Symbol:
Map2k6
Name:
mitogen-activated protein kinase kinase 6
RGD ID:
620666
Description:
Enables MAP kinase kinase activity. Involved in several processes, including cellular response to sorbitol; positive regulation of prostaglandin secretion; and response to ischemia. Predicted to be located in nucleoplasm. Predicted to be active in cytosol. Human ortholog(s) of this gene implicated in Pick's disease; cervical cancer; ovarian carcinoma; progressive supranuclear palsy; and restrictive cardiomyopathy. Orthologous to human MAP2K6 (mitogen-activated protein kinase kinase 6); PARTICIPATES IN p38 MAPK signaling pathway; adenosine signaling pathway; cardiomyopathy pathway; INTERACTS WITH (S)-nicotine; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
dual specificity mitogen-activated protein kinase kinase 6; MGC93287; Mkk6
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 95,872,747 - 95,987,747 (+) NCBI GRCr8 mRatBN7.2 10 95,373,304 - 95,490,406 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 95,373,204 - 95,488,293 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 100,429,713 - 100,544,144 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 99,892,740 - 100,007,172 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 95,301,015 - 95,415,445 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 98,707,160 - 98,823,054 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 98,706,960 - 98,823,287 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 98,413,927 - 98,527,709 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 99,859,684 - 99,974,446 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 99,873,953 - 99,989,003 (+) NCBI Celera 10 94,024,106 - 94,137,678 (+) NCBI Celera Cytogenetic Map 10 q32.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Map2k6 Rat (-)-alpha-phellandrene increases expression ISO MAP2K6 (Homo sapiens) 6480464 alpha phellandrene results in increased expression of MAP2K6 mRNA CTD PMID:25075043 Map2k6 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of MAP2K6 mRNA CTD PMID:22079256 Map2k6 Rat (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of MAP2K6 mRNA CTD PMID:20426880 Map2k6 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 o and p'-DDT promotes the reaction [MAP2K6 protein results in increased activity of CREBBP protein] CTD PMID:22609851 Map2k6 Rat 1,2-dimethylhydrazine decreases expression ISO Map2k6 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of MAP2K6 mRNA CTD PMID:22206623 Map2k6 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of MAP2K6 mRNA CTD PMID:15834898 Map2k6 Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of MAP2K6 mRNA CTD PMID:26865667 Map2k6 Rat 17beta-estradiol multiple interactions ISO Map2k6 (Mus musculus) 6480464 ESR1 protein promotes the reaction [Estradiol results in decreased expression of MAP2K6 mRNA] CTD PMID:25210133 Map2k6 Rat 17beta-estradiol decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Estradiol results in decreased expression of MAP2K6 mRNA CTD PMID:31614463 Map2k6 Rat 17beta-estradiol multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of MAP2K6 mRNA and [Progesterone co-treated with Estradiol] results in increased expression of MAP2K6 mRNA CTD PMID:17404688 and PMID:30165855 Map2k6 Rat 17beta-estradiol decreases expression ISO Map2k6 (Mus musculus) 6480464 Estradiol results in decreased expression of MAP2K6 mRNA CTD PMID:25210133 and PMID:39298647 Map2k6 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Map2k6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MAP2K6 mRNA CTD PMID:14708085 Map2k6 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO MAP2K6 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of MAP2K6 mRNA CTD PMID:22574217 Map2k6 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Map2k6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MAP2K6 mRNA CTD PMID:21570461 and PMID:28922406 Map2k6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MAP2K6 mRNA CTD PMID:21215274 and PMID:33387578 Map2k6 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein alternative form inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of MAP2K6 mRNA] CTD PMID:21215274 Map2k6 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO MAP2K6 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Map2k6 Rat 2-nitrofluorene decreases expression EXP 6480464 2-nitrofluorene results in decreased expression of MAP2K6 mRNA CTD PMID:22484513 Map2k6 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Map2k6 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Map2k6 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Map2k6 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of MAP2K6 mRNA CTD PMID:26251327 Map2k6 Rat 3,4-methylenedioxymethamphetamine increases methylation ISO Map2k6 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased methylation of MAP2K6 promoter CTD PMID:26251327 Map2k6 Rat 4,4'-diaminodiphenylmethane increases expression ISO Map2k6 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of MAP2K6 mRNA CTD PMID:18648102 Map2k6 Rat 4,4'-sulfonyldiphenol decreases expression ISO Map2k6 (Mus musculus) 6480464 bisphenol S results in decreased expression of MAP2K6 mRNA CTD PMID:39298647 Map2k6 Rat 4-hydroxyphenyl retinamide multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [Fenretinide results in increased phosphorylation of MAP2K6 protein] CTD PMID:16407847 Map2k6 Rat 4-hydroxyphenyl retinamide increases phosphorylation ISO MAP2K6 (Homo sapiens) 6480464 Fenretinide results in increased phosphorylation of MAP2K6 protein CTD PMID:16407847 Map2k6 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MAP2K6 mRNA CTD PMID:30047161 Map2k6 Rat afimoxifene decreases response to substance ISO MAP2K6 (Homo sapiens) 6480464 MAP2K6 results in decreased susceptibility to afimoxifene CTD PMID:21233418 Map2k6 Rat aflatoxin B1 affects expression ISO MAP2K6 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of MAP2K6 protein CTD PMID:20106945 Map2k6 Rat aflatoxin B1 decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of MAP2K6 mRNA CTD PMID:21632981 more ... Map2k6 Rat aflatoxin B1 increases methylation ISO MAP2K6 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of MAP2K6 gene CTD PMID:27153756 Map2k6 Rat aldehydo-D-glucose multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [MAP2K6 gene mutant form results in increased activity of MAP2K6 protein] which results in increased susceptibility to Glucose CTD PMID:27278863 Map2k6 Rat all-trans-retinoic acid decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Tretinoin results in decreased expression of MAP2K6 mRNA CTD PMID:21934132 Map2k6 Rat all-trans-retinoic acid increases expression ISO MAP2K6 (Homo sapiens) 6480464 Tretinoin results in increased expression of MAP2K6 mRNA CTD PMID:33167477 Map2k6 Rat alpha-phellandrene increases expression ISO MAP2K6 (Homo sapiens) 6480464 alpha phellandrene results in increased expression of MAP2K6 mRNA CTD PMID:25075043 Map2k6 Rat amino acid multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [MAP2K6 gene mutant form results in increased activity of MAP2K6 protein] which results in increased susceptibility to Amino Acids CTD PMID:27278863 Map2k6 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MAP2K6 mRNA CTD PMID:16483693 Map2k6 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of MAP2K6 mRNA CTD PMID:30779732 Map2k6 Rat andrographolide multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 andrographolide inhibits the reaction [VEGFA protein results in increased phosphorylation of MAP2K6 protein] CTD PMID:24814888 Map2k6 Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 pyrazolanthrone inhibits the reaction [[MAP2K6 gene mutant form results in increased activity of MAP2K6 protein] which results in increased susceptibility to Tetradecanoylphorbol Acetate] CTD PMID:27278863 Map2k6 Rat antirheumatic drug increases expression ISO MAP2K6 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of MAP2K6 mRNA CTD PMID:24449571 Map2k6 Rat aristolochic acid A decreases expression ISO MAP2K6 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of MAP2K6 mRNA CTD PMID:33212167 Map2k6 Rat arsane affects methylation ISO MAP2K6 (Homo sapiens) 6480464 Arsenic affects the methylation of MAP2K6 gene CTD PMID:25304211 Map2k6 Rat arsane multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MAP2K6 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of MAP2K6 mRNA CTD PMID:39836092 Map2k6 Rat arsane decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Arsenic results in decreased expression of MAP2K6 mRNA CTD PMID:29248574 Map2k6 Rat arsenic atom affects methylation ISO MAP2K6 (Homo sapiens) 6480464 Arsenic affects the methylation of MAP2K6 gene CTD PMID:25304211 Map2k6 Rat arsenic atom multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MAP2K6 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of MAP2K6 mRNA CTD PMID:39836092 Map2k6 Rat arsenic atom decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Arsenic results in decreased expression of MAP2K6 mRNA CTD PMID:29248574 Map2k6 Rat arsenite(3-) increases expression ISO Map2k6 (Mus musculus) 6480464 arsenite results in increased expression of MAP2K6 mRNA CTD PMID:18191166 Map2k6 Rat arsenous acid decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of MAP2K6 mRNA CTD PMID:26705709 Map2k6 Rat arsenous acid multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 Arsenic Trioxide results in increased phosphorylation of and results in increased activity of MAP2K6 protein CTD PMID:16818652 Map2k6 Rat arsenous acid multiple interactions ISO Map2k6 (Mus musculus) 6480464 MAP2K6 protein promotes the reaction [Arsenic Trioxide results in increased phosphorylation of and results in increased activity of MAPK14 protein] CTD PMID:16818652 Map2k6 Rat arsenous acid affects response to substance ISO Map2k6 (Mus musculus) 6480464 MAP2K6 protein affects the susceptibility to Arsenic Trioxide CTD PMID:16818652 Map2k6 Rat atazanavir sulfate multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [Atazanavir Sulfate co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of MAP2K6 mRNA CTD PMID:32152650 Map2k6 Rat atazanavir sulfate decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Atazanavir Sulfate results in decreased expression of MAP2K6 mRNA CTD PMID:32152650 Map2k6 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of MAP2K6 gene CTD PMID:28931070 Map2k6 Rat azathioprine decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Azathioprine results in decreased expression of MAP2K6 mRNA CTD PMID:22623647 Map2k6 Rat benzene decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Benzene results in decreased expression of MAP2K6 mRNA CTD PMID:33064461 Map2k6 Rat benzene increases expression ISO Map2k6 (Mus musculus) 6480464 Benzene results in increased expression of MAP2K6 mRNA CTD PMID:34624356 Map2k6 Rat benzene-1,2,4-triol decreases expression ISO MAP2K6 (Homo sapiens) 6480464 hydroxyhydroquinone results in decreased expression of MAP2K6 mRNA CTD PMID:39245080 Map2k6 Rat benzo[a]pyrene decreases expression ISO Map2k6 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of MAP2K6 mRNA CTD PMID:19770486 and PMID:21569818 Map2k6 Rat benzo[a]pyrene decreases methylation ISO Map2k6 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of MAP2K6 intron CTD PMID:27901495 Map2k6 Rat benzo[a]pyrene decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of MAP2K6 mRNA CTD PMID:20106945 more ... Map2k6 Rat benzo[a]pyrene affects expression ISO MAP2K6 (Homo sapiens) 6480464 Benzo(a)pyrene affects the expression of MAP2K6 mRNA CTD PMID:21714911 Map2k6 Rat beta-D-glucan decreases expression ISO MAP2K6 (Homo sapiens) 6480464 beta-Glucans results in decreased expression of MAP2K6 mRNA CTD PMID:25970150 Map2k6 Rat bis(2-chloroethyl) sulfide increases phosphorylation ISO MAP2K6 (Homo sapiens) 6480464 Mustard Gas results in increased phosphorylation of MAP2K6 protein CTD PMID:15251176 Map2k6 Rat bis(2-chloroethyl) sulfide affects expression EXP 6480464 Mustard Gas affects the expression of MAP2K6 mRNA CTD PMID:15651846 Map2k6 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Map2k6 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of MAP2K6 mRNA CTD PMID:19850644 Map2k6 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of MAP2K6 gene CTD PMID:33872906 Map2k6 Rat bis(2-ethylhexyl) phthalate decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of MAP2K6 mRNA CTD PMID:31163220 Map2k6 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Map2k6 (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in decreased expression of MAP2K6 mRNA] CTD PMID:19850644 Map2k6 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of MAP2K6 mRNA CTD PMID:25181051 Map2k6 Rat bisphenol A multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of MAP2K6 gene CTD PMID:31601247 Map2k6 Rat bortezomib decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Bortezomib results in decreased expression of MAP2K6 mRNA CTD PMID:20977926 Map2k6 Rat bromoacetate decreases expression ISO MAP2K6 (Homo sapiens) 6480464 bromoacetate results in decreased expression of MAP2K6 mRNA CTD PMID:19753638 Map2k6 Rat cadmium dichloride multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of MAP2K6 mRNA and Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased phosphorylation of MAP2K6 protein] CTD PMID:12634122 and PMID:18703135 Map2k6 Rat cadmium dichloride increases expression ISO MAP2K6 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of MAP2K6 mRNA CTD PMID:32512071 Map2k6 Rat cadmium dichloride increases phosphorylation EXP 6480464 Cadmium Chloride results in increased phosphorylation of MAP2K6 protein CTD PMID:18021293 and PMID:18703135 Map2k6 Rat cadmium dichloride multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased phosphorylation of MAP2K6 protein] CTD PMID:18703135 Map2k6 Rat cadmium dichloride increases phosphorylation ISO MAP2K6 (Homo sapiens) 6480464 Cadmium Chloride results in increased phosphorylation of MAP2K6 protein CTD PMID:18703135 Map2k6 Rat cannabidiol affects methylation EXP 6480464 Cannabidiol affects the methylation of MAP2K6 gene CTD PMID:30521419 Map2k6 Rat carbamazepine affects expression ISO MAP2K6 (Homo sapiens) 6480464 Carbamazepine affects the expression of MAP2K6 mRNA CTD PMID:24752500 Map2k6 Rat carbon nanotube decreases expression ISO Map2k6 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of MAP2K6 mRNA CTD PMID:25554681 and PMID:25620056 Map2k6 Rat CGP 52608 multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to MAP2K6 gene] CTD PMID:28238834 Map2k6 Rat chenodeoxycholic acid multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [Atazanavir Sulfate co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of MAP2K6 mRNA more ... CTD PMID:32152650 and PMID:33819548 Map2k6 Rat cisplatin affects response to substance ISO MAP2K6 (Homo sapiens) 6480464 MAP2K6 protein affects the susceptibility to Cisplatin CTD PMID:16217747 Map2k6 Rat cisplatin increases expression ISO MAP2K6 (Homo sapiens) 6480464 Cisplatin results in increased expression of MAP2K6 mRNA CTD PMID:27392435 Map2k6 Rat cisplatin multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 Cisplatin promotes the reaction [jinfukang results in increased expression of MAP2K6 mRNA] and jinfukang promotes the reaction [Cisplatin results in increased expression of MAP2K6 mRNA] CTD PMID:27392435 Map2k6 Rat cisplatin multiple interactions EXP 6480464 trichostatin A inhibits the reaction [Cisplatin results in decreased expression of MAP2K6 mRNA] CTD PMID:23558232 Map2k6 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of MAP2K6 mRNA CTD PMID:23558232 Map2k6 Rat cisplatin decreases response to substance EXP 6480464 MAP2K6 protein results in decreased susceptibility to Cisplatin CTD PMID:19578154 Map2k6 Rat copper atom multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of MAP2K6 mRNA more ... CTD PMID:20971185 more ... Map2k6 Rat copper(0) multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of MAP2K6 mRNA more ... CTD PMID:20971185 more ... Map2k6 Rat copper(II) sulfate decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of MAP2K6 mRNA CTD PMID:19549813 Map2k6 Rat corn oil affects expression EXP 6480464 Corn Oil affects the expression of MAP2K6 mRNA CTD PMID:16360708 Map2k6 Rat crocidolite asbestos decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of MAP2K6 mRNA CTD PMID:18687144 Map2k6 Rat cyclosporin A decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of MAP2K6 mRNA CTD PMID:20106945 more ... Map2k6 Rat cyclosporin A multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of MAP2K6 mRNA CTD PMID:32152650 Map2k6 Rat cyclosporin A increases expression ISO MAP2K6 (Homo sapiens) 6480464 Cyclosporine results in increased expression of MAP2K6 mRNA CTD PMID:27989131 Map2k6 Rat D-glucose multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [MAP2K6 gene mutant form results in increased activity of MAP2K6 protein] which results in increased susceptibility to Glucose CTD PMID:27278863 Map2k6 Rat DDT multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 MAP2K6 protein promotes the reaction [DDT results in increased activity of NOTCH1 protein] CTD PMID:18791200 Map2k6 Rat deoxycholic acid multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [Atazanavir Sulfate co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of MAP2K6 mRNA more ... CTD PMID:32152650 and PMID:33819548 Map2k6 Rat deoxynivalenol multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 AG 1879 inhibits the reaction [deoxynivalenol results in increased phosphorylation of MAP2K6 protein] CTD PMID:20181660 Map2k6 Rat deoxynivalenol increases phosphorylation ISO MAP2K6 (Homo sapiens) 6480464 deoxynivalenol results in increased phosphorylation of MAP2K6 protein CTD PMID:20181660 Map2k6 Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of MAP2K6 mRNA CTD PMID:20032058 Map2k6 Rat dexamethasone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of MAP2K6 mRNA] CTD PMID:20032058 Map2k6 Rat diarsenic trioxide multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 Arsenic Trioxide results in increased phosphorylation of and results in increased activity of MAP2K6 protein CTD PMID:16818652 Map2k6 Rat diarsenic trioxide multiple interactions ISO Map2k6 (Mus musculus) 6480464 MAP2K6 protein promotes the reaction [Arsenic Trioxide results in increased phosphorylation of and results in increased activity of MAPK14 protein] CTD PMID:16818652 Map2k6 Rat diarsenic trioxide decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of MAP2K6 mRNA CTD PMID:26705709 Map2k6 Rat diarsenic trioxide affects response to substance ISO Map2k6 (Mus musculus) 6480464 MAP2K6 protein affects the susceptibility to Arsenic Trioxide CTD PMID:16818652 Map2k6 Rat dibenz[a,h]anthracene increases expression ISO Map2k6 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Map2k6 Rat dibutyl phthalate decreases expression ISO Map2k6 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of MAP2K6 mRNA CTD PMID:21266533 Map2k6 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of MAP2K6 mRNA CTD PMID:21266533 Map2k6 Rat dichloroacetic acid decreases expression ISO Map2k6 (Mus musculus) 6480464 Dichloroacetic Acid results in decreased expression of MAP2K6 mRNA CTD PMID:28962523 Map2k6 Rat dichromium trioxide multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of MAP2K6 mRNA CTD PMID:12634122 Map2k6 Rat diclofenac affects expression ISO MAP2K6 (Homo sapiens) 6480464 Diclofenac affects the expression of MAP2K6 mRNA CTD PMID:24752500 Map2k6 Rat dicrotophos decreases expression ISO MAP2K6 (Homo sapiens) 6480464 dicrotophos results in decreased expression of MAP2K6 mRNA CTD PMID:28302478 Map2k6 Rat Didecyldimethylammonium decreases expression ISO MAP2K6 (Homo sapiens) 6480464 didecyldimethylammonium results in decreased expression of MAP2K6 mRNA CTD PMID:32763356 Map2k6 Rat disodium selenite decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of MAP2K6 mRNA CTD PMID:16705456 Map2k6 Rat disodium selenite increases expression ISO MAP2K6 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of MAP2K6 mRNA CTD PMID:18175754 Map2k6 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of MAP2K6 mRNA CTD PMID:21551480 Map2k6 Rat dorsomorphin multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Map2k6 Rat doxorubicin affects activity ISO MAP2K6 (Homo sapiens) 6480464 Doxorubicin affects the activity of MAP2K6 protein CTD PMID:15870702 Map2k6 Rat doxorubicin affects methylation EXP 6480464 Doxorubicin affects the methylation of MAP2K6 gene CTD PMID:28962528 Map2k6 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of MAP2K6 mRNA CTD PMID:29391264 Map2k6 Rat entinostat decreases expression ISO MAP2K6 (Homo sapiens) 6480464 entinostat results in decreased expression of MAP2K6 mRNA CTD PMID:26272509 Map2k6 Rat epoxiconazole decreases expression ISO Map2k6 (Mus musculus) 6480464 epoxiconazole results in decreased expression of MAP2K6 mRNA CTD PMID:35436446 Map2k6 Rat ethanol affects expression ISO Map2k6 (Mus musculus) 6480464 Ethanol affects the expression of MAP2K6 mRNA CTD PMID:30319688 Map2k6 Rat filipin III multiple interactions EXP 6480464 Filipin inhibits the reaction [ferrous sulfate promotes the reaction [MAP3K7 protein results in increased phosphorylation of MAP2K6 protein]] more ... CTD PMID:17172471 Map2k6 Rat folic acid decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Folic Acid results in decreased expression of MAP2K6 mRNA CTD PMID:21867686 Map2k6 Rat FR900359 increases phosphorylation ISO MAP2K6 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of MAP2K6 protein CTD PMID:37730182 Map2k6 Rat fulvestrant multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of MAP2K6 gene and MAP2K6 promotes the reaction [Fulvestrant results in decreased expression of GJA1 protein] CTD PMID:29180066 and PMID:31601247 Map2k6 Rat gemcitabine increases phosphorylation ISO MAP2K6 (Homo sapiens) 6480464 Gemcitabine results in increased phosphorylation of MAP2K6 protein CTD PMID:15003513 Map2k6 Rat genistein decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Genistein results in decreased expression of MAP2K6 mRNA CTD PMID:26865667 Map2k6 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of MAP2K6 mRNA CTD PMID:33387578 Map2k6 Rat glucose multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [MAP2K6 gene mutant form results in increased activity of MAP2K6 protein] which results in increased susceptibility to Glucose CTD PMID:27278863 Map2k6 Rat glycochenodeoxycholic acid multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [Atazanavir Sulfate co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of MAP2K6 mRNA more ... CTD PMID:32152650 and PMID:33819548 Map2k6 Rat glycocholic acid multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [Atazanavir Sulfate co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of MAP2K6 mRNA more ... CTD PMID:32152650 and PMID:33819548 Map2k6 Rat glycodeoxycholic acid multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [Atazanavir Sulfate co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of MAP2K6 mRNA more ... CTD PMID:32152650 and PMID:33819548 Map2k6 Rat glyphosate decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Glyphosate results in decreased expression of MAP2K6 mRNA CTD PMID:31295307 Map2k6 Rat hydrogen peroxide affects expression ISO MAP2K6 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of MAP2K6 mRNA CTD PMID:20044591 Map2k6 Rat iron atom multiple interactions EXP 6480464 Filipin inhibits the reaction [Iron promotes the reaction [MAP3K7 protein results in increased phosphorylation of MAP2K6 protein]] more ... CTD PMID:17172471 Map2k6 Rat iron atom increases phosphorylation EXP 6480464 Iron results in increased phosphorylation of MAP2K6 protein CTD PMID:17172471 Map2k6 Rat iron dichloride decreases expression ISO MAP2K6 (Homo sapiens) 6480464 ferrous chloride results in decreased expression of MAP2K6 mRNA CTD PMID:35984750 Map2k6 Rat iron(0) multiple interactions EXP 6480464 Filipin inhibits the reaction [Iron promotes the reaction [MAP3K7 protein results in increased phosphorylation of MAP2K6 protein]] more ... CTD PMID:17172471 Map2k6 Rat iron(0) increases phosphorylation EXP 6480464 Iron results in increased phosphorylation of MAP2K6 protein CTD PMID:17172471 Map2k6 Rat iron(2+) sulfate (anhydrous) multiple interactions EXP 6480464 ferrous sulfate promotes the reaction [MAP3K7 protein results in increased phosphorylation of MAP2K6 protein] more ... CTD PMID:17172471 Map2k6 Rat iron(2+) sulfate (anhydrous) increases phosphorylation EXP 6480464 ferrous sulfate results in increased phosphorylation of MAP2K6 protein CTD PMID:17172471 Map2k6 Rat L-ascorbic acid multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [Fenretinide results in increased phosphorylation of MAP2K6 protein] CTD PMID:16407847 Map2k6 Rat lead diacetate multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of MAP2K6 mRNA CTD PMID:12634122 Map2k6 Rat lipopolysaccharide multiple interactions ISO Map2k6 (Mus musculus) 6480464 IRAK2 protein promotes the reaction [Lipopolysaccharides results in increased activity of MAP2K6 protein] CTD PMID:21291324 Map2k6 Rat lipopolysaccharide increases activity ISO Map2k6 (Mus musculus) 6480464 Lipopolysaccharides results in increased activity of MAP2K6 protein CTD PMID:21291324 Map2k6 Rat lycopene decreases expression ISO MAP2K6 (Homo sapiens) 6480464 lycopene results in decreased expression of MAP2K6 protein CTD PMID:17337101 Map2k6 Rat maneb multiple interactions ISO Map2k6 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of MAP2K6 mRNA more ... CTD PMID:23963992 Map2k6 Rat manganese atom multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MAP2K6 mRNA CTD PMID:39836092 Map2k6 Rat manganese(0) multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MAP2K6 mRNA CTD PMID:39836092 Map2k6 Rat manganese(II) chloride multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MAP2K6 mRNA CTD PMID:39836092 Map2k6 Rat melatonin multiple interactions ISO Map2k6 (Mus musculus) 6480464 Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in increased expression of MAP2K6 mRNA] CTD PMID:23963992 Map2k6 Rat mercury dibromide decreases expression ISO MAP2K6 (Homo sapiens) 6480464 mercuric bromide results in decreased expression of MAP2K6 mRNA CTD PMID:26272509 Map2k6 Rat mercury dibromide multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MAP2K6 mRNA CTD PMID:27188386 Map2k6 Rat mercury dichloride decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Mercuric Chloride results in decreased expression of MAP2K6 mRNA CTD PMID:27188386 Map2k6 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of MAP2K6 mRNA CTD PMID:30047161 Map2k6 Rat methotrexate affects response to substance ISO MAP2K6 (Homo sapiens) 6480464 MAP2K6 protein affects the susceptibility to Methotrexate CTD PMID:16217747 Map2k6 Rat methotrexate decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Methotrexate results in decreased expression of MAP2K6 mRNA CTD PMID:19100307 Map2k6 Rat methylmercury chloride decreases expression ISO MAP2K6 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of MAP2K6 mRNA CTD PMID:26272509 and PMID:28001369 Map2k6 Rat mevinphos increases phosphorylation EXP 6480464 Mevinphos results in increased phosphorylation of MAP2K6 protein CTD PMID:23157661 Map2k6 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of MAP2K6 gene CTD PMID:33872906 Map2k6 Rat mono(2-ethylhexyl) phthalate decreases expression ISO MAP2K6 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of MAP2K6 mRNA CTD PMID:36695872 Map2k6 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of MAP2K6 gene CTD PMID:33148267 Map2k6 Rat N-acetyl-L-cysteine multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased phosphorylation of MAP2K6 protein] CTD PMID:18703135 Map2k6 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased phosphorylation of MAP2K6 protein] CTD PMID:18703135 Map2k6 Rat N-methyl-4-phenylpyridinium multiple interactions EXP 6480464 CIB1 protein inhibits the reaction [1-Methyl-4-phenylpyridinium results in increased phosphorylation of MAP2K6 protein] CTD PMID:28939911 Map2k6 Rat N-methyl-4-phenylpyridinium increases phosphorylation EXP 6480464 1-Methyl-4-phenylpyridinium results in increased phosphorylation of MAP2K6 protein CTD PMID:28939911 Map2k6 Rat nefazodone multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of MAP2K6 mRNA CTD PMID:32152650 Map2k6 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of MAP2K6 mRNA CTD PMID:22110744 Map2k6 Rat nickel dichloride increases response to substance ISO Map2k6 (Mus musculus) 6480464 MAP2K6 protein results in increased susceptibility to nickel chloride CTD PMID:21544193 Map2k6 Rat nickel dichloride multiple interactions ISO Map2k6 (Mus musculus) 6480464 [incomplete Freund's adjuvant co-treated with Freund's Adjuvant co-treated with nickel chloride] results in increased expression of MAP2K6 mRNA more ... CTD PMID:21544193 and PMID:23536762 Map2k6 Rat nicotine increases expression EXP 6480464 Nicotine results in increased expression of MAP2K6 mRNA CTD PMID:20426880 Map2k6 Rat Nonylphenol increases expression ISO MAP2K6 (Homo sapiens) 6480464 nonylphenol results in increased expression of MAP2K6 protein CTD PMID:24039973 Map2k6 Rat obeticholic acid decreases expression ISO MAP2K6 (Homo sapiens) 6480464 obeticholic acid results in decreased expression of MAP2K6 mRNA CTD PMID:27939613 Map2k6 Rat organoselenium compound multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [Organoselenium Compounds binds to Copper] which results in decreased expression of MAP2K6 mRNA CTD PMID:25167922 Map2k6 Rat ouabain increases expression ISO MAP2K6 (Homo sapiens) 6480464 Ouabain results in increased expression of MAP2K6 mRNA CTD PMID:28795476 Map2k6 Rat ozone multiple interactions ISO Map2k6 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of MAP2K6 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of MAP2K6 mRNA CTD PMID:34911549 Map2k6 Rat p-chloromercuribenzoic acid decreases expression ISO MAP2K6 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of MAP2K6 mRNA CTD PMID:26272509 Map2k6 Rat p-chloromercuribenzoic acid multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MAP2K6 mRNA CTD PMID:27188386 Map2k6 Rat p-menthan-3-ol decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Menthol results in decreased expression of MAP2K6 mRNA CTD PMID:26760959 Map2k6 Rat panobinostat multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MAP2K6 mRNA CTD PMID:27188386 Map2k6 Rat paracetamol affects expression ISO Map2k6 (Mus musculus) 6480464 Acetaminophen affects the expression of MAP2K6 mRNA CTD PMID:17562736 Map2k6 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of MAP2K6 mRNA CTD PMID:33387578 Map2k6 Rat paracetamol multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of MAP2K6 mRNA CTD PMID:33819548 Map2k6 Rat paracetamol decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MAP2K6 mRNA CTD PMID:29067470 Map2k6 Rat paraquat multiple interactions ISO Map2k6 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of MAP2K6 mRNA more ... CTD PMID:23963992 Map2k6 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of MAP2K6 mRNA CTD PMID:32680482 Map2k6 Rat parathion increases expression ISO Map2k6 (Mus musculus) 6480464 Parathion results in increased expression of MAP2K6 mRNA CTD PMID:34813904 Map2k6 Rat perfluorohexanesulfonic acid decreases expression ISO Map2k6 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of MAP2K6 mRNA CTD PMID:37995155 Map2k6 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of MAP2K6 gene CTD PMID:33148267 Map2k6 Rat phenobarbital increases expression ISO Map2k6 (Mus musculus) 6480464 Phenobarbital results in increased expression of MAP2K6 mRNA CTD PMID:19270015 Map2k6 Rat phenobarbital affects expression ISO Map2k6 (Mus musculus) 6480464 Phenobarbital affects the expression of MAP2K6 mRNA CTD PMID:23091169 Map2k6 Rat phenylmercury acetate decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of MAP2K6 mRNA CTD PMID:26272509 Map2k6 Rat phenylmercury acetate multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MAP2K6 mRNA CTD PMID:27188386 Map2k6 Rat phlorizin increases expression ISO Map2k6 (Mus musculus) 6480464 Phlorhizin results in increased expression of MAP2K6 mRNA CTD PMID:22538082 Map2k6 Rat phorbol 13-acetate 12-myristate multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [MAP2K6 gene mutant form results in increased activity of MAP2K6 protein] which results in increased susceptibility to Tetradecanoylphorbol Acetate more ... CTD PMID:27278863 Map2k6 Rat piperonyl butoxide decreases expression EXP 6480464 Piperonyl Butoxide results in decreased expression of MAP2K6 mRNA CTD PMID:22484513 Map2k6 Rat pirinixic acid multiple interactions ISO Map2k6 (Mus musculus) 6480464 [pirinixic acid co-treated with PPARA] results in decreased expression of MAP2K6 mRNA CTD PMID:20813756 Map2k6 Rat pirinixic acid decreases expression ISO Map2k6 (Mus musculus) 6480464 pirinixic acid results in decreased expression of MAP2K6 mRNA CTD PMID:20813756 and PMID:23811191 Map2k6 Rat potassium chromate multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of MAP2K6 mRNA CTD PMID:22079256 Map2k6 Rat potassium chromate decreases expression ISO MAP2K6 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of MAP2K6 mRNA CTD PMID:22079256 Map2k6 Rat progesterone multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [Progesterone co-treated with Estradiol] results in increased expression of MAP2K6 mRNA CTD PMID:17404688 Map2k6 Rat progesterone increases expression ISO MAP2K6 (Homo sapiens) 6480464 Progesterone results in increased expression of MAP2K6 mRNA CTD PMID:17404688 Map2k6 Rat Ptaquiloside decreases expression ISO MAP2K6 (Homo sapiens) 6480464 ptaquiloside results in decreased expression of MAP2K6 mRNA CTD PMID:22143989 Map2k6 Rat quercetin increases expression ISO MAP2K6 (Homo sapiens) 6480464 Quercetin results in increased expression of MAP2K6 mRNA CTD PMID:27514524 Map2k6 Rat quercetin decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Quercetin results in decreased expression of MAP2K6 mRNA CTD PMID:21632981 Map2k6 Rat raloxifene multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 MAP2K6 protein promotes the reaction [Raloxifene Hydrochloride results in increased expression of HMOX1 protein] CTD PMID:20888885 Map2k6 Rat ritodrine increases expression ISO Map2k6 (Mus musculus) 6480464 Ritodrine results in increased expression of MAP2K6 mRNA CTD PMID:23370008 Map2k6 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of MAP2K6 mRNA CTD PMID:28374803 Map2k6 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO MAP2K6 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of MAP2K6 mRNA CTD PMID:33725128 Map2k6 Rat Salinomycin multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [salinomycin co-treated with tanespimycin] inhibits the reaction [MAP2K6 protein results in increased expression of TYMP mRNA] and [salinomycin co-treated with tanespimycin] inhibits the reaction [MAP2K6 protein results in increased expression of TYMP protein] CTD PMID:30796972 Map2k6 Rat SB 203580 multiple interactions EXP 6480464 SB 203580 inhibits the reaction [MAP2K6 protein results in decreased expression of EP300 protein] CTD PMID:15767673 Map2k6 Rat SB 203580 multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 SB 203580 inhibits the reaction [[MAP2K6 gene mutant form results in increased activity of MAP2K6 protein] which results in increased susceptibility to Tetradecanoylphorbol Acetate] CTD PMID:27278863 Map2k6 Rat SB 431542 multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Map2k6 Rat Securinine decreases expression ISO MAP2K6 (Homo sapiens) 6480464 securinine results in decreased expression of MAP2K6 mRNA CTD PMID:32662633 Map2k6 Rat sevoflurane increases phosphorylation ISO MAP2K6 (Homo sapiens) 6480464 sevoflurane results in increased phosphorylation of MAP2K6 protein CTD PMID:18349187 Map2k6 Rat silicon dioxide decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of MAP2K6 mRNA and Silicon Dioxide results in decreased expression of MAP2K6 mRNA CTD PMID:22300531 and PMID:25895662 Map2k6 Rat sodium arsenite multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MAP2K6 mRNA more ... CTD PMID:12634122 more ... Map2k6 Rat sodium arsenite increases expression ISO MAP2K6 (Homo sapiens) 6480464 sodium arsenite results in increased expression of MAP2K6 mRNA CTD PMID:17879257 Map2k6 Rat sodium dichromate affects expression EXP 6480464 sodium bichromate affects the expression of MAP2K6 mRNA CTD PMID:22110744 Map2k6 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of MAP2K6 mRNA CTD PMID:19281266 Map2k6 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of MAP2K6 mRNA CTD PMID:25905778 Map2k6 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of MAP2K6 mRNA CTD PMID:30047161 Map2k6 Rat sulfates multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [Soot co-treated with Sulfates] affects the methylation of MAP2K6 promoter CTD PMID:25395096 Map2k6 Rat sulforaphane decreases expression ISO MAP2K6 (Homo sapiens) 6480464 sulforaphane results in decreased expression of MAP2K6 mRNA CTD PMID:26833863 and PMID:31838189 Map2k6 Rat Sunset Yellow FCF multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in increased expression of MAP2K6 mRNA CTD PMID:33819548 Map2k6 Rat tanespimycin multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [salinomycin co-treated with tanespimycin] inhibits the reaction [MAP2K6 protein results in increased expression of TYMP mRNA] and [salinomycin co-treated with tanespimycin] inhibits the reaction [MAP2K6 protein results in increased expression of TYMP protein] CTD PMID:30796972 Map2k6 Rat tartrazine multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Tartrazine] results in decreased expression of MAP2K6 mRNA CTD PMID:33819548 Map2k6 Rat tert-butyl hydroperoxide increases phosphorylation ISO MAP2K6 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased phosphorylation of MAP2K6 protein CTD PMID:17003459 Map2k6 Rat testosterone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of MAP2K6 mRNA] CTD PMID:20032058 Map2k6 Rat tetrachloromethane decreases expression ISO Map2k6 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of MAP2K6 mRNA CTD PMID:31919559 Map2k6 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of MAP2K6 mRNA CTD PMID:23411599 and PMID:34492290 Map2k6 Rat thiram decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Thiram results in decreased expression of MAP2K6 mRNA CTD PMID:38568856 Map2k6 Rat trichostatin A increases expression EXP 6480464 trichostatin A results in increased expression of MAP2K6 mRNA CTD PMID:23558232 Map2k6 Rat trichostatin A multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MAP2K6 mRNA CTD PMID:27188386 Map2k6 Rat trichostatin A decreases expression ISO MAP2K6 (Homo sapiens) 6480464 trichostatin A results in decreased expression of MAP2K6 mRNA CTD PMID:24935251 and PMID:26272509 Map2k6 Rat trichostatin A increases expression ISO MAP2K6 (Homo sapiens) 6480464 trichostatin A results in increased expression of MAP2K6 mRNA CTD PMID:24935251 Map2k6 Rat trichostatin A multiple interactions EXP 6480464 trichostatin A inhibits the reaction [Cisplatin results in decreased expression of MAP2K6 mRNA] CTD PMID:23558232 Map2k6 Rat triclosan multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Triclosan] results in decreased expression of MAP2K6 mRNA CTD PMID:33819548 Map2k6 Rat trimethyltin decreases expression ISO Map2k6 (Mus musculus) 6480464 trimethyltin results in decreased expression of MAP2K6 mRNA CTD PMID:21435392 Map2k6 Rat Triptolide decreases expression ISO Map2k6 (Mus musculus) 6480464 triptolide results in decreased expression of MAP2K6 mRNA CTD PMID:32835833 Map2k6 Rat tris(2-butoxyethyl) phosphate affects expression ISO MAP2K6 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of MAP2K6 mRNA CTD PMID:29024780 Map2k6 Rat troglitazone decreases expression ISO MAP2K6 (Homo sapiens) 6480464 troglitazone results in decreased expression of MAP2K6 mRNA CTD PMID:19140230 Map2k6 Rat trovafloxacin decreases expression ISO Map2k6 (Mus musculus) 6480464 trovafloxacin results in decreased expression of MAP2K6 mRNA CTD PMID:35537566 Map2k6 Rat urethane decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Urethane results in decreased expression of MAP2K6 mRNA CTD PMID:28818685 Map2k6 Rat valproic acid increases expression ISO MAP2K6 (Homo sapiens) 6480464 Valproic Acid results in increased expression of MAP2K6 mRNA CTD PMID:24935251 and PMID:29154799 Map2k6 Rat valproic acid multiple interactions ISO MAP2K6 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MAP2K6 mRNA CTD PMID:27188386 Map2k6 Rat valproic acid decreases expression ISO MAP2K6 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of MAP2K6 mRNA CTD PMID:23179753 more ... Map2k6 Rat vanadium atom increases expression ISO MAP2K6 (Homo sapiens) 6480464 Vanadium results in increased expression of MAP2K6 mRNA CTD PMID:19000753 Map2k6 Rat vanadium(0) increases expression ISO MAP2K6 (Homo sapiens) 6480464 Vanadium results in increased expression of MAP2K6 mRNA CTD PMID:19000753
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-alpha-phellandrene (ISO) (-)-epigallocatechin 3-gallate (ISO) (S)-nicotine (EXP) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-nitrofluorene (EXP) 3,3',4,4'-tetrachlorobiphenyl (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) afimoxifene (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) alpha-phellandrene (ISO) amino acid (ISO) ammonium chloride (EXP) amphetamine (EXP) andrographolide (ISO) anthra[1,9-cd]pyrazol-6(2H)-one (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atazanavir sulfate (ISO) atrazine (EXP) azathioprine (ISO) benzene (ISO) benzene-1,2,4-triol (ISO) benzo[a]pyrene (ISO) beta-D-glucan (ISO) bis(2-chloroethyl) sulfide (EXP,ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bortezomib (ISO) bromoacetate (ISO) cadmium dichloride (EXP,ISO) cannabidiol (EXP) carbamazepine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chenodeoxycholic acid (ISO) cisplatin (EXP,ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) corn oil (EXP) crocidolite asbestos (ISO) cyclosporin A (ISO) D-glucose (ISO) DDT (ISO) deoxycholic acid (ISO) deoxynivalenol (ISO) dexamethasone (EXP) diarsenic trioxide (ISO) dibenz[a,h]anthracene (ISO) dibutyl phthalate (EXP,ISO) dichloroacetic acid (ISO) dichromium trioxide (ISO) diclofenac (ISO) dicrotophos (ISO) Didecyldimethylammonium (ISO) disodium selenite (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (EXP,ISO) endosulfan (EXP) entinostat (ISO) epoxiconazole (ISO) ethanol (ISO) filipin III (EXP) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) gemcitabine (ISO) genistein (ISO) gentamycin (EXP) glucose (ISO) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) glyphosate (ISO) hydrogen peroxide (ISO) iron atom (EXP) iron dichloride (ISO) iron(0) (EXP) iron(2+) sulfate (anhydrous) (EXP) L-ascorbic acid (ISO) lead diacetate (ISO) lipopolysaccharide (ISO) lycopene (ISO) maneb (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) melatonin (ISO) mercury dibromide (ISO) mercury dichloride (ISO) methimazole (EXP) methotrexate (ISO) methylmercury chloride (ISO) mevinphos (EXP) mono(2-ethylhexyl) phthalate (ISO) N,N-diethyl-m-toluamide (EXP) N-acetyl-L-cysteine (EXP,ISO) N-methyl-4-phenylpyridinium (EXP) nefazodone (ISO) nickel dichloride (EXP,ISO) nicotine (EXP) Nonylphenol (ISO) obeticholic acid (ISO) organoselenium compound (ISO) ouabain (ISO) ozone (ISO) p-chloromercuribenzoic acid (ISO) p-menthan-3-ol (ISO) panobinostat (ISO) paracetamol (EXP,ISO) paraquat (EXP,ISO) parathion (ISO) perfluorohexanesulfonic acid (ISO) permethrin (EXP) phenobarbital (ISO) phenylmercury acetate (ISO) phlorizin (ISO) phorbol 13-acetate 12-myristate (ISO) piperonyl butoxide (EXP) pirinixic acid (ISO) potassium chromate (ISO) progesterone (ISO) Ptaquiloside (ISO) quercetin (ISO) raloxifene (ISO) ritodrine (ISO) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) Salinomycin (ISO) SB 203580 (EXP,ISO) SB 431542 (ISO) Securinine (ISO) sevoflurane (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium dichromate (EXP) Soman (EXP) streptozocin (EXP) sulfadimethoxine (EXP) sulfates (ISO) sulforaphane (ISO) Sunset Yellow FCF (ISO) tanespimycin (ISO) tartrazine (ISO) tert-butyl hydroperoxide (ISO) testosterone (EXP) tetrachloromethane (ISO) thioacetamide (EXP) thiram (ISO) trichostatin A (EXP,ISO) triclosan (ISO) trimethyltin (ISO) Triptolide (ISO) tris(2-butoxyethyl) phosphate (ISO) troglitazone (ISO) trovafloxacin (ISO) urethane (ISO) valproic acid (ISO) vanadium atom (ISO) vanadium(0) (ISO)
1.
The MKK6-p38 MAPK pathway prolongs the cardiac contractile calcium transient, downregulates SERCA2, and activates NF-AT.
Andrews C, etal., Cardiovasc Res 2003 Jul 1;59(1):46-56.
2.
Targeted inhibition of p38 MAPK promotes hypertrophic cardiomyopathy through upregulation of calcineurin-NFAT signaling.
Braz JC, etal., J Clin Invest. 2003 May;111(10):1475-86. doi: 10.1172/JCI17295.
3.
Pro-life role for c-Jun N-terminal kinase and p38 mitogen-activated protein kinase at rostral ventrolateral medulla in experimental brain stem death.
Chang AY J Biomed Sci. 2012 Nov 17;19:96. doi: 10.1186/1423-0127-19-96.
4.
p38 MAP-kinases pathway regulation, function and role in human diseases.
Cuenda A and Rousseau S, Biochim Biophys Acta. 2007 Aug;1773(8):1358-75. Epub 2007 Mar 24.
5.
MAP kinase kinase 6-p38 MAP kinase signaling cascade regulates cyclooxygenase-2 expression in cardiac myocytes in vitro and in vivo.
Degousee N, etal., Circ Res. 2003 Apr 18;92(7):757-64. Epub 2003 Mar 20.
6.
The role of the MKK6/p38 MAPK pathway in Wip1-dependent regulation of ErbB2-driven mammary gland tumorigenesis.
Demidov ON, etal., Oncogene. 2007 Apr 12;26(17):2502-6. Epub 2006 Oct 2.
7.
Active kinase proteome screening reveals novel signal complexity in cardiomyopathy.
Fernando P, etal., Mol Cell Proteomics. 2005 May;4(5):673-82. Epub 2005 Feb 18.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
10.
Both p38alpha(MAPK) and JNK/SAPK pathways are important for induction of nitric-oxide synthase by interleukin-1beta in rat glomerular mesangial cells.
Guan Z, etal., J Biol Chem. 1999 Dec 17;274(51):36200-6.
11.
Activation of ASK1, downstream MAPKK and MAPK isoforms during cardiac ischaemia.
Harding SJ, etal., Biochim Biophys Acta. 2010 Sep;1802(9):733-40. doi: 10.1016/j.bbadis.2010.06.005. Epub 2010 Jun 13.
12.
The p38 pathway is activated in Pick disease and progressive supranuclear palsy: a mechanistic link between mitogenic pathways, oxidative stress, and tau.
Hartzler AW, etal., Neurobiol Aging. 2002 Sep-Oct;23(5):855-9.
13.
The p38 kinases MKK4 and MKK6 suppress metastatic colonization in human ovarian carcinoma.
Hickson JA, etal., Cancer Res. 2006 Feb 15;66(4):2264-70.
14.
Effects of sodium ferulate on amyloid-beta-induced MKK3/MKK6-p38 MAPK-Hsp27 signal pathway and apoptosis in rat hippocampus.
Jin Y, etal., Acta Pharmacol Sin. 2006 Oct;27(10):1309-16.
15.
Targeted inhibition of p38 mitogen-activated protein kinase antagonizes cardiac injury and cell death following ischemia-reperfusion in vivo.
Kaiser RA, etal., J Biol Chem. 2004 Apr 9;279(15):15524-30. Epub 2004 Jan 28.
16.
p38 MAPK and MAPK kinase 3/6 mRNA and activities are increased in early diabetic glomeruli.
Kang SW, etal., Kidney Int. 2001 Aug;60(2):543-52.
17.
p38 kinase is crucial for osteopontin-induced furin expression that supports cervical cancer progression.
Kumar V, etal., Cancer Res. 2010 Dec 15;70(24):10381-91. doi: 10.1158/0008-5472.CAN-10-1470. Epub 2010 Oct 27.
18.
The in vivo role of p38 MAP kinases in cardiac remodeling and restrictive cardiomyopathy.
Liao P, etal., Proc Natl Acad Sci U S A 2001 Oct 9;98(21):12283-8. Epub 2001 Oct 02.
19.
Up-regulation of MKK4, MKK6 and MKK7 during prostate cancer progression: an important role for SAPK signalling in prostatic neoplasia.
Lotan TL, etal., J Pathol. 2007 Aug;212(4):386-94.
20.
Developmental regulation of mitogen-activated protein kinase-activated kinases-2 and -3 (MAPKAPK-2/-3) in vivo during corpus luteum formation in the rat.
Maizels ET, etal., Mol Endocrinol. 2001 May;15(5):716-33.
21.
Overexpression of mitogen-activated protein kinase kinase 6 in the heart improves functional recovery from ischemia in vitro and protects against myocardial infarction in vivo.
Martindale JJ, etal., J Biol Chem. 2005 Jan 7;280(1):669-76. Epub 2004 Oct 18.
22.
MKK6 controls T3-mediated browning of white adipose tissue.
Matesanz N, etal., Nat Commun. 2017 Oct 11;8(1):856. doi: 10.1038/s41467-017-00948-z.
23.
Activation of TGF-beta1-TAK1-p38 MAPK pathway in spared cardiomyocytes is involved in left ventricular remodeling after myocardial infarction in rats.
Matsumoto-Ida M, etal., Am J Physiol Heart Circ Physiol. 2006 Feb;290(2):H709-15. Epub 2005 Sep 23.
24.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
25.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
26.
Role of MAP kinases and their cross-talk in TGF-beta1-induced apoptosis in FaO rat hepatoma cell line.
Park HJ, etal., Hepatology. 2002 Jun;35(6):1360-71.
27.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
28.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
29.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
30.
GOA pipeline
RGD automated data pipeline
31.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
32.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
33.
Comprehensive gene review and curation
RGD comprehensive gene curation
34.
Different effects of amlodipine and enalapril on the mitogen-activated protein kinase/extracellular signal-regulated kinase kinase-extracellular signal-regulated kinase pathway for induction of vascular smooth muscle cell differentiation in vivo.
Umemoto S, etal., Hypertens Res. 2006 Mar;29(3):179-86.
35.
Suppression of metastatic colonization by the context-dependent activation of the c-Jun NH2-terminal kinase kinases JNKK1/MKK4 and MKK7.
Vander Griend DJ, etal., Cancer Res. 2005 Dec 1;65(23):10984-91.
Map2k6 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 95,872,747 - 95,987,747 (+) NCBI GRCr8 mRatBN7.2 10 95,373,304 - 95,490,406 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 95,373,204 - 95,488,293 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 100,429,713 - 100,544,144 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 99,892,740 - 100,007,172 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 95,301,015 - 95,415,445 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 98,707,160 - 98,823,054 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 98,706,960 - 98,823,287 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 98,413,927 - 98,527,709 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 99,859,684 - 99,974,446 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 99,873,953 - 99,989,003 (+) NCBI Celera 10 94,024,106 - 94,137,678 (+) NCBI Celera Cytogenetic Map 10 q32.1 NCBI
MAP2K6 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 69,414,697 - 69,553,865 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 69,414,697 - 69,553,865 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 67,410,838 - 67,550,006 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 64,922,433 - 65,050,065 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 65,010,164 - 65,051,067 NCBI Celera 17 63,982,421 - 64,110,030 (+) NCBI Celera Cytogenetic Map 17 q24.3 NCBI HuRef 17 62,796,464 - 62,924,594 (+) NCBI HuRef CHM1_1 17 67,475,265 - 67,603,400 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 70,291,653 - 70,430,810 (+) NCBI T2T-CHM13v2.0
Map2k6 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 110,289,928 - 110,416,348 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 110,289,948 - 110,416,348 (+) Ensembl GRCm39 Ensembl GRCm38 11 110,399,102 - 110,525,522 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 110,399,122 - 110,525,522 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 110,260,436 - 110,374,951 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 110,215,212 - 110,329,727 (+) NCBI MGSCv36 mm8 Celera 11 122,139,172 - 122,253,133 (+) NCBI Celera Cytogenetic Map 11 E1- E2 NCBI cM Map 11 73.6 NCBI
Map2k6 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955478 3,331,607 - 3,448,842 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955478 3,331,607 - 3,448,840 (-) NCBI ChiLan1.0 ChiLan1.0
MAP2K6 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 85,434,352 - 85,573,837 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 90,255,171 - 90,400,452 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 63,342,720 - 63,483,926 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 68,730,011 - 68,870,713 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 68,730,011 - 68,870,454 (+) Ensembl panpan1.1 panPan2
MAP2K6 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 15,840,714 - 15,962,400 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 15,840,983 - 15,952,026 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 16,731,937 - 16,853,765 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 17,501,891 - 17,623,440 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 17,501,897 - 17,614,738 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 16,445,924 - 16,567,352 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 10,966,413 - 11,088,091 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 10,965,262 - 11,086,973 (-) NCBI UU_Cfam_GSD_1.0
MAP2K6 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 10,894,966 - 11,018,641 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 10,891,445 - 11,018,617 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 11,145,143 - 11,264,150 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MAP2K6 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 52,045,398 - 52,188,416 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 52,057,784 - 52,187,997 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 22,937,949 - 23,081,340 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Map2k6 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 54 Count of miRNA genes: 52 Interacting mature miRNAs: 53 Transcripts: ENSRNOT00000006217 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 1354641 Bvd2 Brain ventricular dilatation QTL 2 6.36 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 10 93223816 107057807 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 631558 Bp137 Blood pressure QTL 137 0.013 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 94724860 96836268 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 1579915 Bp280 Blood pressure QTL 280 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90404397 107211142 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 1300107 Rf18 Renal function QTL 18 3.41 urine output (VT:0003620) timed urine volume (CMO:0000260) 10 78775516 98279596 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 2317754 Glom25 Glomerulus QTL 25 3.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 82685200 107211142 Rat 70168 Eae12 Experimental allergic encephalomyelitis QTL 12 0.0009 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 92238497 101012337 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 10450493 Bp382 Blood pressure QTL 382 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 94759759 107211142 Rat 2313856 Bp342 Blood pressure QTL 342 4.4 0.0001 life span trait (VT:0005372) age at time of death (CMO:0001193) 10 87307617 96121100 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2292617 Ept18 Estrogen-induced pituitary tumorigenesis QTL 18 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 61363 Oia3 Oil induced arthritis QTL 3 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87307617 107211142 Rat 1357344 Bp249 Blood pressure QTL 249 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 66743655 98003205 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 724530 Bp149 Blood pressure QTL 149 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90627439 107211142 Rat 1300137 Bp186 Blood pressure QTL 186 3.57 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 10 90627439 107057807 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 6893357 Bw102 Body weight QTL 102 0.5 0.36 body mass (VT:0001259) body weight (CMO:0000012) 10 80515287 101325465 Rat 12880384 Cm107 Cardiac mass QTL 107 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 90404397 107211142 Rat 12880385 Cm108 Cardiac mass QTL 108 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 90404397 107211142 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 2303589 Bw87 Body weight QTL 87 2 body mass (VT:0001259) body weight (CMO:0000012) 10 81285008 107211142 Rat 12880396 Am13 Aortic mass QTL 13 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 90404397 107211142 Rat 12880398 Kidm67 Kidney mass QTL 67 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 90404397 107211142 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 12880395 Cm109 Cardiac mass QTL 109 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 10 90404397 107211142 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 634320 Niddm49 Non-insulin dependent diabetes mellitus QTL 49 4.41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 10 88539139 107211142 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 12880055 Am11 Aortic mass QTL 11 0.004 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 84007272 95933025 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 2301398 Kidm38 Kidney mass QTL 38 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 84007272 95933025 Rat 2292436 Bp310 Blood pressure QTL 310 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 94759759 107211142 Rat 1600367 Mcs15 Mammary carcinoma susceptibility QTL 15 4.5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 85565469 103884409 Rat 1358188 Ept9 Estrogen-induced pituitary tumorigenesis QTL 9 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 631538 Oia5 Oil induced arthritis QTL 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87055121 107211142 Rat 61436 Cia5 Collagen induced arthritis QTL 5 4.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 91228102 104060283 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
D10Mco69
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 95,953,412 - 95,953,648 (+) Marker Load Pipeline mRatBN7.2 10 95,453,982 - 95,454,218 (+) MAPPER mRatBN7.2 Rnor_6.0 10 98,787,961 - 98,788,196 NCBI Rnor6.0 Rnor_5.0 10 98,493,942 - 98,494,177 UniSTS Rnor5.0 RGSC_v3.4 10 99,939,315 - 99,939,551 RGD RGSC3.4 RGSC_v3.4 10 99,939,316 - 99,939,551 UniSTS RGSC3.4 RGSC_v3.1 10 99,953,685 - 99,953,921 RGD Celera 10 94,103,581 - 94,103,816 UniSTS Cytogenetic Map 10 q32.1 UniSTS
D10Chm249
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 95,445,008 - 95,445,251 (+) MAPPER mRatBN7.2 Rnor_6.0 10 98,778,986 - 98,779,229 NCBI Rnor6.0 Rnor_5.0 10 98,484,967 - 98,485,210 UniSTS Rnor5.0 RGSC_v3.4 10 99,930,342 - 99,930,584 UniSTS RGSC3.4 Celera 10 94,094,607 - 94,094,849 UniSTS Cytogenetic Map 10 q32.1 UniSTS
Map2k6
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 95,488,043 - 95,488,181 (+) MAPPER mRatBN7.2 Rnor_6.0 10 98,822,976 - 98,823,113 NCBI Rnor6.0 Rnor_5.0 10 98,527,631 - 98,527,768 UniSTS Rnor5.0 RGSC_v3.4 10 99,974,368 - 99,974,505 UniSTS RGSC3.4 Celera 10 94,137,600 - 94,137,737 UniSTS Cytogenetic Map 10 q32.1 UniSTS
UniSTS:224328
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 95,487,684 - 95,487,876 (+) MAPPER mRatBN7.2 Rnor_6.0 10 98,822,617 - 98,822,808 NCBI Rnor6.0 Rnor_5.0 10 98,527,272 - 98,527,463 UniSTS Rnor5.0 RGSC_v3.4 10 99,974,009 - 99,974,200 UniSTS RGSC3.4 Celera 10 94,137,241 - 94,137,432 UniSTS Cytogenetic Map 10 q32.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000006217 ⟹ ENSRNOP00000006217
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 95,373,204 - 95,488,293 (+) Ensembl Rnor_6.0 Ensembl 10 98,706,960 - 98,823,287 (+) Ensembl
RefSeq Acc Id:
NM_053703 ⟹ NP_446155
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 95,872,747 - 95,987,550 (+) NCBI mRatBN7.2 10 95,373,304 - 95,488,122 (+) NCBI Rnor_6.0 10 98,707,160 - 98,823,054 (+) NCBI Rnor_5.0 10 98,413,927 - 98,527,709 (+) NCBI RGSC_v3.4 10 99,859,684 - 99,974,446 (+) RGD Celera 10 94,024,106 - 94,137,678 (+) RGD
Sequence:
TGAAGATTGCACGCCTGCAGCTTGCATCTTTGTTGCAAAACTAGCTACAGAAGAGAAGCAAGGCAAAGTCTTTTGTGCTCCCCTCCCCCATCAAAGGAAAGGGGAAAATGTCTCAGTCGAAAGGCAAG AAGCGAAACCCCGGCCTTAAGATTCCAAGGGAAGCGTTTGAACAACCTCAGACCAGTTCCACGCCGCCTCGGGATTTAGACTCCAAGGCTTGCATTTCTATTGGAAACCAGAACTTTGAGGTGAAGGC CGATGACTTGGAGCCTATAGTGGAGCTGGGACGAGGTGCGTACGGGGTGGTGGAGAAGATGCGTCACGTGCCCAGCGGGCAGATCATGGCGGTGAAGCGGATACGGGCCACAGTTAATAGCCAGGAGC AGAAACGGCTACTGATGGATCTGGATGTTTCTATGAGGACAGTGGACTGTCCGTTTACCGTGACCTTCTATGGTGCACTCTTCCGGGAGGGCGATGTGTGGATCTGCATGGAGCTCATGGATACGTCA CTAGATAAATTCTACAAACAAGTTATTGATAAAGGCCAAACAATTCCAGAAGATATCTTAGGGAAGATAGCAGTTTCTATTGTAAAAGCATTAGAACATTTACACAGTAAGCTCTCTGTTATCCATCG AGATGTCAAGCCTTCAAATGTGCTCATTAACACGCTGGGCCAAGTGAAGATGTGTGACTTTGGAATCAGCGGCTACCTGGTAGACTCTGTTGCGAAAACGATCGATGCCGGTTGCAAACCATACATGG CTCCTGAACGAATAAATCCAGAGCTCAACCAGAAGGGGTACAGTGTGAAGTCTGACATTTGGAGTCTGGGCATCACCATGATTGAGCTGGCCATCCTCCGGTTTCCCTATGATTCTTGGGGAACGCCC TTCCAGCAGCTAAAACAGGTGGTAGAAGAGCCGTCTCCACAACTCCCAGCGGACAAGTTCTCTGCTGACTTCGTTGACTTTACCTCACAGTGCTTGAAGAAAAATTCCAAAGAACGGCCCACGTATCC AGAGCTTATGCAACATCCATTTTTCACCGTCCATGAAGCCAAAGCAGCAGATGTGGCGTCTTTCGTAAAACTGATACTCGGGGACTAAAAAGCCACGGACTTGACTGGTTGACCCTACTGTGGATTGG TGGGTTTACAGGGCGAAGTGAGTTCACCACAGCGCCAACAGAAAGTCATCTTGAGATCATTGAACCCTGCCTCTCTGAGGGGCTTCCTCTCCCTGTTTTTCTTTTTCCTCTCCGAAGGGGGCCTTGGA ATCTCTAGCGTAGGCTGAGCTCTCTATATGGATGAAATATGATAGAGGCTTAGGACTCGAAAAGGTGATAAAATATTTAATGGCGAGGCATACGAGGAGTCCTCAAGCCTCTGGGATCTCTCGTGTTC TTTACAAAATGAATGCATTGGCCCTGGTAACAAGGTGCTACAGTAGTTGACGAGATTGTAAAGTAGGTTCGTAGCGTATCCCACTTATTTTAATATTTATGTTTCAGTGCTTGGTTGGAAATATTCCA TTTTTATGCAAGAAGGGAGATACAGAGACAAGGCTGACTTGGCAGTGTTTATAGGGCTTTTATTTTTTAAGTTCAATCATGTCTGTGGTCCAGAGGAAGTTATTTAATATGCATCTTTAAGAATATTA TAAAAAAAAAATCTCAAGCAAAGGGG
hide sequence
RefSeq Acc Id:
XM_039085033 ⟹ XP_038940961
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 95,946,846 - 95,987,747 (+) NCBI mRatBN7.2 10 95,447,420 - 95,490,406 (+) NCBI
RefSeq Acc Id:
XM_039085034 ⟹ XP_038940962
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 95,873,037 - 95,987,747 (+) NCBI mRatBN7.2 10 95,382,182 - 95,490,406 (+) NCBI
RefSeq Acc Id:
NP_446155 ⟸ NM_053703
- UniProtKB:
Q925D6 (UniProtKB/TrEMBL), A6HKD4 (UniProtKB/TrEMBL), F7EK55 (UniProtKB/TrEMBL)
- Sequence:
MSQSKGKKRNPGLKIPREAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIVELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDVSMRTVDCPFTVTFYGALFREGDVWIC MELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFP YDSWGTPFQQLKQVVEEPSPQLPADKFSADFVDFTSQCLKKNSKERPTYPELMQHPFFTVHEAKAADVASFVKLILGD
hide sequence
Ensembl Acc Id:
ENSRNOP00000006217 ⟸ ENSRNOT00000006217
RefSeq Acc Id:
XP_038940962 ⟸ XM_039085034
- Peptide Label:
isoform X1
- UniProtKB:
A6HKD7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038940961 ⟸ XM_039085033
- Peptide Label:
isoform X1
- UniProtKB:
A6HKD7 (UniProtKB/TrEMBL)
RGD ID: 13697867
Promoter ID: EPDNEW_R8391
Type: multiple initiation site
Name: Map2k6_1
Description: mitogen-activated protein kinase kinase 6
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 98,707,000 - 98,707,060 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-01-20
Map2k6
mitogen-activated protein kinase kinase 6
Symbol and Name status set to approved
1299863
APPROVED
2002-08-07
Map2k6
mitogen-activated protein kinase kinase 6
Symbol and Name status set to provisional
70820
PROVISIONAL
Note Type
Note
Reference
gene_process
prolongs the decay phase of the cardiac contractile calcium by downregulating SERCA2, increasing diastolic [Ca2+]
724424