Symbol:
Ltc4s
Name:
leukotriene C4 synthase
RGD ID:
620677
Description:
Enables glutathione binding activity and leukotriene-C4 synthase activity. Involved in several processes, including cellular response to lipopolysaccharide; cellular response to vitamin A; and leukotriene biosynthetic process. Predicted to be located in endoplasmic reticulum membrane and nuclear outer membrane. Predicted to be active in endoplasmic reticulum and nuclear envelope. Biomarker of glomerulonephritis and peripheral nervous system disease. Orthologous to human LTC4S (leukotriene C4 synthase); PARTICIPATES IN acetylsalicylic acid pharmacodynamics pathway; antipyrine drug pathway; arachidonic acid metabolic pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 7,12-dimethyltetraphene; acetamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
glutathione S-transferase LTC4; leukotriene-C(4) synthase; LTC4 synthase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Candidate Gene For:
Bmd4
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 35,060,002 - 35,066,466 (-) NCBI GRCr8 mRatBN7.2 10 34,560,476 - 34,562,790 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 34,560,360 - 34,562,651 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 39,235,902 - 39,237,857 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 7,775,154 - 7,777,109 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 34,229,574 - 34,231,529 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 35,736,486 - 35,743,088 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 35,737,664 - 35,739,625 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 35,498,195 - 35,506,088 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 35,786,877 - 35,788,838 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 35,787,925 - 35,789,881 (-) NCBI Celera 10 33,909,805 - 33,911,766 (-) NCBI Celera Cytogenetic Map 10 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ltc4s Rat 17beta-estradiol multiple interactions ISO LTC4S (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of LTC4S mRNA CTD PMID:30165855 Ltc4s Rat 17beta-estradiol decreases expression ISO LTC4S (Homo sapiens) 6480464 Estradiol results in decreased expression of LTC4S mRNA CTD PMID:31614463 Ltc4s Rat 17beta-estradiol decreases expression ISO Ltc4s (Mus musculus) 6480464 Estradiol results in decreased expression of LTC4S mRNA CTD PMID:39298647 Ltc4s Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR mRNA promotes the reaction [Tetrachlorodibenzodioxin results in decreased expression of LTC4S mRNA] and AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of LTC4S mRNA] CTD PMID:21215274 and PMID:28487374 Ltc4s Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ltc4s (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of LTC4S mRNA CTD PMID:21570461 Ltc4s Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of LTC4S mRNA and Tetrachlorodibenzodioxin results in decreased expression of LTC4S protein CTD PMID:21215274 more ... Ltc4s Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Ltc4s (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Ltc4s Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Ltc4s (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of LTC4S mRNA CTD PMID:25172293 Ltc4s Rat 3,4-methylenedioxymethamphetamine increases expression ISO Ltc4s (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of LTC4S mRNA CTD PMID:26251327 Ltc4s Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:19480007 Ltc4s Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of LTC4S mRNA CTD PMID:31881176 Ltc4s Rat acetohydrazide decreases expression ISO Ltc4s (Mus musculus) 6480464 acetylhydrazine results in decreased expression of LTC4S mRNA CTD PMID:15282401 Ltc4s Rat acetylsalicylic acid affects response to substance ISO LTC4S (Homo sapiens) 6480464 LTC4S affects the susceptibility to Aspirin more ... CTD PMID:15100686 more ... Ltc4s Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of LTC4S mRNA CTD PMID:28959563 Ltc4s Rat acrylamide decreases expression ISO Ltc4s (Mus musculus) 6480464 Acrylamide results in decreased expression of LTC4S mRNA CTD PMID:35032568 Ltc4s Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of LTC4S mRNA CTD PMID:25378103 Ltc4s Rat Aflatoxin B2 alpha decreases methylation ISO LTC4S (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of LTC4S intron CTD PMID:30157460 Ltc4s Rat aldehydo-D-glucose multiple interactions ISO Ltc4s (Mus musculus) 6480464 fucoxanthin inhibits the reaction [Glucose results in increased expression of LTC4S mRNA] CTD PMID:33448797 Ltc4s Rat aldehydo-D-glucose increases expression ISO Ltc4s (Mus musculus) 6480464 Glucose results in increased expression of LTC4S mRNA CTD PMID:33448797 Ltc4s Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of LTC4S mRNA CTD PMID:16483693 Ltc4s Rat arsenous acid increases expression ISO LTC4S (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of LTC4S mRNA CTD PMID:15761015 Ltc4s Rat arsenous acid decreases expression ISO LTC4S (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of LTC4S mRNA CTD PMID:20458559 Ltc4s Rat benzo[a]pyrene multiple interactions ISO Ltc4s (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of LTC4S mRNA and AHR protein affects the reaction [Benzo(a)pyrene affects the expression of LTC4S mRNA] CTD PMID:22228805 and PMID:27858113 Ltc4s Rat benzo[a]pyrene increases expression ISO Ltc4s (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of LTC4S mRNA CTD PMID:21964900 more ... Ltc4s Rat benzo[b]fluoranthene increases expression ISO Ltc4s (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of LTC4S mRNA CTD PMID:26377693 Ltc4s Rat benzo[b]fluoranthene multiple interactions ISO Ltc4s (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of LTC4S mRNA CTD PMID:27858113 Ltc4s Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of LTC4S mRNA CTD PMID:18164116 Ltc4s Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of LTC4S mRNA CTD PMID:25181051 and PMID:30903817 Ltc4s Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of LTC4S gene CTD PMID:28505145 Ltc4s Rat bisphenol F decreases expression ISO Ltc4s (Mus musculus) 6480464 bisphenol F results in decreased expression of LTC4S mRNA CTD PMID:38685157 Ltc4s Rat bucladesine decreases secretion ISO LTC4S (Homo sapiens) 6480464 Bucladesine results in decreased secretion of LTC4S protein CTD PMID:16083514 Ltc4s Rat carbon nanotube decreases expression ISO Ltc4s (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Ltc4s Rat chlorohydrocarbon multiple interactions EXP 6480464 [Hydrocarbons and Chlorinated co-treated with Polychlorinated Biphenyls co-treated with methylmercuric chloride] results in decreased expression of LTC4S mRNA CTD PMID:30744511 Ltc4s Rat chromium(6+) affects expression ISO Ltc4s (Mus musculus) 6480464 chromium hexavalent ion affects the expression of LTC4S mRNA CTD PMID:28472532 Ltc4s Rat chrysene multiple interactions ISO Ltc4s (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of LTC4S mRNA CTD PMID:27858113 Ltc4s Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of LTC4S mRNA CTD PMID:17602206 Ltc4s Rat colforsin daropate hydrochloride decreases secretion ISO LTC4S (Homo sapiens) 6480464 Colforsin results in decreased secretion of LTC4S protein CTD PMID:16083514 Ltc4s Rat D-glucose multiple interactions ISO Ltc4s (Mus musculus) 6480464 fucoxanthin inhibits the reaction [Glucose results in increased expression of LTC4S mRNA] CTD PMID:33448797 Ltc4s Rat D-glucose increases expression ISO Ltc4s (Mus musculus) 6480464 Glucose results in increased expression of LTC4S mRNA CTD PMID:33448797 Ltc4s Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of LTC4S mRNA CTD PMID:23640034 Ltc4s Rat dexamethasone increases expression ISO LTC4S (Homo sapiens) 6480464 Dexamethasone results in increased expression of LTC4S mRNA CTD PMID:12891383 Ltc4s Rat diarsenic trioxide increases expression ISO LTC4S (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of LTC4S mRNA CTD PMID:15761015 Ltc4s Rat diarsenic trioxide decreases expression ISO LTC4S (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of LTC4S mRNA CTD PMID:20458559 Ltc4s Rat dibenz[a,h]anthracene increases expression ISO Ltc4s (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Ltc4s Rat diclofenac increases expression EXP 6480464 Diclofenac results in increased expression of LTC4S mRNA CTD PMID:30723492 Ltc4s Rat diethyl maleate decreases expression EXP 6480464 diethyl maleate results in decreased expression of LTC4S mRNA CTD PMID:21161181 Ltc4s Rat etazolate decreases secretion ISO LTC4S (Homo sapiens) 6480464 Etazolate results in decreased secretion of LTC4S protein CTD PMID:16083514 Ltc4s Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of LTC4S mRNA CTD PMID:18035473 Ltc4s Rat fucoxanthin multiple interactions ISO Ltc4s (Mus musculus) 6480464 fucoxanthin inhibits the reaction [Glucose results in increased expression of LTC4S mRNA] CTD PMID:33448797 Ltc4s Rat furan decreases expression EXP 6480464 furan results in decreased expression of LTC4S mRNA CTD PMID:26194646 Ltc4s Rat glucose multiple interactions ISO Ltc4s (Mus musculus) 6480464 fucoxanthin inhibits the reaction [Glucose results in increased expression of LTC4S mRNA] CTD PMID:33448797 Ltc4s Rat glucose increases expression ISO Ltc4s (Mus musculus) 6480464 Glucose results in increased expression of LTC4S mRNA CTD PMID:33448797 Ltc4s Rat histamine decreases response to substance ISO LTC4S (Homo sapiens) 6480464 LTC4S polymorphism results in decreased susceptibility to Histamine CTD PMID:19862937 Ltc4s Rat leukotriene C4 affects chemical synthesis ISO LTC4S (Homo sapiens) 6480464 LTC4S protein affects the chemical synthesis of Leukotriene C4 CTD PMID:10666225 Ltc4s Rat lipopolysaccharide decreases expression ISO LTC4S (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of LTC4S mRNA CTD PMID:12574384 Ltc4s Rat lipopolysaccharide decreases expression ISO Ltc4s (Mus musculus) 6480464 Lipopolysaccharides results in decreased expression of LTC4S mRNA CTD PMID:21461237 Ltc4s Rat lipopolysaccharide multiple interactions ISO LTC4S (Homo sapiens) 6480464 parthenolide inhibits the reaction [Lipopolysaccharides results in decreased expression of LTC4S mRNA] and TLR4 protein affects the reaction [Lipopolysaccharides results in decreased expression of LTC4S mRNA] CTD PMID:12574384 Ltc4s Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of LTC4S mRNA CTD PMID:19564919 Ltc4s Rat methamphetamine multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in decreased expression of LTC4S mRNA CTD PMID:19564919 Ltc4s Rat methylmercury chloride multiple interactions EXP 6480464 [Hydrocarbons and Chlorinated co-treated with Polychlorinated Biphenyls co-treated with methylmercuric chloride] results in decreased expression of LTC4S mRNA CTD PMID:30744511 Ltc4s Rat montelukast affects response to substance ISO LTC4S (Homo sapiens) 6480464 LTC4S gene SNP affects the susceptibility to montelukast CTD PMID:16293801 Ltc4s Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of LTC4S mRNA and [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of LTC4S mRNA CTD PMID:17602206 and PMID:18164116 Ltc4s Rat nitroprusside decreases expression EXP 6480464 Nitroprusside results in decreased expression of LTC4S mRNA CTD PMID:17496435 Ltc4s Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of LTC4S mRNA CTD PMID:23665939 Ltc4s Rat parthenolide multiple interactions ISO LTC4S (Homo sapiens) 6480464 parthenolide inhibits the reaction [Lipopolysaccharides results in decreased expression of LTC4S mRNA] CTD PMID:12574384 Ltc4s Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ltc4s (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of LTC4S mRNA CTD PMID:36331819 Ltc4s Rat resveratrol decreases expression ISO Ltc4s (Mus musculus) 6480464 Resveratrol results in decreased expression of LTC4S mRNA CTD PMID:23751068 Ltc4s Rat rolipram decreases secretion ISO LTC4S (Homo sapiens) 6480464 Rolipram results in decreased secretion of LTC4S protein CTD PMID:16083514 Ltc4s Rat SB 203580 multiple interactions ISO Ltc4s (Mus musculus) 6480464 SB 203580 inhibits the reaction [2-chloroethyl ethyl sulfide results in increased expression of LTC4S mRNA] CTD PMID:20382172 Ltc4s Rat SCH 23390 multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in decreased expression of LTC4S mRNA CTD PMID:19564919 Ltc4s Rat sodium arsenite decreases expression ISO LTC4S (Homo sapiens) 6480464 sodium arsenite results in decreased expression of LTC4S mRNA CTD PMID:29301061 and PMID:38568856 Ltc4s Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of LTC4S mRNA CTD PMID:25993096 Ltc4s Rat tetrachloromethane multiple interactions ISO Ltc4s (Mus musculus) 6480464 PTGS1 gene mutant form promotes the reaction [Carbon Tetrachloride results in increased expression of LTC4S mRNA] and SC 560 promotes the reaction [Carbon Tetrachloride results in increased expression of LTC4S mRNA] CTD PMID:25432964 Ltc4s Rat tetrachloromethane increases expression ISO Ltc4s (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of LTC4S mRNA CTD PMID:25432964 Ltc4s Rat tetraphene multiple interactions ISO Ltc4s (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of LTC4S mRNA CTD PMID:27858113 Ltc4s Rat theophylline decreases secretion ISO LTC4S (Homo sapiens) 6480464 Theophylline results in decreased secretion of LTC4S protein CTD PMID:16083514 Ltc4s Rat titanium dioxide decreases expression ISO Ltc4s (Mus musculus) 6480464 titanium dioxide results in decreased expression of LTC4S mRNA CTD PMID:23557971 Ltc4s Rat titanium dioxide decreases methylation ISO Ltc4s (Mus musculus) 6480464 titanium dioxide results in decreased methylation of LTC4S gene CTD PMID:35295148 Ltc4s Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of LTC4S mRNA CTD PMID:33387578 Ltc4s Rat triphenyl phosphate affects expression ISO LTC4S (Homo sapiens) 6480464 triphenyl phosphate affects the expression of LTC4S mRNA CTD PMID:37042841 Ltc4s Rat troglitazone increases expression ISO Ltc4s (Mus musculus) 6480464 troglitazone results in increased expression of LTC4S mRNA CTD PMID:28973697 Ltc4s Rat valproic acid increases methylation ISO LTC4S (Homo sapiens) 6480464 Valproic Acid results in increased methylation of LTC4S gene CTD PMID:29154799 Ltc4s Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of LTC4S mRNA CTD PMID:29427782
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 7,12-dimethyltetraphene (EXP) acetamide (EXP) acetohydrazide (ISO) acetylsalicylic acid (ISO) acrylamide (EXP,ISO) aflatoxin B1 (EXP) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (ISO) ammonium chloride (EXP) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) beta-naphthoflavone (EXP) bisphenol A (EXP) bisphenol F (ISO) bucladesine (ISO) carbon nanotube (ISO) chlorohydrocarbon (EXP) chromium(6+) (ISO) chrysene (ISO) clofibric acid (EXP) colforsin daropate hydrochloride (ISO) D-glucose (ISO) decabromodiphenyl ether (EXP) dexamethasone (ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (ISO) diclofenac (EXP) diethyl maleate (EXP) etazolate (ISO) flavonoids (EXP) fucoxanthin (ISO) furan (EXP) glucose (ISO) histamine (ISO) leukotriene C4 (ISO) lipopolysaccharide (ISO) methamphetamine (EXP) methylmercury chloride (EXP) montelukast (ISO) N-nitrosodiethylamine (EXP) nitroprusside (EXP) orphenadrine (EXP) parthenolide (ISO) perfluorooctane-1-sulfonic acid (ISO) resveratrol (ISO) rolipram (ISO) SB 203580 (ISO) SCH 23390 (EXP) sodium arsenite (ISO) sodium dichromate (EXP) tetrachloromethane (ISO) tetraphene (ISO) theophylline (ISO) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) troglitazone (ISO) valproic acid (EXP,ISO)
1.
Induction of leukotriene C4 synthase after the differentiation of rat basophilic leukemia cells with retinoic acid and a low dose of actinomycin D and its suppression with methylprednisolone.
Abe M, etal., J Cell Physiol 2003 Jul;196(1):154-64.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Human bronchial epithelial cells express an active and inducible biosynthetic pathway for leukotrienes B4 and C4.
Jame AJ, etal., Clin Exp Allergy. 2007 Jun;37(6):880-92.
4.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
5.
Enhanced expressions and activations of leukotriene C4 synthesis enzymes in D-galactosamine/lipopolysaccharide-induced rat fulminant hepatic failure model.
Ma KF, etal., World J Gastroenterol. 2008 May 7;14(17):2748-56.
6.
The membrane organization of leukotriene synthesis.
Mandal AK, etal., Proc Natl Acad Sci U S A. 2004 Apr 27;101(17):6587-92. Epub 2004 Apr 14.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
Leukotriene synthases and the receptors induced by peripheral nerve injury in the spinal cord contribute to the generation of neuropathic pain.
Okubo M, etal., Glia. 2010 Apr;58(5):599-610.
10.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
11.
Renal leukotriene C4 synthase: characterization, partial purification and alterations in experimental glomerulonephritis.
Petric R, etal., Biochim Biophys Acta. 1995 Jan 20;1254(2):207-15.
12.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
13.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
14.
GOA pipeline
RGD automated data pipeline
15.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
16.
Molecular and catalytic properties of three rat leukotriene C(4) synthase homologs.
Schroder O, etal., Biochem Biophys Res Commun. 2003 Dec 12;312(2):271-6.
17.
Microsomal glutathione S-transferases: selective up-regulation of leukotriene C4 synthase during lipopolysaccharide-induced pyresis.
Schroder O, etal., Cell Mol Life Sci. 2005 Jan;62(1):87-94.
18.
Expression and regulation of leukotriene-synthesis enzymes in rat liver cells.
Shimada K, etal., Hepatology. 1998 Nov;28(5):1275-81.
19.
High-level expression, purification, and crystallization of recombinant rat leukotriene C(4) synthase from the yeast Pichia pastoris.
Wetterholm A, etal., Protein Expr Purif. 2008 Jul;60(1):1-6. Epub 2008 Mar 23.
20.
Sodium nitroprusside decreased leukotriene C4 generation by inhibiting leukotriene C4 synthase expression and activity in hepatic ischemia-reperfusion injured rats.
Yang SL and Lou YJ, Biochem Pharmacol. 2007 Mar 1;73(5):724-35. Epub 2006 Nov 18.
21.
Sodium nitroprusside regulates mRNA expressions of LTC4 synthesis enzymes in hepatic ischemia/reperfusion injury rats via NF-kappaB signaling pathway.
Yang SL, etal., Pharmacology. 2007;80(1):11-20. Epub 2007 May 10.
Ltc4s Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 35,060,002 - 35,066,466 (-) NCBI GRCr8 mRatBN7.2 10 34,560,476 - 34,562,790 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 34,560,360 - 34,562,651 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 39,235,902 - 39,237,857 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 7,775,154 - 7,777,109 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 34,229,574 - 34,231,529 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 35,736,486 - 35,743,088 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 35,737,664 - 35,739,625 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 35,498,195 - 35,506,088 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 35,786,877 - 35,788,838 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 35,787,925 - 35,789,881 (-) NCBI Celera 10 33,909,805 - 33,911,766 (-) NCBI Celera Cytogenetic Map 10 q22 NCBI
LTC4S Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 179,793,986 - 179,796,647 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 179,793,980 - 179,796,647 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 179,220,987 - 179,223,648 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 179,153,592 - 179,156,119 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 179,153,591 - 179,156,119 NCBI Celera 5 174,846,142 - 174,848,669 (+) NCBI Celera Cytogenetic Map 5 q35.3 NCBI HuRef 5 173,947,161 - 173,949,688 (+) NCBI HuRef CHM1_1 5 178,653,394 - 178,655,921 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 180,349,182 - 180,351,843 (+) NCBI T2T-CHM13v2.0
Ltc4s Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 50,127,288 - 50,129,378 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 50,127,288 - 50,129,443 (-) Ensembl GRCm39 Ensembl GRCm38 11 50,236,461 - 50,238,532 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 50,236,461 - 50,238,616 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 50,049,974 - 50,051,973 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 50,079,895 - 50,081,894 (-) NCBI MGSCv36 mm8 Celera 11 54,797,050 - 54,799,049 (-) NCBI Celera Cytogenetic Map 11 B1.3 NCBI cM Map 11 30.4 NCBI
Ltc4s Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955408 788,856 - 791,505 (-) NCBI ChiLan1.0 ChiLan1.0
LTC4S Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 174,735,060 - 174,739,519 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 172,874,599 - 172,879,058 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 174,946,346 - 174,950,805 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 182,256,113 - 182,261,003 (+) NCBI panpan1.1 PanPan1.1 panPan2
LTC4S Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 1,893,927 - 1,897,028 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 1,894,380 - 1,897,752 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 2,012,534 - 2,020,224 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 1,863,608 - 1,871,298 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 1,867,307 - 1,871,411 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 1,835,205 - 1,842,895 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 1,914,372 - 1,922,062 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 2,154,596 - 2,162,286 (-) NCBI UU_Cfam_GSD_1.0
Ltc4s
LTC4S Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 78,799,449 - 78,802,285 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 78,799,446 - 78,802,281 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 80,365,497 - 80,368,339 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LTC4S Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 23 81,523,784 - 81,526,297 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 23 81,523,775 - 81,526,179 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666075 12,900,551 - 12,903,368 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ltc4s
.
Predicted Target Of
Count of predictions: 82 Count of miRNA genes: 73 Interacting mature miRNAs: 75 Transcripts: ENSRNOT00000004359 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2293680 Bss40 Bone structure and strength QTL 40 5.66 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 10 1 35225947 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 61332 Eau3 Experimental allergic uveoretinitis QTL 3 0.004 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 34490559 45579777 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat 631531 Iresp2 Immunoglobin response QTL2 6.3 blood immunoglobulin E amount (VT:0002492) serum immunoglobulin E level (CMO:0002101) 10 22918268 36400810 Rat 631532 Cm50 Cardiac mass QTL 50 6.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 17907113 51786432 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1600371 Mcs21 Mammary carcinoma susceptibility QTL 21 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 28875650 52200160 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004359 ⟹ ENSRNOP00000004359
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 34,560,555 - 34,561,801 (-) Ensembl Rnor_6.0 Ensembl 10 35,737,664 - 35,739,625 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000110795 ⟹ ENSRNOP00000087343
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 34,560,360 - 34,562,651 (-) Ensembl
RefSeq Acc Id:
NM_053639 ⟹ NP_446091
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 35,061,633 - 35,063,594 (-) NCBI mRatBN7.2 10 34,560,555 - 34,562,516 (-) NCBI Rnor_6.0 10 35,737,664 - 35,739,625 (-) NCBI Rnor_5.0 10 35,498,195 - 35,506,088 (-) NCBI RGSC_v3.4 10 35,786,877 - 35,788,838 (-) RGD Celera 10 33,909,805 - 33,911,766 (-) RGD
Sequence:
GCTAATTCTGCCTGTGGCTGGCAACATGAAGGAAGAAACAGCTCTTCTGGCTACCGTCACCCTCGTGGGAGTTCTGCTGCAAGCCTACTTCTCCCTACAGGTGATCTCTGCGCGAAGAACTTTCCACG
hide sequence
RefSeq Acc Id:
XM_006246219 ⟹ XP_006246281
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 35,061,562 - 35,063,505 (-) NCBI mRatBN7.2 10 34,560,484 - 34,562,427 (-) NCBI Rnor_6.0 10 35,736,486 - 35,739,535 (-) NCBI Rnor_5.0 10 35,498,195 - 35,506,088 (-) NCBI
Sequence:
GGCTCCTGTCTGGGGGATGGGTGGATCTTAGACCTACGCAGCCTGCTCTCCGTCCTTCAGCCCCTTGGGGTAGGGAATTGGGGTGCTGGCAGGCCTAGGCTCAGGTGAAGGACAGGAGCTTCTAGCCT
hide sequence
RefSeq Acc Id:
XM_039085020 ⟹ XP_038940948
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 35,061,562 - 35,063,684 (-) NCBI mRatBN7.2 10 34,560,484 - 34,562,624 (-) NCBI
RefSeq Acc Id:
XM_063268266 ⟹ XP_063124336
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 35,060,002 - 35,066,466 (-) NCBI
RefSeq Acc Id:
NP_446091 ⟸ NM_053639
- UniProtKB:
Q925U2 (UniProtKB/Swiss-Prot), G3V6E6 (UniProtKB/Swiss-Prot), A0A8L2Q1E0 (UniProtKB/TrEMBL)
- Sequence:
MKEETALLATVTLVGVLLQAYFSLQVISARRTFHVSPPLTSGPPEFERVFRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQHRLDPLYASARALWLLVAMAALGLLV
hide sequence
RefSeq Acc Id:
XP_006246281 ⟸ XM_006246219
- Peptide Label:
isoform X2
- UniProtKB:
A0A8L2Q1E0 (UniProtKB/TrEMBL)
- Sequence:
MKPPRSVYRGAEETVHGSTEEDQVISARRTFHVSPPLTSGPPEFERVFRAQVNCSEYFPLFLAT
hide sequence
Ensembl Acc Id:
ENSRNOP00000004359 ⟸ ENSRNOT00000004359
RefSeq Acc Id:
XP_038940948 ⟸ XM_039085020
- Peptide Label:
isoform X3
- UniProtKB:
A6HE07 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000087343 ⟸ ENSRNOT00000110795
RefSeq Acc Id:
XP_063124336 ⟸ XM_063268266
- Peptide Label:
isoform X1
RGD ID: 13697151 Promoter ID: EPDNEW_R7676 Type: single initiation site Name: Ltc4s_1 Description: leukotriene C4 synthase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 35,739,627 - 35,739,687 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Ltc4s
leukotriene C4 synthase
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Ltc4s
leukotriene C4 synthase
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_regulation
inhibited by steroids at the transcriptional level
724432
