Symbol:
Xpo1
Name:
exportin 1
RGD ID:
620517
Description:
Enables DNA-binding transcription factor binding activity and protein domain specific binding activity. Involved in several processes, including cellular response to salt; cellular response to triglyceride; and protein export from nucleus. Predicted to be located in several cellular components, including annulate lamellae; kinetochore; and nucleus. Predicted to be part of ribonucleoprotein complex. Predicted to be active in cytoplasm and nucleus. Used to study hepatocellular carcinoma. Human ortholog(s) of this gene implicated in colorectal cancer; gastric adenocarcinoma; hepatocellular carcinoma; and lung non-small cell carcinoma. Orthologous to human XPO1 (exportin 1); PARTICIPATES IN CRM1 export pathway; Hedgehog signaling pathway; nuclear factor kappa B signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
chromosome region maintenance 1 protein homolog; exp1; exportin 1 (CRM1, yeast, homolog); exportin 1, CRM1 homolog; exportin 1, CRM1 homolog (yeast); exportin-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
XPO1 (exportin 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Xpo1 (exportin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Xpo1 (exportin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
XPO1 (exportin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
XPO1 (exportin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Xpo1 (exportin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
XPO1 (exportin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
XPO1 (exportin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Xpo1 (exportin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
LHX4 (LIM homeobox 4) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Xpo1 (exportin 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
XPO1 (exportin 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
xpo1b (exportin 1 (CRM1 homolog, yeast) b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
xpo1a (exportin 1 (CRM1 homolog, yeast) a)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
CRM1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
emb
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
xpo-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
xpo1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 101,434,450 - 101,476,705 (+) NCBI GRCr8 mRatBN7.2 14 97,233,282 - 97,275,536 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 97,233,270 - 97,275,498 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 101,571,539 - 101,607,053 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 102,815,887 - 102,851,401 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 99,287,455 - 99,322,969 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 108,007,421 - 108,049,088 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 108,007,724 - 108,049,660 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 108,082,784 - 108,124,516 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 103,943,249 - 103,978,717 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 103,962,459 - 103,997,928 (+) NCBI Celera 14 96,216,463 - 96,251,770 (+) NCBI Celera Cytogenetic Map 14 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Xpo1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO XPO1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of XPO1 mRNA CTD PMID:22079256 Xpo1 Rat (1->4)-beta-D-glucan multiple interactions ISO Xpo1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of XPO1 mRNA CTD PMID:36331819 Xpo1 Rat 1,2-dimethylhydrazine multiple interactions ISO Xpo1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of XPO1 mRNA CTD PMID:22206623 Xpo1 Rat 17beta-estradiol increases expression ISO XPO1 (Homo sapiens) 6480464 Estradiol results in increased expression of XPO1 mRNA CTD PMID:16514628 Xpo1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Xpo1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Xpo1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Xpo1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of XPO1 mRNA CTD PMID:19465110 Xpo1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of XPO1 mRNA CTD PMID:33387578 and PMID:34747641 Xpo1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Xpo1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of XPO1 mRNA CTD PMID:24680724 Xpo1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of XPO1 mRNA CTD PMID:21346803 Xpo1 Rat 2,6-dimethoxyphenol multiple interactions ISO XPO1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of and affects the localization of XPO1 protein CTD PMID:38598786 Xpo1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of XPO1 mRNA CTD PMID:21346803 Xpo1 Rat 2-methylcholine affects expression ISO XPO1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of XPO1 mRNA CTD PMID:21179406 Xpo1 Rat 4,4'-sulfonyldiphenol increases expression ISO Xpo1 (Mus musculus) 6480464 bisphenol S results in increased expression of XPO1 mRNA CTD PMID:39298647 Xpo1 Rat 4,4'-sulfonyldiphenol increases expression ISO XPO1 (Homo sapiens) 6480464 bisphenol S results in increased expression of XPO1 protein CTD PMID:34186270 Xpo1 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one decreases expression ISO XPO1 (Homo sapiens) 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in decreased expression of XPO1 protein CTD PMID:20421341 Xpo1 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of XPO1 mRNA CTD PMID:21346803 Xpo1 Rat aconitine decreases expression EXP 6480464 Aconitine results in decreased expression of XPO1 protein CTD PMID:33236894 Xpo1 Rat acrolein multiple interactions ISO XPO1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of XPO1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of XPO1 mRNA CTD PMID:32699268 Xpo1 Rat acrylamide increases expression ISO XPO1 (Homo sapiens) 6480464 Acrylamide results in increased expression of XPO1 mRNA CTD PMID:32763439 Xpo1 Rat afimoxifene decreases expression ISO XPO1 (Homo sapiens) 6480464 afimoxifene results in decreased expression of XPO1 mRNA CTD PMID:16514628 Xpo1 Rat aflatoxin B1 increases expression ISO Xpo1 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of XPO1 mRNA CTD PMID:19770486 Xpo1 Rat aflatoxin M1 decreases expression ISO XPO1 (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of XPO1 mRNA CTD PMID:30928695 Xpo1 Rat AICA ribonucleotide multiple interactions ISO XPO1 (Homo sapiens) 6480464 AICA ribonucleotide promotes the reaction [ABL1 protein mutant form binds to XPO1 protein] more ... CTD PMID:33070465 Xpo1 Rat all-trans-retinoic acid decreases expression ISO XPO1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of XPO1 mRNA CTD PMID:18614847 Xpo1 Rat alpha-pinene multiple interactions ISO XPO1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of XPO1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of XPO1 mRNA CTD PMID:32699268 Xpo1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of XPO1 mRNA CTD PMID:16483693 Xpo1 Rat aristolochic acid A decreases expression ISO XPO1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of XPO1 mRNA CTD PMID:33212167 Xpo1 Rat arsenous acid multiple interactions ISO XPO1 (Homo sapiens) 6480464 Arsenic Trioxide promotes the reaction [XPO1 protein binds to YWHAQ protein] CTD PMID:33070465 Xpo1 Rat aurantio-obtusin decreases expression ISO Xpo1 (Mus musculus) 6480464 aurantio-obtusin results in decreased expression of XPO1 mRNA CTD PMID:34718095 Xpo1 Rat benzo[a]pyrene affects methylation ISO XPO1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of XPO1 intron CTD PMID:30157460 Xpo1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO XPO1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 more ... Xpo1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of XPO1 mRNA CTD PMID:25181051 and PMID:30816183 Xpo1 Rat bisphenol A increases methylation ISO XPO1 (Homo sapiens) 6480464 bisphenol A results in increased methylation of XPO1 gene CTD PMID:31601247 Xpo1 Rat bisphenol A decreases expression ISO Xpo1 (Mus musculus) 6480464 bisphenol A results in decreased expression of XPO1 mRNA CTD PMID:33221593 Xpo1 Rat bisphenol A decreases expression ISO XPO1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of XPO1 protein CTD PMID:37567409 Xpo1 Rat bisphenol AF increases expression ISO XPO1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of XPO1 protein CTD PMID:34186270 Xpo1 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of XPO1 mRNA CTD PMID:24136188 Xpo1 Rat cadmium atom multiple interactions ISO Xpo1 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of XPO1 mRNA CTD PMID:37325564 Xpo1 Rat cadmium dichloride multiple interactions ISO Xpo1 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of XPO1 mRNA and XPO1 protein affects the reaction [Cadmium Chloride affects the localization of BACH1 protein] CTD PMID:14504288 and PMID:37325564 Xpo1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of XPO1 mRNA CTD PMID:33453195 Xpo1 Rat caffeine decreases phosphorylation ISO XPO1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of XPO1 protein CTD PMID:35688186 Xpo1 Rat calcitriol decreases expression ISO XPO1 (Homo sapiens) 6480464 Calcitriol results in decreased expression of XPO1 mRNA CTD PMID:16847355 and PMID:18614847 Xpo1 Rat cannabidiol multiple interactions ISO XPO1 (Homo sapiens) 6480464 [Cuprizone co-treated with Cannabidiol] results in decreased expression of XPO1 protein CTD PMID:34122009 Xpo1 Rat cannabidiol increases expression ISO XPO1 (Homo sapiens) 6480464 Cannabidiol results in increased expression of XPO1 mRNA CTD PMID:31801206 Xpo1 Rat chloropicrin increases expression ISO XPO1 (Homo sapiens) 6480464 chloropicrin results in increased expression of XPO1 mRNA CTD PMID:26352163 Xpo1 Rat chloroquine multiple interactions ISO XPO1 (Homo sapiens) 6480464 Chloroquine promotes the reaction [XPO1 protein binds to BECN1 protein] and Chloroquine promotes the reaction [XPO1 protein binds to YWHAQ protein] CTD PMID:33070465 Xpo1 Rat chlorpyrifos decreases expression ISO Xpo1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of XPO1 mRNA CTD PMID:37019170 Xpo1 Rat chlorpyrifos increases expression ISO Xpo1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of XPO1 mRNA CTD PMID:34289071 Xpo1 Rat ciguatoxin CTX1B affects expression ISO Xpo1 (Mus musculus) 6480464 Ciguatoxins affects the expression of XPO1 mRNA CTD PMID:18353800 Xpo1 Rat clofibrate increases expression ISO Xpo1 (Mus musculus) 6480464 Clofibrate results in increased expression of XPO1 mRNA CTD PMID:17585979 Xpo1 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of XPO1 mRNA CTD PMID:22465980 and PMID:30556269 Xpo1 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of XPO1 mRNA CTD PMID:22465980 and PMID:30556269 Xpo1 Rat corticosterone decreases expression EXP 6480464 Corticosterone results in decreased expression of XPO1 mRNA CTD PMID:15755911 Xpo1 Rat coumarin affects phosphorylation ISO XPO1 (Homo sapiens) 6480464 coumarin affects the phosphorylation of XPO1 protein CTD PMID:35688186 Xpo1 Rat crocidolite asbestos decreases expression ISO Xpo1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of XPO1 mRNA CTD PMID:29279043 Xpo1 Rat Cuprizon multiple interactions ISO XPO1 (Homo sapiens) 6480464 [Cuprizone co-treated with Cannabidiol] results in decreased expression of XPO1 protein CTD PMID:34122009 Xpo1 Rat curcumin multiple interactions ISO Xpo1 (Mus musculus) 6480464 Curcumin inhibits the reaction [KRAS protein results in decreased expression of XPO1 protein] CTD PMID:21519798 Xpo1 Rat diarsenic trioxide multiple interactions ISO XPO1 (Homo sapiens) 6480464 Arsenic Trioxide promotes the reaction [XPO1 protein binds to YWHAQ protein] CTD PMID:33070465 Xpo1 Rat Dibutyl phosphate affects expression ISO XPO1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of XPO1 mRNA CTD PMID:37042841 Xpo1 Rat dibutyl phthalate decreases expression ISO Xpo1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of XPO1 mRNA CTD PMID:21266533 Xpo1 Rat dicrotophos decreases expression ISO XPO1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of XPO1 mRNA CTD PMID:28302478 Xpo1 Rat doxorubicin multiple interactions EXP 6480464 Doxorubicin promotes the reaction [MIRLET7F-2 mRNA results in decreased expression of XPO1 mRNA] more ... CTD PMID:31570982 Xpo1 Rat doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of XPO1 mRNA and Doxorubicin results in decreased expression of XPO1 protein CTD PMID:31570982 Xpo1 Rat enzyme inhibitor multiple interactions ISO XPO1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of XPO1 protein CTD PMID:23301498 Xpo1 Rat ethanol affects expression ISO Xpo1 (Mus musculus) 6480464 Ethanol affects the expression of XPO1 mRNA CTD PMID:30319688 Xpo1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of XPO1 mRNA CTD PMID:24136188 Xpo1 Rat fluoxetine decreases expression EXP 6480464 Fluoxetine results in decreased expression of XPO1 mRNA CTD PMID:21852994 Xpo1 Rat fluoxetine increases expression EXP 6480464 Fluoxetine results in increased expression of XPO1 mRNA CTD PMID:21852994 Xpo1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of XPO1 mRNA CTD PMID:24136188 Xpo1 Rat folic acid multiple interactions ISO Xpo1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of XPO1 mRNA CTD PMID:22206623 Xpo1 Rat formaldehyde multiple interactions ISO XPO1 (Homo sapiens) 6480464 Formaldehyde affects the reaction [SET protein alternative form binds to XPO1 protein] CTD PMID:36534342 Xpo1 Rat fulvestrant decreases expression ISO XPO1 (Homo sapiens) 6480464 fulvestrant results in decreased expression of XPO1 mRNA CTD PMID:16514628 Xpo1 Rat furan increases expression EXP 6480464 furan results in increased expression of XPO1 mRNA CTD PMID:25539665 and PMID:26194646 Xpo1 Rat furfural multiple interactions ISO XPO1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of XPO1 protein CTD PMID:38598786 Xpo1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of XPO1 mRNA CTD PMID:33387578 Xpo1 Rat hydrogen peroxide affects expression ISO XPO1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of XPO1 mRNA CTD PMID:20044591 Xpo1 Rat ivermectin decreases expression ISO XPO1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of XPO1 protein CTD PMID:32959892 Xpo1 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of XPO1 mRNA CTD PMID:24136188 Xpo1 Rat leptomycin B multiple interactions ISO Xpo1 (Mus musculus) 6480464 [leptomycin B results in decreased activity of XPO1 protein] which results in decreased export of SMAD4 protein CTD PMID:26354774 Xpo1 Rat leptomycin B decreases activity ISO Xpo1 (Mus musculus) 6480464 leptomycin B results in decreased activity of XPO1 protein CTD PMID:26354774 Xpo1 Rat levofloxacin decreases expression EXP 6480464 Levofloxacin results in decreased expression of XPO1 mRNA CTD PMID:24136188 Xpo1 Rat menadione affects expression ISO XPO1 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of XPO1 mRNA CTD PMID:20044591 Xpo1 Rat methidathion decreases expression ISO Xpo1 (Mus musculus) 6480464 methidathion results in decreased expression of XPO1 mRNA CTD PMID:34813904 Xpo1 Rat methylparaben increases expression ISO XPO1 (Homo sapiens) 6480464 methylparaben results in increased expression of XPO1 mRNA CTD PMID:31745603 Xpo1 Rat miconazole decreases expression ISO Xpo1 (Mus musculus) 6480464 Miconazole results in decreased expression of XPO1 mRNA CTD PMID:27462272 Xpo1 Rat N-methyl-4-phenylpyridinium increases expression ISO XPO1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of XPO1 mRNA CTD PMID:24810058 Xpo1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of XPO1 mRNA CTD PMID:24136188 Xpo1 Rat nickel atom decreases expression ISO XPO1 (Homo sapiens) 6480464 Nickel results in decreased expression of XPO1 mRNA CTD PMID:23195993 Xpo1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of XPO1 mRNA CTD PMID:24136188 Xpo1 Rat nitrates multiple interactions ISO Xpo1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of XPO1 mRNA CTD PMID:35964746 Xpo1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of XPO1 mRNA CTD PMID:25729387 Xpo1 Rat ozone multiple interactions ISO XPO1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of XPO1 mRNA more ... CTD PMID:32699268 Xpo1 Rat paclitaxel decreases expression ISO XPO1 (Homo sapiens) 6480464 Paclitaxel results in decreased expression of XPO1 mRNA CTD PMID:15000894 Xpo1 Rat paracetamol affects expression ISO Xpo1 (Mus musculus) 6480464 Acetaminophen affects the expression of XPO1 mRNA CTD PMID:17562736 Xpo1 Rat perfluorohexanesulfonic acid increases expression ISO Xpo1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of XPO1 mRNA CTD PMID:37995155 Xpo1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Xpo1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of XPO1 mRNA CTD PMID:36331819 Xpo1 Rat phenobarbital affects expression ISO XPO1 (Homo sapiens) 6480464 Phenobarbital affects the expression of XPO1 mRNA CTD PMID:19159669 Xpo1 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of XPO1 mRNA CTD PMID:15215175 Xpo1 Rat potassium chromate decreases expression ISO XPO1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of XPO1 mRNA CTD PMID:22079256 Xpo1 Rat potassium chromate multiple interactions ISO XPO1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of XPO1 mRNA CTD PMID:22079256 Xpo1 Rat potassium dichromate affects expression ISO Xpo1 (Mus musculus) 6480464 Potassium Dichromate affects the expression of XPO1 mRNA CTD PMID:23608068 Xpo1 Rat propiconazole increases expression ISO Xpo1 (Mus musculus) 6480464 propiconazole results in increased expression of XPO1 mRNA CTD PMID:21278054 Xpo1 Rat quercetin decreases expression ISO XPO1 (Homo sapiens) 6480464 Quercetin results in decreased expression of XPO1 mRNA CTD PMID:21632981 Xpo1 Rat raloxifene decreases expression ISO XPO1 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in decreased expression of XPO1 mRNA CTD PMID:16514628 Xpo1 Rat resveratrol decreases expression ISO Xpo1 (Mus musculus) 6480464 resveratrol results in decreased expression of XPO1 protein CTD PMID:25505154 Xpo1 Rat sodium arsenite decreases expression ISO Xpo1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of XPO1 mRNA and sodium arsenite results in decreased expression of XPO1 protein CTD PMID:32991915 Xpo1 Rat sodium arsenite decreases expression ISO XPO1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of XPO1 mRNA CTD PMID:38568856 Xpo1 Rat sodium arsenite multiple interactions ISO Xpo1 (Mus musculus) 6480464 [sodium arsenite binds to ID3 protein] promotes the reaction [XPO1 protein affects the localization of ID3 protein] CTD PMID:23523789 Xpo1 Rat sodium chloride multiple interactions ISO XPO1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of XPO1 protein more ... CTD PMID:38598786 Xpo1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of XPO1 mRNA CTD PMID:25993096 Xpo1 Rat sulindac multiple interactions EXP 6480464 [Sulindac co-treated with lipopolysaccharide and E coli O55-B5] affects the expression of XPO1 mRNA CTD PMID:20371263 Xpo1 Rat tetrachloromethane increases expression ISO Xpo1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of XPO1 mRNA CTD PMID:27339419 Xpo1 Rat tetrachloromethane affects expression ISO Xpo1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of XPO1 mRNA CTD PMID:31919559 Xpo1 Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of XPO1 protein CTD PMID:35544339 Xpo1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of XPO1 mRNA CTD PMID:23411599 and PMID:34492290 Xpo1 Rat titanium dioxide decreases expression ISO Xpo1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of XPO1 mRNA CTD PMID:29264374 Xpo1 Rat titanium dioxide decreases methylation ISO Xpo1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of XPO1 gene and titanium dioxide results in decreased methylation of XPO1 promoter CTD PMID:35295148 Xpo1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of XPO1 mRNA CTD PMID:25729387 Xpo1 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of XPO1 gene CTD PMID:27618143 Xpo1 Rat trichostatin A affects expression ISO XPO1 (Homo sapiens) 6480464 trichostatin A affects the expression of XPO1 mRNA CTD PMID:28542535 Xpo1 Rat triphenyl phosphate affects expression ISO XPO1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of XPO1 mRNA CTD PMID:37042841 Xpo1 Rat triptonide increases expression ISO Xpo1 (Mus musculus) 6480464 triptonide results in increased expression of XPO1 mRNA CTD PMID:33045310 Xpo1 Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of XPO1 mRNA CTD PMID:24136188 Xpo1 Rat valproic acid decreases expression ISO XPO1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of XPO1 mRNA CTD PMID:23179753 more ... Xpo1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of XPO1 mRNA CTD PMID:23034163
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-methylcholine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (ISO) 4-amino-2,6-dinitrotoluene (EXP) aconitine (EXP) acrolein (ISO) acrylamide (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) aflatoxin M1 (ISO) AICA ribonucleotide (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsenous acid (ISO) aurantio-obtusin (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) buspirone (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) calcitriol (ISO) cannabidiol (ISO) chloropicrin (ISO) chloroquine (ISO) chlorpyrifos (ISO) ciguatoxin CTX1B (ISO) clofibrate (ISO) copper atom (EXP) copper(0) (EXP) corticosterone (EXP) coumarin (ISO) crocidolite asbestos (ISO) Cuprizon (ISO) curcumin (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) doxorubicin (EXP) enzyme inhibitor (ISO) ethanol (ISO) finasteride (EXP) fluoxetine (EXP) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) fulvestrant (ISO) furan (EXP) furfural (ISO) gentamycin (EXP) hydrogen peroxide (ISO) ivermectin (ISO) leflunomide (EXP) leptomycin B (ISO) levofloxacin (EXP) menadione (ISO) methidathion (ISO) methylparaben (ISO) miconazole (ISO) N-methyl-4-phenylpyridinium (ISO) nefazodone (EXP) nickel atom (ISO) nimesulide (EXP) nitrates (ISO) oxaliplatin (EXP) ozone (ISO) paclitaxel (ISO) paracetamol (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) PhIP (EXP) potassium chromate (ISO) potassium dichromate (ISO) propiconazole (ISO) quercetin (ISO) raloxifene (ISO) resveratrol (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium dichromate (EXP) sulindac (EXP) tetrachloromethane (ISO) thapsigargin (EXP) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) trovafloxacin (EXP) valproic acid (ISO) vinclozolin (EXP)
Biological Process
cellular response to salt (IEP) cellular response to triglyceride (IEP) intracellular protein transport (IEA) mRNA export from nucleus (IEA,ISO) mRNA transport (IEA) negative regulation of transcription by RNA polymerase II (IMP) nucleocytoplasmic transport (IEA,ISO) protein export from nucleus (IDA,IEA,ISO) protein localization to nucleus (IEA,ISO) protein transport (IEA) regulation of centrosome duplication (IEA,ISO) regulation of proteasomal ubiquitin-dependent protein catabolic process (IEA,ISO) regulation of protein catabolic process (IEA,ISO) regulation of protein export from nucleus (IEA,ISO) response to xenobiotic stimulus (IEP) ribosomal large subunit export from nucleus (IBA,IEA,ISO) ribosomal small subunit export from nucleus (IBA,IEA,ISO) ribosomal subunit export from nucleus (IEA,ISO) ribosome biogenesis (IEA,ISO)
Cellular Component
annulate lamellae (IEA,ISO) Cajal body (IEA) cytoplasm (IBA,IEA,ISO) cytosol (IEA,ISO) intracellular membrane-bounded organelle (IEA,ISO) kinetochore (IEA,ISO,ISS) nuclear membrane (IEA,ISO) nucleolus (IEA,ISO) nucleoplasm (IEA,ISO) nucleus (IBA,IEA,ISO) protein-containing complex (IEA,ISO) ribonucleoprotein complex (IEA,ISO)
1.
Association of XPO1 Overexpression with NF-κB and Ki67 in Colorectal Cancer.
Aladhraei M, etal., Asian Pac J Cancer Prev. 2019 Dec 1;20(12):3747-3754. doi: 10.31557/APJCP.2019.20.12.3747.
2.
Nuclear export factor CRM1 interacts with nonstructural proteins NS2 from parvovirus minute virus of mice.
Bodendorf U, etal., J Virol 1999 Sep;73(9):7769-79.
3.
Prognostic roles of the transcriptional expression of exportins in hepatocellular carcinoma.
Chen L, etal., Biosci Rep. 2019 Aug 19;39(8). pii: BSR20190827. doi: 10.1042/BSR20190827. Print 2019 Aug 30.
4.
Nucleocytoplasmic shuttling of dysbindin-1, a schizophrenia-related protein, regulates synapsin I expression.
Fei E, etal., J Biol Chem. 2010 Dec 3;285(49):38630-40. doi: 10.1074/jbc.M110.107912. Epub 2010 Oct 4.
5.
XPO1 Inhibition Enhances Radiation Response in Preclinical Models of Rectal Cancer.
Ferreiro-Neira I, etal., Clin Cancer Res. 2016 Apr 1;22(7):1663-73. doi: 10.1158/1078-0432.CCR-15-0978. Epub 2015 Nov 24.
6.
Coordinate regulation/localization of the carbohydrate responsive binding protein (ChREBP) by two nuclear export signal sites: discovery of a new leucine-rich nuclear export signal site.
Fukasawa M, etal., Biochem Biophys Res Commun. 2010 Jan 8;391(2):1166-9. doi: 10.1016/j.bbrc.2009.11.115. Epub 2009 Dec 17.
7.
Overexpression of CRM1: A Characteristic Feature in a Transformed Phenotype of Lung Carcinogenesis and a Molecular Target for Lung Cancer Adjuvant Therapy.
Gao W, etal., J Thorac Oncol. 2015 May;10(5):815-25. doi: 10.1097/JTO.0000000000000485.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
10.
Rat CRM1 is responsible for the poor activity of human T-cell leukemia virus type 1 Rex protein in rat cells.
Hakata Y, etal., J Virol 2001 Dec;75(23):11515-25.
11.
A novel circular RNA, circXPO1, promotes lung adenocarcinoma progression by interacting with IGF2BP1.
Huang Q, etal., Cell Death Dis. 2020 Dec 2;11(12):1031. doi: 10.1038/s41419-020-03237-8.
12.
Prognostic value of CRM1 in pancreas cancer.
Huang WY, etal., Clin Invest Med. 2009 Dec 1;32(6):E315.
13.
Sequential Administration of XPO1 and ATR Inhibitors Enhances Therapeutic Response in TP53-mutated Colorectal Cancer.
Inoue A, etal., Gastroenterology. 2021 Jul;161(1):196-210. doi: 10.1053/j.gastro.2021.03.022. Epub 2021 Mar 19.
14.
CRM-1 knockdown inhibits extrahepatic cholangiocarcinoma tumor growth by blocking the nuclear export of p27Kip1.
Luo J, etal., Int J Mol Med. 2016 Aug;38(2):381-90. doi: 10.3892/ijmm.2016.2628. Epub 2016 Jun 7.
15.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
16.
Postage for the messenger: designating routes for nuclear mRNA export.
Natalizio BJ and Wente SR, Trends Cell Biol. 2013 Aug;23(8):365-73. doi: 10.1016/j.tcb.2013.03.006. Epub 2013 Apr 11.
17.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
18.
RNA Export through the NPC in Eukaryotes.
Okamura M, etal., Genes (Basel). 2015 Mar 20;6(1):124-49. doi: 10.3390/genes6010124.
19.
Suppressing activity of tributyrin on hepatocarcinogenesis is associated with inhibiting the p53-CRM1 interaction and changing the cellular compartmentalization of p53 protein.
Ortega JF, etal., Oncotarget. 2016 Apr 26;7(17):24339-47. doi: 10.18632/oncotarget.8248.
20.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
21.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
22.
GOA pipeline
RGD automated data pipeline
23.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
24.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
25.
Targeting Nuclear Exporter Protein XPO1/CRM1 in Gastric Cancer.
Sexton R, etal., Int J Mol Sci. 2019 Sep 28;20(19). pii: ijms20194826. doi: 10.3390/ijms20194826.
26.
Anti-tumor efficacy of Selinexor (KPT-330) in gastric cancer is dependent on nuclear accumulation of p53 tumor suppressor.
Subhash VV, etal., Sci Rep. 2018 Aug 16;8(1):12248. doi: 10.1038/s41598-018-30686-1.
27.
KPT-330 has antitumour activity against non-small cell lung cancer.
Sun H, etal., Br J Cancer. 2014 Jul 15;111(2):281-91. doi: 10.1038/bjc.2014.260. Epub 2014 Jun 19.
28.
Expression of CRM1 and CDK5 shows high prognostic accuracy for gastric cancer.
Sun YQ, etal., World J Gastroenterol. 2017 Mar 21;23(11):2012-2022. doi: 10.3748/wjg.v23.i11.2012.
29.
Elevated expression of the nuclear export protein, Crm1 (exportin 1), associates with human oesophageal squamous cell carcinoma.
van der Watt PJ, etal., Oncol Rep. 2014 Aug;32(2):730-8. doi: 10.3892/or.2014.3231. Epub 2014 Jun 4.
30.
Involvement of chromosome region maintenance 1 (CRM1) in the formation and progression of esophageal squamous cell carcinoma.
Yang X, etal., Med Oncol. 2014 Sep;31(9):155. doi: 10.1007/s12032-014-0155-9. Epub 2014 Aug 23.
31.
Nuclear export and cytoplasmic maturation of ribosomal subunits.
Zemp I and Kutay U, FEBS Lett. 2007 Jun 19;581(15):2783-93. Epub 2007 May 11.
32.
KPT-330 inhibitor of XPO1-mediated nuclear export has anti-proliferative activity in hepatocellular carcinoma.
Zheng Y, etal., Cancer Chemother Pharmacol. 2014 Sep;74(3):487-95. doi: 10.1007/s00280-014-2495-8. Epub 2014 Jul 17.
33.
Both high expression of nucleophosmin/B23 and CRM1 predicts poorer prognosis in human gastric cancer.
Zhou F, etal., APMIS. 2016 Dec;124(12):1046-1053. doi: 10.1111/apm.12604. Epub 2016 Oct 6.
34.
CRM1 is a novel independent prognostic factor for the poor prognosis of gastric carcinomas.
Zhou F, etal., Med Oncol. 2013 Dec;30(4):726. doi: 10.1007/s12032-013-0726-1. Epub 2013 Sep 12.
35.
XPO1 inhibitor KPT-330 synergizes with Bcl-xL inhibitor to induce cancer cell apoptosis by perturbing rRNA processing and Mcl-1 protein synthesis.
Zhu ZC, etal., Cell Death Dis. 2019 May 21;10(6):395. doi: 10.1038/s41419-019-1627-9.
Xpo1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 101,434,450 - 101,476,705 (+) NCBI GRCr8 mRatBN7.2 14 97,233,282 - 97,275,536 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 97,233,270 - 97,275,498 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 101,571,539 - 101,607,053 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 102,815,887 - 102,851,401 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 99,287,455 - 99,322,969 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 108,007,421 - 108,049,088 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 108,007,724 - 108,049,660 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 108,082,784 - 108,124,516 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 103,943,249 - 103,978,717 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 103,962,459 - 103,997,928 (+) NCBI Celera 14 96,216,463 - 96,251,770 (+) NCBI Celera Cytogenetic Map 14 q22 NCBI
XPO1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 61,477,849 - 61,538,612 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 61,476,032 - 61,538,741 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 61,704,984 - 61,765,491 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 61,558,573 - 61,618,922 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 61,616,719 - 61,677,069 NCBI Celera 2 61,550,297 - 61,610,634 (-) NCBI Celera Cytogenetic Map 2 p15 NCBI HuRef 2 61,445,666 - 61,506,245 (-) NCBI HuRef CHM1_1 2 61,635,341 - 61,695,639 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 61,483,936 - 61,544,825 (-) NCBI T2T-CHM13v2.0
Xpo1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 23,205,768 - 23,248,250 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 23,206,055 - 23,248,249 (+) Ensembl GRCm39 Ensembl GRCm38 11 23,255,909 - 23,297,597 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 23,256,041 - 23,298,249 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 23,156,041 - 23,197,597 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 23,156,041 - 23,197,597 (+) NCBI MGSCv36 mm8 Celera 11 25,383,230 - 25,424,813 (+) NCBI Celera Cytogenetic Map 11 A3.2 NCBI cM Map 11 14.28 NCBI
Xpo1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955424 22,370,006 - 22,420,568 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955424 22,370,006 - 22,420,568 (+) NCBI ChiLan1.0 ChiLan1.0
XPO1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 64,845,566 - 64,906,271 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 64,849,384 - 64,910,222 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 61,562,372 - 61,622,841 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 62,698,935 - 62,759,059 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 62,698,935 - 62,757,793 (-) Ensembl panpan1.1 panPan2
XPO1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 61,541,647 - 61,588,397 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 61,542,211 - 61,585,054 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 61,432,066 - 61,478,799 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 62,551,228 - 62,597,765 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 62,549,829 - 62,598,376 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 62,236,087 - 62,282,603 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 62,538,737 - 62,585,449 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 62,833,751 - 62,880,490 (-) NCBI UU_Cfam_GSD_1.0
Xpo1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 21,608,933 - 21,649,530 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936491 6,921,319 - 6,962,343 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936491 6,921,753 - 6,962,062 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
XPO1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 80,255,146 - 80,300,327 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 80,255,016 - 80,300,260 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 84,163,542 - 84,182,141 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
XPO1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 45,428,279 - 45,487,965 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 45,432,619 - 45,488,723 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 66,319,346 - 66,401,611 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Xpo1
.
Predicted Target Of
Count of predictions: 95 Count of miRNA genes: 75 Interacting mature miRNAs: 78 Transcripts: ENSRNOT00000014062 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
634328 Hc5 Hypercalciuria QTL 5 2.3 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 14 58184885 103184885 Rat 9590294 Uminl4 Urine mineral level QTL 4 5.66 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 14 55624247 100624247 Rat 2317879 Alcrsp27 Alcohol response QTL 27 3.3 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 14 56631369 101631369 Rat 1641900 Alcrsp11 Alcohol response QTL 11 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 14 70053989 104886043 Rat 2300197 Scl59 Serum cholesterol level QTL 59 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 14 55147478 100147478 Rat 9589034 Epfw11 Epididymal fat weight QTL 11 6 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 14 55624247 100624247 Rat 631523 Pia13 Pristane induced arthritis QTL 13 3.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 40793460 98037301 Rat 1582259 Gluco23 Glucose level QTL 23 3.1 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 70053989 104886043 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014062 ⟹ ENSRNOP00000014062
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 97,233,382 - 97,275,498 (+) Ensembl Rnor_6.0 Ensembl 14 108,007,724 - 108,049,660 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000101915 ⟹ ENSRNOP00000087052
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 97,252,482 - 97,275,458 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114310 ⟹ ENSRNOP00000097648
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 97,233,270 - 97,275,432 (+) Ensembl
RefSeq Acc Id:
NM_053490 ⟹ NP_445942
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 101,434,450 - 101,476,705 (+) NCBI mRatBN7.2 14 97,233,282 - 97,275,536 (+) NCBI Rnor_6.0 14 108,013,281 - 108,048,950 (+) NCBI Rnor_5.0 14 108,082,784 - 108,124,516 (+) NCBI RGSC_v3.4 14 103,943,249 - 103,978,717 (+) RGD Celera 14 96,216,463 - 96,251,770 (+) RGD
Sequence:
ATGCCAGCAATTATGACAATGTTAGCAGACCATGCAGCCCGTCAGCTGCTTGACTTCAGCCAGAAGCTGGATATCAACCTTTTAGACAATGTGGTGAACTGCTTGTACCACGGGGAAGGAGCCCAGCA
hide sequence
RefSeq Acc Id:
NP_445942 ⟸ NM_053490
- UniProtKB:
Q80U96 (UniProtKB/Swiss-Prot), A6JQ67 (UniProtKB/TrEMBL), A0A8I6AT26 (UniProtKB/TrEMBL)
- Sequence:
MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIG
hide sequence
Ensembl Acc Id:
ENSRNOP00000014062 ⟸ ENSRNOT00000014062
Ensembl Acc Id:
ENSRNOP00000097648 ⟸ ENSRNOT00000114310
Ensembl Acc Id:
ENSRNOP00000087052 ⟸ ENSRNOT00000101915
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2014-03-13
Xpo1
exportin 1
Xpo1
exportin 1, CRM1 homolog (yeast)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-12-14
Xpo1
exportin 1, CRM1 homolog (yeast)
exportin 1 (CRM1, yeast, homolog)
Name updated
1299863 APPROVED
2002-08-07
Xpo1
exportin 1 (CRM1, yeast, homolog)
Symbol and Name status set to provisional
70820 PROVISIONAL
