCCTCGCGGCGCCCGGCGCTGCCCGGATCCCCTCAGCCTCCAGCGGAGAGGCG
hide sequence
RefSeq Acc Id:
NP_114448 ⟸ NM_032059
- UniProtKB:
B1PZT8 (UniProtKB/Swiss-Prot), F1M7Y5 (UniProtKB/Swiss-Prot)
- Sequence:
MPTQRDSSTMSHTVACGGGGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCSEVRDMCSFDNEQPFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGEDKSIYRRG
hide sequence
Ensembl Acc Id:
ENSRNOP00000012924 ⟸ ENSRNOT00000012924
RGD ID: 13691273 Promoter ID: EPDNEW_R1798 Type: initiation region Name: Prkci_1 Description: protein kinase C, iota SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 116,002,588 - 116,002,648 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Prkci
protein kinase C, iota
Pkcl
protein kinase C, lambda
Symbol and Name updated
1299863 APPROVED
2002-08-07
Pkcl
protein kinase C, lambda
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_process
mediates protein transport in the early secretory pathway
724652
gene_regulation
activated by phosphatidylinositol 3,4,5-triphosphate and phosphatidic acid
724652
