Symbol:
Taldo1
Name:
transaldolase 1
RGD ID:
620674
Description:
Enables monosaccharide binding activity and transaldolase activity. Involved in fructose 6-phosphate metabolic process and pentose-phosphate shunt, non-oxidative branch. Predicted to be located in cytoplasm. Predicted to be active in cytosol and nucleus. Human ortholog(s) of this gene implicated in carbohydrate metabolic disorder. Orthologous to human TALDO1 (transaldolase 1); PARTICIPATES IN pentose phosphate pathway; pentose phosphate pathway - non-oxidative phase; ribose 5-phosphate isomerase deficiency pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dibromophenyl 2,4,5-tribromophenyl ether.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
transaldolase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TALDO1 (transaldolase 1)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Taldo1 (transaldolase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Taldo1 (transaldolase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TALDO1 (transaldolase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TALDO1 (transaldolase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Taldo1 (transaldolase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TALDO1 (transaldolase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TALDO1 (transaldolase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Taldo1 (transaldolase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
TALDO1 (transaldolase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Taldo1 (transaldolase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
taldo1 (transaldolase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
NQM1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Taldo
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
tald-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
TAL1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
taldo1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 205,923,196 - 205,933,526 (+) NCBI GRCr8 mRatBN7.2 1 196,493,634 - 196,503,965 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 196,493,589 - 196,503,974 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 204,839,159 - 204,849,489 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 211,967,918 - 211,978,015 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 204,642,055 - 204,652,153 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 214,375,555 - 214,385,886 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 214,375,515 - 214,385,885 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 221,292,669 - 221,302,999 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 201,582,856 - 201,593,187 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 201,737,566 - 201,747,896 (+) NCBI Celera 1 194,127,362 - 194,137,466 (+) NCBI Celera Cytogenetic Map 1 q41 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Taldo1 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:733189 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TALDO1 mRNA CTD PMID:36331819 Taldo1 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:733189 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TALDO1 mRNA CTD PMID:22206623 Taldo1 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:733189 6480464 1,2-Dimethylhydrazine results in decreased expression of TALDO1 mRNA CTD PMID:22206623 Taldo1 Rat 17beta-estradiol multiple interactions ISO RGD:733188 6480464 [Estradiol co-treated with Norethindrone Acetate] results in increased expression of TALDO1 mRNA CTD PMID:22217510 Taldo1 Rat 17beta-estradiol decreases expression ISO RGD:733189 6480464 Estradiol results in decreased expression of TALDO1 mRNA CTD PMID:39298647 Taldo1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of TALDO1 mRNA CTD PMID:32145629 Taldo1 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one decreases expression ISO RGD:733188 6480464 Metribolone results in decreased expression of TALDO1 protein CTD PMID:17152098 Taldo1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TALDO1 mRNA CTD PMID:20558275|PMID:33387578 Taldo1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of TALDO1 mRNA CTD PMID:34747641 Taldo1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:733189 6480464 Tetrachlorodibenzodioxin results in increased expression of TALDO1 mRNA CTD PMID:15034205 Taldo1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:733189 6480464 Tetrachlorodibenzodioxin affects the expression of TALDO1 mRNA CTD PMID:21570461 Taldo1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression EXP 6480464 2,2',4,4',5-brominated diphenyl ether results in decreased expression of TALDO1 protein CTD PMID:19954255 Taldo1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression EXP 6480464 2,2',4,4',5-brominated diphenyl ether results in increased expression of TALDO1 protein CTD PMID:19954255 Taldo1 Rat 2,6-dimethoxyphenol multiple interactions ISO RGD:733188 6480464 [Sodium Chloride co-treated with pyrogallol 1,3-dimethyl ether] results in decreased expression of TALDO1 protein CTD PMID:38598786 Taldo1 Rat 2-acetamidofluorene multiple interactions EXP 6480464 [2-Acetylaminofluorene co-treated with Diethylnitrosamine] results in increased expression of TALDO1 mRNA; [Diethylnitrosamine co-treated with 2-Acetylaminofluorene] more ... CTD PMID:14656948|PMID:16158176 Taldo1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:733188 6480464 tetrabromobisphenol A results in decreased expression of TALDO1 protein CTD PMID:31675489 Taldo1 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin analog results in decreased expression of TALDO1 protein CTD PMID:26597043 Taldo1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of TALDO1 protein CTD PMID:34915118 Taldo1 Rat 4,4'-diaminodiphenylmethane decreases expression ISO RGD:733189 6480464 4,4'-diaminodiphenylmethane results in decreased expression of TALDO1 mRNA CTD PMID:18648102 Taldo1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:733189 6480464 bisphenol S results in increased expression of TALDO1 mRNA CTD PMID:39298647 Taldo1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:733188 6480464 bisphenol S results in increased expression of TALDO1 protein CTD PMID:34186270 Taldo1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of TALDO1 mRNA CTD PMID:31881176 Taldo1 Rat actinomycin D multiple interactions ISO RGD:733188 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of TALDO1 protein CTD PMID:38460933 Taldo1 Rat ADP increases abundance ISO RGD:733189 6480464 TALDO1 gene mutant form results in increased abundance of Adenosine Diphosphate CTD PMID:19436114 Taldo1 Rat aflatoxin B1 increases methylation ISO RGD:733188 6480464 Aflatoxin B1 results in increased methylation of TALDO1 polyA tail CTD PMID:30157460 Taldo1 Rat all-trans-retinoic acid increases expression ISO RGD:733188 6480464 Tretinoin results in increased expression of TALDO1 mRNA CTD PMID:33167477 Taldo1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TALDO1 mRNA CTD PMID:16483693 Taldo1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of TALDO1 mRNA CTD PMID:30779732 Taldo1 Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions ISO RGD:733189 6480464 pyrazolanthrone affects the reaction [TALDO1 gene mutant form promotes the reaction [Acetaminophen results in increased more ... CTD PMID:19436114 Taldo1 Rat aristolochic acid A increases expression ISO RGD:733188 6480464 aristolochic acid I results in increased expression of TALDO1 protein CTD PMID:33212167 Taldo1 Rat arsane multiple interactions ISO RGD:733188 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Taldo1 Rat arsenic atom multiple interactions ISO RGD:733188 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Taldo1 Rat arsenite(3-) multiple interactions ISO RGD:733188 6480464 arsenite inhibits the reaction [G3BP1 protein binds to TALDO1 protein]; arsenite promotes the reaction [G3BP1 more ... CTD PMID:32406909 Taldo1 Rat arsenous acid increases expression ISO RGD:733188 6480464 Arsenic Trioxide results in increased expression of TALDO1 mRNA CTD PMID:20458559 Taldo1 Rat ATP increases abundance ISO RGD:733189 6480464 TALDO1 gene mutant form results in increased abundance of Adenosine Triphosphate CTD PMID:19436114 Taldo1 Rat benzo[a]pyrene decreases expression ISO RGD:733189 6480464 Benzo(a)pyrene results in decreased expression of TALDO1 mRNA CTD PMID:22228805 Taldo1 Rat benzo[a]pyrene increases expression ISO RGD:733188 6480464 Benzo(a)pyrene results in increased expression of TALDO1 mRNA CTD PMID:21632981|PMID:22316170|PMID:26238291 Taldo1 Rat benzo[a]pyrene increases expression ISO RGD:733189 6480464 Benzo(a)pyrene results in increased expression of TALDO1 mRNA CTD PMID:15034205|PMID:25908611 Taldo1 Rat benzo[a]pyrene multiple interactions ISO RGD:733189 6480464 AHR protein promotes the reaction [Benzo(a)pyrene results in increased expression of TALDO1 mRNA] CTD PMID:15034205 Taldo1 Rat benzo[e]pyrene decreases methylation ISO RGD:733188 6480464 benzo(e)pyrene results in decreased methylation of TALDO1 polyA tail CTD PMID:30157460 Taldo1 Rat beta-lapachone increases expression ISO RGD:733188 6480464 beta-lapachone results in increased expression of TALDO1 mRNA CTD PMID:38218311 Taldo1 Rat beta-naphthoflavone increases expression ISO RGD:733188 6480464 beta-Naphthoflavone results in increased expression of TALDO1 mRNA CTD PMID:19737606 Taldo1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:733189 6480464 Diethylhexyl Phthalate results in decreased expression of TALDO1 mRNA CTD PMID:34319233 Taldo1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TALDO1 mRNA CTD PMID:25181051 Taldo1 Rat bisphenol A decreases expression ISO RGD:733189 6480464 bisphenol A results in decreased expression of TALDO1 protein CTD PMID:35999755 Taldo1 Rat bisphenol A decreases expression ISO RGD:733188 6480464 bisphenol A results in decreased expression of TALDO1 protein CTD PMID:31675489|PMID:34186270|PMID:37567409 Taldo1 Rat bisphenol A increases expression ISO RGD:733189 6480464 bisphenol A results in increased expression of TALDO1 mRNA CTD PMID:33221593 Taldo1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TALDO1 mRNA CTD PMID:30816183|PMID:32145629|PMID:32528016|PMID:34947998 Taldo1 Rat bisphenol A affects expression ISO RGD:733188 6480464 bisphenol A affects the expression of TALDO1 mRNA CTD PMID:30903817 Taldo1 Rat bisphenol AF increases expression ISO RGD:733188 6480464 bisphenol AF results in increased expression of TALDO1 protein CTD PMID:34186270 Taldo1 Rat Bisphenol B increases expression ISO RGD:733188 6480464 bisphenol B results in increased expression of TALDO1 protein CTD PMID:34186270 Taldo1 Rat bisphenol F increases expression ISO RGD:733188 6480464 bisphenol F results in increased expression of TALDO1 protein CTD PMID:34186270 Taldo1 Rat bleomycin A2 decreases expression EXP 6480464 Bleomycin results in decreased expression of TALDO1 protein CTD PMID:25933445 Taldo1 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of TALDO1 protein CTD PMID:28903499 Taldo1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of TALDO1 mRNA; Cadmium Chloride results in increased expression more ... CTD PMID:21297351|PMID:21699967 Taldo1 Rat cadmium dichloride increases expression ISO RGD:733188 6480464 Cadmium Chloride results in increased expression of TALDO1 mRNA CTD PMID:25596134|PMID:38568856 Taldo1 Rat captan increases expression ISO RGD:733189 6480464 Captan results in increased expression of TALDO1 mRNA CTD PMID:31558096 Taldo1 Rat carbon nanotube decreases expression ISO RGD:733189 6480464 Nanotubes, Carbon results in decreased expression of TALDO1 mRNA CTD PMID:25620056 Taldo1 Rat chloroacetaldehyde increases expression ISO RGD:733188 6480464 chloroacetaldehyde results in increased expression of TALDO1 mRNA CTD PMID:25596134 Taldo1 Rat cidofovir anhydrous increases expression ISO RGD:733188 6480464 Cidofovir results in increased expression of TALDO1 mRNA CTD PMID:25596134 Taldo1 Rat cisplatin increases expression ISO RGD:733188 6480464 Cisplatin results in increased expression of TALDO1 mRNA CTD PMID:25596134 Taldo1 Rat cisplatin multiple interactions ISO RGD:733188 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of TALDO1 mRNA CTD PMID:27392435 Taldo1 Rat clofibrate multiple interactions ISO RGD:733189 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of TALDO1 mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Taldo1 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of TALDO1 protein CTD PMID:25100957 Taldo1 Rat copper(II) chloride increases expression ISO RGD:733188 6480464 cupric chloride results in increased expression of TALDO1 mRNA CTD PMID:17211630 Taldo1 Rat copper(II) sulfate increases expression ISO RGD:733188 6480464 Copper Sulfate results in increased expression of TALDO1 mRNA CTD PMID:19549813 Taldo1 Rat crocidolite asbestos increases expression ISO RGD:733188 6480464 Asbestos, Crocidolite results in increased expression of TALDO1 mRNA CTD PMID:29523930 Taldo1 Rat curcumin increases expression EXP 6480464 Curcumin results in increased expression of TALDO1 mRNA CTD PMID:18299980 Taldo1 Rat cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of TALDO1 mRNA CTD PMID:25596134 Taldo1 Rat cyclosporin A increases expression ISO RGD:733188 6480464 Cyclosporine results in increased expression of TALDO1 mRNA CTD PMID:20106945|PMID:25562108|PMID:25596134 Taldo1 Rat D-ribofuranose 5-phosphate increases abundance ISO RGD:733189 6480464 TALDO1 gene mutant form results in increased abundance of ribose-5-phosphate CTD PMID:19436114 Taldo1 Rat D-xylulose 5-phosphate increases abundance ISO RGD:733189 6480464 TALDO1 gene mutant form results in increased abundance of xylulose-5-phosphate CTD PMID:19436114 Taldo1 Rat diarsenic trioxide increases expression ISO RGD:733188 6480464 Arsenic Trioxide results in increased expression of TALDO1 mRNA CTD PMID:20458559 Taldo1 Rat diethylstilbestrol increases expression ISO RGD:733188 6480464 Diethylstilbestrol results in increased expression of TALDO1 mRNA CTD PMID:36621641 Taldo1 Rat dioxygen decreases expression ISO RGD:733188 6480464 Oxygen deficiency results in decreased expression of TALDO1 mRNA CTD PMID:25596134 Taldo1 Rat dorsomorphin multiple interactions ISO RGD:733188 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Taldo1 Rat doxorubicin increases expression ISO RGD:733188 6480464 Doxorubicin results in increased expression of TALDO1 mRNA CTD PMID:29803840 Taldo1 Rat elemental selenium increases expression ISO RGD:733188 6480464 Selenium results in increased expression of TALDO1 mRNA CTD PMID:19244175 Taldo1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of TALDO1 mRNA CTD PMID:29391264 Taldo1 Rat enzyme inhibitor multiple interactions ISO RGD:733188 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Taldo1 Rat fenofibrate decreases expression EXP 6480464 Fenofibrate results in decreased expression of TALDO1 mRNA CTD PMID:25596134 Taldo1 Rat fenthion decreases expression ISO RGD:733189 6480464 Fenthion results in decreased expression of TALDO1 mRNA CTD PMID:34813904 Taldo1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of TALDO1 mRNA CTD PMID:24136188 Taldo1 Rat folic acid multiple interactions ISO RGD:733189 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TALDO1 mRNA CTD PMID:22206623 Taldo1 Rat folpet increases expression ISO RGD:733189 6480464 folpet results in increased expression of TALDO1 mRNA CTD PMID:31558096 Taldo1 Rat furfural multiple interactions ISO RGD:733188 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ... CTD PMID:38598786 Taldo1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of TALDO1 mRNA; Gentamicins results in decreased expression of TALDO1 more ... CTD PMID:22061828 Taldo1 Rat glutathione multiple interactions ISO RGD:733189 6480464 Acetylcysteine inhibits the reaction [TALDO1 gene mutant form results in decreased abundance of Glutathione] CTD PMID:19436114 Taldo1 Rat glutathione decreases abundance ISO RGD:733189 6480464 TALDO1 gene mutant form results in decreased abundance of Glutathione CTD PMID:19436114 Taldo1 Rat hydralazine multiple interactions ISO RGD:733188 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of TALDO1 mRNA CTD PMID:17183730 Taldo1 Rat hydroquinone affects expression ISO RGD:733188 6480464 hydroquinone affects the expression of TALDO1 protein CTD PMID:20021034 Taldo1 Rat ibuprofen decreases expression EXP 6480464 Ibuprofen results in decreased expression of TALDO1 mRNA CTD PMID:25596134 Taldo1 Rat ifosfamide increases expression ISO RGD:733188 6480464 Ifosfamide results in increased expression of TALDO1 mRNA CTD PMID:25596134 Taldo1 Rat inulin multiple interactions ISO RGD:733189 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of TALDO1 mRNA CTD PMID:36331819 Taldo1 Rat isotretinoin decreases expression ISO RGD:733188 6480464 Isotretinoin results in decreased expression of TALDO1 mRNA CTD PMID:20436886 Taldo1 Rat ivermectin decreases expression ISO RGD:733188 6480464 Ivermectin results in decreased expression of TALDO1 protein CTD PMID:32959892 Taldo1 Rat lead diacetate increases expression ISO RGD:733188 6480464 lead acetate results in increased expression of TALDO1 mRNA CTD PMID:38568856 Taldo1 Rat lipopolysaccharide multiple interactions ISO RGD:733188 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of TALDO1 mRNA CTD PMID:35877022 Taldo1 Rat Macrosphelide A affects binding ISO RGD:733188 6480464 macrosphelide A binds to TALDO1 protein CTD PMID:34681284 Taldo1 Rat manganese atom multiple interactions ISO RGD:733188 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Taldo1 Rat manganese(0) multiple interactions ISO RGD:733188 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Taldo1 Rat manganese(II) chloride multiple interactions ISO RGD:733188 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Taldo1 Rat metformin decreases expression EXP 6480464 Metformin results in decreased expression of TALDO1 mRNA CTD PMID:25596134 Taldo1 Rat methapyrilene decreases methylation ISO RGD:733188 6480464 Methapyrilene results in decreased methylation of TALDO1 polyA tail CTD PMID:30157460 Taldo1 Rat methidathion decreases expression ISO RGD:733189 6480464 methidathion results in decreased expression of TALDO1 mRNA CTD PMID:34813904 Taldo1 Rat microcystin RR decreases expression ISO RGD:733188 6480464 microcystin RR results in decreased expression of TALDO1 protein CTD PMID:19111056 Taldo1 Rat N-acetyl-L-cysteine multiple interactions ISO RGD:733189 6480464 Acetylcysteine inhibits the reaction [TALDO1 gene mutant form results in decreased abundance of Glutathione]; Acetylcysteine more ... CTD PMID:19436114 Taldo1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of TALDO1 mRNA CTD PMID:19638242 Taldo1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [2-Acetylaminofluorene co-treated with Diethylnitrosamine] results in increased expression of TALDO1 mRNA; [Diethylnitrosamine co-treated with 2-Acetylaminofluorene] more ... CTD PMID:14656948|PMID:16158176|PMID:28943392 Taldo1 Rat NAD zwitterion decreases abundance ISO RGD:733189 6480464 TALDO1 gene mutant form results in decreased abundance of NAD CTD PMID:19436114 Taldo1 Rat NAD(+) decreases abundance ISO RGD:733189 6480464 TALDO1 gene mutant form results in decreased abundance of NAD CTD PMID:19436114 Taldo1 Rat NADP zwitterion decreases abundance ISO RGD:733189 6480464 TALDO1 gene mutant form results in decreased abundance of NADP CTD PMID:19436114 Taldo1 Rat NADP zwitterion multiple interactions ISO RGD:733189 6480464 Acetylcysteine inhibits the reaction [TALDO1 gene mutant form results in decreased abundance of NADP] CTD PMID:19436114 Taldo1 Rat NADP(+) decreases abundance ISO RGD:733189 6480464 TALDO1 gene mutant form results in decreased abundance of NADP CTD PMID:19436114 Taldo1 Rat NADP(+) multiple interactions ISO RGD:733189 6480464 Acetylcysteine inhibits the reaction [TALDO1 gene mutant form results in decreased abundance of NADP] CTD PMID:19436114 Taldo1 Rat nitric oxide multiple interactions ISO RGD:733189 6480464 Acetylcysteine inhibits the reaction [TALDO1 gene mutant form results in decreased abundance of Nitric Oxide] CTD PMID:19436114 Taldo1 Rat nitric oxide decreases abundance ISO RGD:733189 6480464 TALDO1 gene mutant form results in decreased abundance of Nitric Oxide CTD PMID:19436114 Taldo1 Rat Nutlin-3 multiple interactions ISO RGD:733188 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of TALDO1 protein CTD PMID:38460933 Taldo1 Rat paracetamol multiple interactions ISO RGD:733189 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of TALDO1 mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979|PMID:19436114 Taldo1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of TALDO1 mRNA CTD PMID:33387578 Taldo1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of TALDO1 mRNA CTD PMID:15084756 Taldo1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of TALDO1 mRNA CTD PMID:32680482 Taldo1 Rat parathion decreases expression ISO RGD:733189 6480464 Parathion results in decreased expression of TALDO1 mRNA CTD PMID:34813904 Taldo1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:733189 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TALDO1 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Taldo1 Rat perfluorooctanoic acid increases expression ISO RGD:733189 6480464 perfluorooctanoic acid results in increased expression of TALDO1 protein CTD PMID:37422089 Taldo1 Rat phenobarbital affects expression ISO RGD:733188 6480464 Phenobarbital affects the expression of TALDO1 mRNA CTD PMID:19159669 Taldo1 Rat pirinixic acid multiple interactions ISO RGD:733189 6480464 PPARA protein promotes the reaction [pirinixic acid results in increased expression of TALDO1 mRNA] CTD PMID:20059764 Taldo1 Rat pirinixic acid increases expression ISO RGD:733189 6480464 pirinixic acid results in increased expression of TALDO1 mRNA CTD PMID:18301758|PMID:20059764|PMID:20813756 Taldo1 Rat quercetin increases expression ISO RGD:733188 6480464 Quercetin results in increased expression of TALDO1 mRNA CTD PMID:21632981 Taldo1 Rat resveratrol affects expression ISO RGD:733188 6480464 resveratrol affects the expression of TALDO1 protein CTD PMID:22234583 Taldo1 Rat ribitol increases abundance ISO RGD:733189 6480464 TALDO1 gene mutant form results in increased abundance of Ribitol CTD PMID:19436114 Taldo1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of TALDO1 mRNA CTD PMID:28374803 Taldo1 Rat rotenone increases expression ISO RGD:733188 6480464 Rotenone results in increased expression of TALDO1 mRNA CTD PMID:33512557 Taldo1 Rat SB 431542 multiple interactions ISO RGD:733188 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of TALDO1 more ... CTD PMID:27188386|PMID:37664457 Taldo1 Rat selenium atom increases expression ISO RGD:733188 6480464 Selenium results in increased expression of TALDO1 mRNA CTD PMID:19244175 Taldo1 Rat sodium arsenite increases expression ISO RGD:733188 6480464 sodium arsenite results in increased expression of TALDO1 mRNA CTD PMID:38568856 Taldo1 Rat sodium arsenite multiple interactions ISO RGD:733188 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Taldo1 Rat sodium chloride multiple interactions ISO RGD:733188 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ... CTD PMID:38598786 Taldo1 Rat sodium dichromate affects expression EXP 6480464 sodium bichromate affects the expression of TALDO1 mRNA CTD PMID:22110744 Taldo1 Rat sodium dichromate increases expression ISO RGD:733189 6480464 sodium bichromate results in increased expression of TALDO1 mRNA CTD PMID:31558096 Taldo1 Rat sodium dodecyl sulfate decreases expression ISO RGD:733188 6480464 Sodium Dodecyl Sulfate results in decreased expression of TALDO1 protein CTD PMID:21469165 Taldo1 Rat sulforaphane increases expression ISO RGD:733188 6480464 sulforaphane results in increased expression of TALDO1 mRNA CTD PMID:31838189 Taldo1 Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of TALDO1 protein CTD PMID:26141394 Taldo1 Rat tetrachloromethane affects expression ISO RGD:733189 6480464 Carbon Tetrachloride affects the expression of TALDO1 mRNA CTD PMID:17484886 Taldo1 Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of TALDO1 mRNA CTD PMID:28943392 Taldo1 Rat titanium dioxide increases methylation ISO RGD:733189 6480464 titanium dioxide results in increased methylation of TALDO1 promoter CTD PMID:35295148 Taldo1 Rat Tributyltin oxide increases expression ISO RGD:733189 6480464 bis(tri-n-butyltin)oxide results in increased expression of TALDO1 mRNA CTD PMID:18958704 Taldo1 Rat triphenyl phosphate affects expression ISO RGD:733188 6480464 triphenyl phosphate affects the expression of TALDO1 mRNA CTD PMID:37042841 Taldo1 Rat triptonide increases expression ISO RGD:733189 6480464 triptonide results in increased expression of TALDO1 mRNA CTD PMID:33045310 Taldo1 Rat troglitazone increases expression ISO RGD:733189 6480464 troglitazone results in increased expression of TALDO1 mRNA CTD PMID:12732648 Taldo1 Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of TALDO1 mRNA CTD PMID:25596134 Taldo1 Rat uranium atom affects expression ISO RGD:733188 6480464 Uranium affects the expression of TALDO1 mRNA CTD PMID:15672453 Taldo1 Rat valproic acid increases methylation ISO RGD:733188 6480464 Valproic Acid results in increased methylation of TALDO1 gene CTD PMID:29154799 Taldo1 Rat valproic acid increases expression ISO RGD:733188 6480464 Valproic Acid results in increased expression of TALDO1 mRNA CTD PMID:23179753|PMID:26272509 Taldo1 Rat valproic acid affects expression ISO RGD:733188 6480464 Valproic Acid affects the expression of TALDO1 mRNA CTD PMID:25979313 Taldo1 Rat valproic acid multiple interactions ISO RGD:733188 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of TALDO1 mRNA; [NOG protein co-treated more ... CTD PMID:17183730|PMID:27188386 Taldo1 Rat vorinostat increases expression ISO RGD:733188 6480464 vorinostat results in increased expression of TALDO1 protein CTD PMID:20543569 Taldo1 Rat zearalenone decreases expression ISO RGD:733189 6480464 Zearalenone results in decreased expression of TALDO1 protein CTD PMID:25058043
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2,6-dimethoxyphenol (ISO) 2-acetamidofluorene (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) actinomycin D (ISO) ADP (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) amphetamine (EXP) anthra[1,9-cd]pyrazol-6(2H)-one (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) ATP (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) beta-naphthoflavone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bleomycin A2 (EXP) Brodifacoum (EXP) cadmium dichloride (EXP,ISO) captan (ISO) carbon nanotube (ISO) chloroacetaldehyde (ISO) cidofovir anhydrous (ISO) cisplatin (ISO) clofibrate (ISO) cocaine (EXP) copper(II) chloride (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) curcumin (EXP) cyclosporin A (EXP,ISO) D-ribofuranose 5-phosphate (ISO) D-xylulose 5-phosphate (ISO) diarsenic trioxide (ISO) diethylstilbestrol (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) endosulfan (EXP) enzyme inhibitor (ISO) fenofibrate (EXP) fenthion (ISO) flutamide (EXP) folic acid (ISO) folpet (ISO) furfural (ISO) gentamycin (EXP) glutathione (ISO) hydralazine (ISO) hydroquinone (ISO) ibuprofen (EXP) ifosfamide (ISO) inulin (ISO) isotretinoin (ISO) ivermectin (ISO) lead diacetate (ISO) lipopolysaccharide (ISO) Macrosphelide A (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) metformin (EXP) methapyrilene (ISO) methidathion (ISO) microcystin RR (ISO) N-acetyl-L-cysteine (ISO) N-nitrosodiethylamine (EXP) NAD zwitterion (ISO) NAD(+) (ISO) NADP zwitterion (ISO) NADP(+) (ISO) nitric oxide (ISO) Nutlin-3 (ISO) paracetamol (EXP,ISO) paraquat (EXP) parathion (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) quercetin (ISO) resveratrol (ISO) ribitol (ISO) rotenone (EXP,ISO) SB 431542 (ISO) selenium atom (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium dichromate (EXP,ISO) sodium dodecyl sulfate (ISO) sulforaphane (ISO) T-2 toxin (EXP) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) Tributyltin oxide (ISO) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (EXP,ISO) uranium atom (ISO) valproic acid (ISO) vorinostat (ISO) zearalenone (ISO)
1.
The pentose phosphate pathway in the endoplasmic reticulum.
Bublitz C and Steavenson S, J Biol Chem. 1988 Sep 15;263(26):12849-53.
2.
The interdependence of glycolytic and pentose cycle intermediates in ad libitum fed rats.
Casazza JP and Veech RL, J Biol Chem. 1986 Jan 15;261(2):690-8.
3.
Exchange reactions catalyzed by group-transferring enzymes oppose the quantitation and the unravelling of the identify of the pentose pathway.
Flanigan I, etal., Eur J Biochem. 1993 Apr 1;213(1):477-85.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
11.
GOA pipeline
RGD automated data pipeline
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Comprehensive gene review and curation
RGD comprehensive gene curation
15.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
16.
A humble hexose monophosphate pathway metabolite regulates short- and long-term control of lipogenesis.
Veech RL Proc Natl Acad Sci U S A. 2003 May 13;100(10):5578-80. Epub 2003 Apr 29.
17.
Transaldolase deficiency: liver cirrhosis associated with a new inborn error in the pentose phosphate pathway.
Verhoeven NM, etal., Am J Hum Genet. 2001 May;68(5):1086-92. Epub 2001 Mar 27.
Taldo1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 205,923,196 - 205,933,526 (+) NCBI GRCr8 mRatBN7.2 1 196,493,634 - 196,503,965 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 196,493,589 - 196,503,974 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 204,839,159 - 204,849,489 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 211,967,918 - 211,978,015 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 204,642,055 - 204,652,153 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 214,375,555 - 214,385,886 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 214,375,515 - 214,385,885 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 221,292,669 - 221,302,999 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 201,582,856 - 201,593,187 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 201,737,566 - 201,747,896 (+) NCBI Celera 1 194,127,362 - 194,137,466 (+) NCBI Celera Cytogenetic Map 1 q41 NCBI
TALDO1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 747,464 - 765,012 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 747,415 - 765,012 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 747,464 - 765,012 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 737,432 - 755,024 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 737,431 - 755,023 NCBI Celera 11 815,308 - 828,130 (+) NCBI Celera Cytogenetic Map 11 p15.5 NCBI HuRef 11 564,412 - 581,950 (+) NCBI HuRef CHM1_1 11 746,369 - 763,851 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 798,942 - 816,524 (+) NCBI T2T-CHM13v2.0
Taldo1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 140,972,073 - 140,982,889 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 140,972,112 - 140,982,881 (+) Ensembl GRCm39 Ensembl GRCm38 7 141,392,160 - 141,402,976 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 141,392,199 - 141,402,968 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 148,578,059 - 148,588,875 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 141,243,531 - 141,254,288 (+) NCBI MGSCv36 mm8 Celera 7 141,185,913 - 141,196,721 (+) NCBI Celera Cytogenetic Map 7 F5 NCBI cM Map 7 86.73 NCBI
Taldo1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955476 11,356,603 - 11,364,259 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955476 11,356,601 - 11,364,573 (-) NCBI ChiLan1.0 ChiLan1.0
TALDO1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 3,144,559 - 3,162,555 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 2,354,981 - 2,372,634 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 764,864 - 782,548 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 809,751 - 826,744 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 809,751 - 826,744 (+) Ensembl panpan1.1 panPan2
TALDO1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 25,764,138 - 25,772,043 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 25,436,609 - 25,444,516 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 26,372,292 - 26,380,192 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 26,372,286 - 26,380,960 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 25,881,807 - 25,889,713 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 25,526,824 - 25,534,713 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 26,139,191 - 26,147,099 (+) NCBI UU_Cfam_GSD_1.0
Taldo1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
TALDO1 (Sus scrofa - pig)
TALDO1 (Chlorocebus sabaeus - green monkey)
Taldo1 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 45 Count of miRNA genes: 35 Interacting mature miRNAs: 43 Transcripts: ENSRNOT00000024863 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1359018 Hrtrt20 Heart rate QTL 20 3.08 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 185356336 202902618 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 631260 Tcas2 Tongue tumor susceptibility QTL 2 4.93 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 192485903 199050587 Rat 619614 Bp78 Blood pressure QTL 78 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 169112897 197261052 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 6480780 Insul18 Insulin level QTL 18 4.11 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 189607473 200611765 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024863 ⟹ ENSRNOP00000024863
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 196,493,589 - 196,503,965 (+) Ensembl Rnor_6.0 Ensembl 1 214,375,515 - 214,385,885 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000097714 ⟹ ENSRNOP00000090500
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 196,497,410 - 196,503,974 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000111177 ⟹ ENSRNOP00000081672
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 196,493,625 - 196,503,965 (+) Ensembl
RefSeq Acc Id:
NM_031811 ⟹ NP_113999
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 205,923,196 - 205,933,526 (+) NCBI mRatBN7.2 1 196,493,634 - 196,503,965 (+) NCBI Rnor_6.0 1 214,375,555 - 214,385,886 (+) NCBI Rnor_5.0 1 221,292,669 - 221,302,999 (+) NCBI RGSC_v3.4 1 201,582,856 - 201,593,187 (+) RGD Celera 1 194,127,362 - 194,137,466 (+) RGD
Sequence:
GTGCGCGTTTCGCCATGTCGGGGTCCCCGGTAAAACGCCAGAGGATGGAGTCCGCCTTGGACCAGCTCAAGCAGTTCACCACCGTGGTGGCTGACACGGGTGATTTCAACGCCATCGATGAGTACAAG CCCCAGGATGCCACCACCAACCCATCCCTGATCCTGGCTGCAGCACAGATGCCTGCCTACCAAGAGCTGGTGGAGGAGGCCATTGCCTACGGCAAGAAGCTGGGTGGGCCACAAGAGGAGCAGATTAA AAATGCCATTGATAAACTTTTTGTGCTGTTTGGGGCAGAAATACTAAAGAAGATTCCAGGCCGTGTATCCACAGAAGTCGATGCAAGGCTTTCCTTTGATAAGGATGCCATGGTGGCCCGAGCCAGGC GCATCATAGAGCTTTACAAAGAAGCTGGGATCAGCAAGGACAGAATTCTCATCAAGTTATCATCAACCTGGGAGGGAATCCAGGCCGGAAAGGAGCTGGAGGAGCAGCATGGCATCCACTGCAACATG ACACTGCTTTTCTCCTTCGCCCAGGCCGTGGCCTGCGCTGAAGCGGGCGTGACGCTCATCTCTCCCTTTGTGGGGCGCATCCTTGACTGGCATGTGGCAAACACAGACAAGAAATCCTACGAACCCCA GGAGGACCCTGGGGTGAAGAGTGTCACAAAAATCTACAACTACTACAAAAAGTTTGGCTACAAGACCATTGTCATGGGTGCTTCCTTCCGTAACACGGGTGAGATCAAAGCGCTGGCAGGCTGTGATT TCCTCACCATCTCACCCAAGCTTCTGGGGGAGCTGCTCAAGGACAGCAGCAAGCTGGCACCCACGCTTTCCGTCAAAGCAGCCCAGACCAGTGACTTGGAGAAGATACATCTGGACGAGAAGGCCTTC CGTTGGCTGCACAATGAGGACCAAATGGCTGTGGAGAAGCTCTCTGATGGGATCCGCAAGTTTGCTGCTGATGCCATAAAGTTGGAGCGGATGCTCACAGAACGAATGTTCAGCGCTGAGAATGGGAA ATAGTGCAGCACCTGAGGCTGGACCGCAGACCTGCACTGCCTTCGAGGGGTCCGAATCGCACATGGCTTGTAACGAATGAATCTTGCATTTTTTAGTGATCAGAAGGGAAGGATTATAGGATTCTGAT TTCATGTGAAATTTTGTCTAATTCATTAAAGCAGTCGCTTTTCCTAAAAAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_113999 ⟸ NM_031811
- UniProtKB:
Q6PCV1 (UniProtKB/Swiss-Prot), Q9EQS0 (UniProtKB/Swiss-Prot), A6HXV3 (UniProtKB/TrEMBL), A6HXV4 (UniProtKB/TrEMBL)
- Sequence:
MSGSPVKRQRMESALDQLKQFTTVVADTGDFNAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGKKLGGPQEEQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRIIEL YKEAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPQEDPGVKSVTKIYNYYKKFGYKTIVMGASFRNTGEIKALAGCDFLTIS PKLLGELLKDSSKLAPTLSVKAAQTSDLEKIHLDEKAFRWLHNEDQMAVEKLSDGIRKFAADAIKLERMLTERMFSAENGK
hide sequence
Ensembl Acc Id:
ENSRNOP00000024863 ⟸ ENSRNOT00000024863
Ensembl Acc Id:
ENSRNOP00000081672 ⟸ ENSRNOT00000111177
Ensembl Acc Id:
ENSRNOP00000090500 ⟸ ENSRNOT00000097714
RGD ID: 13690542
Promoter ID: EPDNEW_R1066
Type: initiation region
Name: Taldo1_1
Description: transaldolase 1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 214,375,524 - 214,375,584 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Taldo1
transaldolase 1
Symbol and Name status set to approved
1299863
APPROVED
2002-08-07
Taldo1
transaldolase 1
Symbol and Name status set to provisional
70820
PROVISIONAL