Symbol:
Dnajc5
Name:
DnaJ heat shock protein family (Hsp40) member C5
RGD ID:
620516
Description:
Enables ATP-dependent protein binding activity. Predicted to be involved in chaperone-mediated protein folding and regulation of synaptic vesicle cycle. Predicted to act upstream of or within negative regulation of neuron apoptotic process. Located in terminal bouton. Is active in synaptic vesicle membrane. Human ortholog(s) of this gene implicated in neuronal ceroid lipofuscinosis 4. Orthologous to human DNAJC5 (DnaJ heat shock protein family (Hsp40) member C5); PARTICIPATES IN Endoplasmic Reticulum-associated degradation pathway; INTERACTS WITH 17alpha-ethynylestradiol; 6-propyl-2-thiouracil; acetamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Csp; cysteine string protein; DnaJ (Hsp40) homolog, subfamily C, member 5; dnaJ homolog subfamily C member 5
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DNAJC5 (DnaJ heat shock protein family (Hsp40) member C5) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Mus musculus (house mouse):
Dnajc5 (DnaJ heat shock protein family (Hsp40) member C5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Dnajc5 (DnaJ heat shock protein family (Hsp40) member C5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DNAJC5 (DnaJ heat shock protein family (Hsp40) member C5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DNAJC5 (DnaJ heat shock protein family (Hsp40) member C5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Dnajc5 (DnaJ heat shock protein family (Hsp40) member C5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DNAJC5 (DnaJ heat shock protein family (Hsp40) member C5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DNAJC5 (DnaJ heat shock protein family (Hsp40) member C5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Dnajc5 (DnaJ heat shock protein family (Hsp40) member C5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
DNAJC5B (DnaJ heat shock protein family (Hsp40) member C5 beta) HGNC
OrthoDB
Alliance orthologs 3
Mus musculus (house mouse):
Dnajc5 (DnaJ heat shock protein family (Hsp40) member C5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
DNAJC5 (DnaJ heat shock protein family (Hsp40) member C5)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
dnajc5ab (DnaJ (Hsp40) homolog, subfamily C, member 5ab)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
dnajc5aa (DnaJ (Hsp40) homolog, subfamily C, member 5aa)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Csp
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
dnj-14
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 188,999,508 - 189,033,455 (+) NCBI GRCr8 GRCr8 Ensembl 3 188,999,470 - 189,034,089 (+) Ensembl GRCr8 Ensembl mRatBN7.2 3 168,621,905 - 168,656,570 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 168,621,969 - 168,655,935 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 173,002,718 - 173,032,873 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 181,961,813 - 181,991,968 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 178,623,311 - 178,653,609 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 177,012,714 - 177,047,787 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 177,013,604 - 177,043,902 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 180,723,449 - 180,758,075 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 170,655,557 - 170,685,855 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 3 163,934,331 - 163,964,588 (-) NCBI Celera RGSC_v3.1 3 170,561,592 - 170,591,891 (+) NCBI Cytogenetic Map 3 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dnajc5 Rat 1,2-dichloroethane decreases expression ISO Dnajc5 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of DNAJC5 mRNA CTD PMID:28960355 Dnajc5 Rat 1,2-dimethylhydrazine increases expression ISO Dnajc5 (Mus musculus) 6480464 1,2-Dimethylhydrazine results in increased expression of DNAJC5 mRNA CTD PMID:22206623 Dnajc5 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of DNAJC5 mRNA CTD PMID:29097150 Dnajc5 Rat 17beta-estradiol affects expression ISO DNAJC5 (Homo sapiens) 6480464 Estradiol affects the expression of DNAJC5 mRNA CTD PMID:22574217 Dnajc5 Rat 17beta-estradiol increases expression ISO Dnajc5 (Mus musculus) 6480464 Estradiol results in increased expression of DNAJC5 mRNA CTD PMID:39298647 Dnajc5 Rat 17beta-estradiol increases expression ISO DNAJC5 (Homo sapiens) 6480464 Estradiol results in increased expression of DNAJC5 mRNA CTD PMID:23019147 Dnajc5 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Dnajc5 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of DNAJC5 mRNA CTD PMID:21570461|PMID:24680724 Dnajc5 Rat 2,6-dimethoxyphenol multiple interactions ISO DNAJC5 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1,3-dimethyl ether] results in increased expression of and affects the more ... CTD PMID:38598786 Dnajc5 Rat 2-bromohexadecanoic acid multiple interactions ISO DNAJC5 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Dnajc5 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Dnajc5 (Mus musculus) 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of DNAJC5 mRNA CTD PMID:20188158 Dnajc5 Rat 4,4'-diaminodiphenylmethane increases expression ISO Dnajc5 (Mus musculus) 6480464 4,4'-diaminodiphenylmethane results in increased expression of DNAJC5 mRNA CTD PMID:18648102 Dnajc5 Rat 4,4'-sulfonyldiphenol increases expression ISO Dnajc5 (Mus musculus) 6480464 bisphenol S results in increased expression of DNAJC5 mRNA CTD PMID:39298647 Dnajc5 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of DNAJC5 mRNA CTD PMID:24780913 Dnajc5 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of DNAJC5 mRNA CTD PMID:30047161 Dnajc5 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of DNAJC5 mRNA CTD PMID:31881176 Dnajc5 Rat aconitine decreases expression EXP 6480464 Aconitine results in decreased expression of DNAJC5 protein CTD PMID:33236894 Dnajc5 Rat aflatoxin B1 increases expression ISO Dnajc5 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of DNAJC5 mRNA CTD PMID:19770486 Dnajc5 Rat Aflatoxin B2 alpha increases methylation ISO DNAJC5 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of DNAJC5 intron CTD PMID:30157460 Dnajc5 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of DNAJC5 mRNA CTD PMID:30047161 Dnajc5 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of DNAJC5 mRNA CTD PMID:16483693 Dnajc5 Rat antirheumatic drug decreases expression ISO DNAJC5 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of DNAJC5 mRNA CTD PMID:24449571 Dnajc5 Rat arsane affects methylation ISO DNAJC5 (Homo sapiens) 6480464 Arsenic affects the methylation of DNAJC5 gene CTD PMID:25304211 Dnajc5 Rat arsenic atom affects methylation ISO DNAJC5 (Homo sapiens) 6480464 Arsenic affects the methylation of DNAJC5 gene CTD PMID:25304211 Dnajc5 Rat benzo[a]pyrene increases mutagenesis ISO DNAJC5 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of DNAJC5 gene CTD PMID:25435355 Dnajc5 Rat benzo[a]pyrene affects methylation ISO DNAJC5 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of DNAJC5 5' UTR; Benzo(a)pyrene affects the methylation of DNAJC5 intron CTD PMID:27901495|PMID:30157460 Dnajc5 Rat benzo[a]pyrene decreases methylation ISO DNAJC5 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of DNAJC5 promoter CTD PMID:27901495 Dnajc5 Rat benzo[a]pyrene diol epoxide I decreases expression ISO DNAJC5 (Homo sapiens) 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of DNAJC5 mRNA CTD PMID:19150397 Dnajc5 Rat benzo[e]pyrene decreases methylation ISO DNAJC5 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of DNAJC5 intron CTD PMID:30157460 Dnajc5 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DNAJC5 mRNA CTD PMID:25181051|PMID:29097150|PMID:30816183|PMID:34947998 Dnajc5 Rat bisphenol A multiple interactions ISO DNAJC5 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of DNAJC5 gene CTD PMID:31601247 Dnajc5 Rat bisphenol A decreases expression ISO DNAJC5 (Homo sapiens) 6480464 bisphenol A results in decreased expression of DNAJC5 protein CTD PMID:33376534 Dnajc5 Rat cadmium atom multiple interactions ISO DNAJC5 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Dnajc5 Rat cadmium atom multiple interactions ISO Dnajc5 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of DNAJC5 more ... CTD PMID:37325564 Dnajc5 Rat cadmium dichloride multiple interactions ISO DNAJC5 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Dnajc5 Rat cadmium dichloride multiple interactions ISO Dnajc5 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of DNAJC5 more ... CTD PMID:37325564 Dnajc5 Rat caffeine affects phosphorylation ISO DNAJC5 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of DNAJC5 protein CTD PMID:35688186 Dnajc5 Rat carbamazepine affects expression ISO DNAJC5 (Homo sapiens) 6480464 Carbamazepine affects the expression of DNAJC5 mRNA CTD PMID:24752500 Dnajc5 Rat carbon nanotube affects expression ISO Dnajc5 (Mus musculus) 6480464 Nanotubes, Carbon affects the expression of DNAJC5 mRNA; Nanotubes, Carbon analog affects the expression of more ... CTD PMID:25554681 Dnajc5 Rat carbon nanotube increases expression ISO Dnajc5 (Mus musculus) 6480464 Nanotubes, Carbon analog results in increased expression of DNAJC5 mRNA CTD PMID:25620056 Dnajc5 Rat CGP 52608 multiple interactions ISO DNAJC5 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to DNAJC5 gene] CTD PMID:28238834 Dnajc5 Rat chlorpyrifos increases expression ISO Dnajc5 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of DNAJC5 mRNA CTD PMID:37019170 Dnajc5 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of DNAJC5 mRNA CTD PMID:24386269 Dnajc5 Rat coumarin decreases phosphorylation ISO DNAJC5 (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of DNAJC5 protein CTD PMID:35688186 Dnajc5 Rat CU-O LINKAGE decreases expression ISO DNAJC5 (Homo sapiens) 6480464 cupric oxide results in decreased expression of DNAJC5 mRNA CTD PMID:22077320 Dnajc5 Rat deoxynivalenol increases phosphorylation ISO Dnajc5 (Mus musculus) 6480464 deoxynivalenol results in increased phosphorylation of DNAJC5 protein CTD PMID:23352502 Dnajc5 Rat Dibutyl phosphate affects expression ISO DNAJC5 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of DNAJC5 mRNA CTD PMID:37042841 Dnajc5 Rat diclofenac affects expression ISO DNAJC5 (Homo sapiens) 6480464 Diclofenac affects the expression of DNAJC5 mRNA CTD PMID:24752500 Dnajc5 Rat diquat increases expression ISO Dnajc5 (Mus musculus) 6480464 Diquat results in increased expression of DNAJC5 protein CTD PMID:36851058 Dnajc5 Rat doxorubicin decreases expression ISO DNAJC5 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of DNAJC5 mRNA CTD PMID:29803840 Dnajc5 Rat ethanol multiple interactions ISO Dnajc5 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of DNAJC5 mRNA CTD PMID:30319688 Dnajc5 Rat ethyl methanesulfonate increases expression ISO DNAJC5 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of DNAJC5 mRNA CTD PMID:23649840 Dnajc5 Rat fenofibrate increases expression ISO Dnajc5 (Mus musculus) 6480464 Fenofibrate results in increased expression of DNAJC5 mRNA CTD PMID:21318169 Dnajc5 Rat fenofibrate multiple interactions ISO Dnajc5 (Mus musculus) 6480464 PPARA protein affects the reaction [Fenofibrate results in increased expression of DNAJC5 mRNA] CTD PMID:21318169 Dnajc5 Rat formaldehyde increases expression ISO DNAJC5 (Homo sapiens) 6480464 Formaldehyde results in increased expression of DNAJC5 mRNA CTD PMID:23649840 Dnajc5 Rat FR900359 affects phosphorylation ISO DNAJC5 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of DNAJC5 protein CTD PMID:37730182 Dnajc5 Rat fulvestrant multiple interactions ISO DNAJC5 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of DNAJC5 gene CTD PMID:31601247 Dnajc5 Rat furfural multiple interactions ISO DNAJC5 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of more ... CTD PMID:38598786 Dnajc5 Rat gamma-hexachlorocyclohexane decreases expression EXP 6480464 Hexachlorocyclohexane results in decreased expression of DNAJC5 mRNA CTD PMID:17785943 Dnajc5 Rat gamma-tocopherol increases expression ISO Dnajc5 (Mus musculus) 6480464 Tocopherols results in increased expression of DNAJC5 mRNA CTD PMID:17654050 Dnajc5 Rat gold atom multiple interactions ISO DNAJC5 (Homo sapiens) 6480464 [Polyethyleneimine binds to Gold] which results in decreased expression of DNAJC5 mRNA CTD PMID:28433809 Dnajc5 Rat gold(0) multiple interactions ISO DNAJC5 (Homo sapiens) 6480464 [Polyethyleneimine binds to Gold] which results in decreased expression of DNAJC5 mRNA CTD PMID:28433809 Dnajc5 Rat imipramine increases expression ISO DNAJC5 (Homo sapiens) 6480464 Imipramine results in increased expression of DNAJC5 mRNA; Imipramine results in increased expression of DNAJC5 more ... CTD PMID:11257428 Dnajc5 Rat lead(0) affects expression ISO DNAJC5 (Homo sapiens) 6480464 Lead affects the expression of DNAJC5 mRNA CTD PMID:28903495 Dnajc5 Rat methapyrilene decreases methylation ISO DNAJC5 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of DNAJC5 intron CTD PMID:30157460 Dnajc5 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of DNAJC5 mRNA CTD PMID:30047161 Dnajc5 Rat methotrexate affects expression ISO Dnajc5 (Mus musculus) 6480464 Methotrexate affects the expression of DNAJC5 mRNA CTD PMID:18502557 Dnajc5 Rat methyl methanesulfonate increases expression ISO DNAJC5 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of DNAJC5 mRNA CTD PMID:23649840 Dnajc5 Rat ozone multiple interactions ISO DNAJC5 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of DNAJC5 mRNA CTD PMID:35430440 Dnajc5 Rat paracetamol affects expression ISO Dnajc5 (Mus musculus) 6480464 Acetaminophen affects the expression of DNAJC5 mRNA CTD PMID:17562736 Dnajc5 Rat phenobarbital affects expression ISO Dnajc5 (Mus musculus) 6480464 Phenobarbital affects the expression of DNAJC5 mRNA CTD PMID:23091169 Dnajc5 Rat phlorizin decreases expression ISO Dnajc5 (Mus musculus) 6480464 Phlorhizin results in decreased expression of DNAJC5 mRNA CTD PMID:22538082 Dnajc5 Rat potassium dichromate increases expression ISO DNAJC5 (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of DNAJC5 protein CTD PMID:23718831 Dnajc5 Rat rotenone decreases expression ISO Dnajc5 (Mus musculus) 6480464 Rotenone results in decreased expression of DNAJC5 mRNA CTD PMID:23186747 Dnajc5 Rat sertraline increases expression ISO DNAJC5 (Homo sapiens) 6480464 Sertraline results in increased expression of DNAJC5 mRNA; Sertraline results in increased expression of DNAJC5 more ... CTD PMID:11257428 Dnajc5 Rat sodium arsenite affects expression ISO DNAJC5 (Homo sapiens) 6480464 sodium arsenite affects the expression of DNAJC5 mRNA CTD PMID:34032870 Dnajc5 Rat sodium chloride multiple interactions ISO DNAJC5 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of more ... CTD PMID:38598786 Dnajc5 Rat succimer multiple interactions ISO Dnajc5 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of DNAJC5 mRNA; [Succimer co-treated more ... CTD PMID:21641980|PMID:26378955 Dnajc5 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of DNAJC5 mRNA CTD PMID:30047161 Dnajc5 Rat tetrachloromethane increases expression ISO Dnajc5 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of DNAJC5 mRNA CTD PMID:27339419|PMID:31919559 Dnajc5 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of DNAJC5 mRNA CTD PMID:34492290 Dnajc5 Rat thiram decreases expression ISO DNAJC5 (Homo sapiens) 6480464 Thiram results in decreased expression of DNAJC5 mRNA CTD PMID:38568856 Dnajc5 Rat titanium dioxide increases expression ISO Dnajc5 (Mus musculus) 6480464 titanium dioxide results in increased expression of DNAJC5 mRNA CTD PMID:35295148 Dnajc5 Rat titanium dioxide decreases methylation ISO Dnajc5 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of DNAJC5 gene CTD PMID:35295148 Dnajc5 Rat tocopherol increases expression ISO Dnajc5 (Mus musculus) 6480464 Tocopherols results in increased expression of DNAJC5 mRNA CTD PMID:17654050 Dnajc5 Rat trimellitic anhydride increases expression ISO Dnajc5 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of DNAJC5 mRNA CTD PMID:19042947 Dnajc5 Rat triphenyl phosphate affects expression ISO DNAJC5 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of DNAJC5 mRNA CTD PMID:37042841 Dnajc5 Rat triptonide increases expression ISO Dnajc5 (Mus musculus) 6480464 triptonide results in increased expression of DNAJC5 mRNA CTD PMID:33045310 Dnajc5 Rat valproic acid affects expression ISO Dnajc5 (Mus musculus) 6480464 Valproic Acid affects the expression of DNAJC5 mRNA CTD PMID:17292431 Dnajc5 Rat valproic acid increases expression ISO DNAJC5 (Homo sapiens) 6480464 Valproic Acid results in increased expression of DNAJC5 mRNA CTD PMID:23179753
Imported Annotations - KEGG (archival)
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,6-dimethoxyphenol (ISO) 2-bromohexadecanoic acid (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aconitine (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) amitrole (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) carbamazepine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) cobalt dichloride (EXP) coumarin (ISO) CU-O LINKAGE (ISO) deoxynivalenol (ISO) Dibutyl phosphate (ISO) diclofenac (ISO) diquat (ISO) doxorubicin (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) fenofibrate (ISO) formaldehyde (ISO) FR900359 (ISO) fulvestrant (ISO) furfural (ISO) gamma-hexachlorocyclohexane (EXP) gamma-tocopherol (ISO) gold atom (ISO) gold(0) (ISO) imipramine (ISO) lead(0) (ISO) methapyrilene (ISO) methimazole (EXP) methotrexate (ISO) methyl methanesulfonate (ISO) ozone (ISO) paracetamol (ISO) phenobarbital (ISO) phlorizin (ISO) potassium dichromate (ISO) rotenone (ISO) sertraline (ISO) sodium arsenite (ISO) sodium chloride (ISO) succimer (ISO) sulfadimethoxine (EXP) tetrachloromethane (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) tocopherol (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO)
Cellular Component
chromaffin granule membrane (IEA) cytoplasm (IEA) cytoplasmic vesicle (IEA) cytosol (IEA,ISS) melanosome (IEA) membrane (IBA,IEA,ISS) neuromuscular junction (IEA,ISO) plasma membrane (IEA,ISO,ISS) presynapse (IBA,IEA,ISO) synaptic vesicle (IEA,ISO) synaptic vesicle membrane (IDA,IEP) terminal bouton (HDA) transport vesicle membrane (IEA)
1.
Rdj2, a J protein family member, interacts with cellular prion PrP(C).
Beck KE, etal., Biochem Biophys Res Commun. 2006 Aug 4;346(3):866-71. Epub 2006 Jun 6.
2.
Cysteine string protein, a DnaJ family member, is present on diverse secretory vesicles.
Braun JE and Scheller RH, Neuropharmacology 1995 Nov;34(11):1361-9.
3.
Phosphorylation-dependent interaction of the synaptic vesicle proteins cysteine string protein and synaptotagmin I.
Evans GJ and Morgan A, Biochem J 2002 Jun 1;364(Pt 2):343-7.
4.
Cysteine-string protein in inner hair cells of the organ of Corti: synaptic expression and upregulation at the onset of hearing.
Eybalin M, etal., Eur J Neurosci 2002 May;15(9):1409-20.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
The nucleotide and deduced amino acid sequence of a rat cysteine string protein.
Mastrogiacomo A and Gundersen CB, Brain Res Mol Brain Res 1995 Jan;28(1):12-8.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Cysteine string protein (CSP) inhibition of N-type calcium channels is blocked by mutant huntingtin.
Miller LC, etal., J Biol Chem 2003 Dec 26;278(52):53072-81. Epub 2003 Oct 21.
9.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
GOA pipeline
RGD automated data pipeline
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Rab-alphaGDI activity is regulated by a Hsp90 chaperone complex.
Sakisaka T, etal., EMBO J 2002 Nov 15;21(22):6125-35.
16.
Oligomerization characteristics of cysteine string protein.
Swayne LA, etal., Biochem Biophys Res Commun 2003 Jan 24;300(4):921-6.
17.
A brain-specific isoform of small glutamine-rich tetratricopeptide repeat-containing protein binds to Hsc70 and the cysteine string protein.
Tobaben S, etal., J Biol Chem 2003 Oct 3;278(40):38376-83. Epub 2003 Jul 23.
18.
A trimeric protein complex functions as a synaptic chaperone machine.
Tobaben S, etal., Neuron. 2001 Sep 27;31(6):987-99.
19.
Composition of isolated synaptic boutons reveals the amounts of vesicle trafficking proteins.
Wilhelm BG, etal., Science. 2014 May 30;344(6187):1023-8. doi: 10.1126/science.1252884.
20.
Induction of cysteine string protein after chronic antidepressant treatment in rat frontal cortex.
Yamada M, etal., Neurosci Lett 2001 Apr 6;301(3):183-6.
Dnajc5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 188,999,508 - 189,033,455 (+) NCBI GRCr8 GRCr8 Ensembl 3 188,999,470 - 189,034,089 (+) Ensembl GRCr8 Ensembl mRatBN7.2 3 168,621,905 - 168,656,570 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 168,621,969 - 168,655,935 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 173,002,718 - 173,032,873 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 181,961,813 - 181,991,968 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 178,623,311 - 178,653,609 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 177,012,714 - 177,047,787 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 177,013,604 - 177,043,902 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 180,723,449 - 180,758,075 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 170,655,557 - 170,685,855 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 3 163,934,331 - 163,964,588 (-) NCBI Celera RGSC_v3.1 3 170,561,592 - 170,591,891 (+) NCBI Cytogenetic Map 3 q43 NCBI
DNAJC5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 63,895,126 - 63,936,011 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 63,895,126 - 63,936,031 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 62,526,479 - 62,567,364 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 61,996,962 - 62,035,839 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 61,996,961 - 62,035,838 NCBI Celera 20 59,210,381 - 59,249,259 (+) NCBI Celera Cytogenetic Map 20 q13.33 NCBI HuRef 20 59,258,875 - 59,300,772 (+) NCBI HuRef CHM1_1 20 62,427,271 - 62,467,998 (+) NCBI CHM1_1 T2T-CHM13v2.0 20 65,714,973 - 65,755,860 (+) NCBI T2T-CHM13v2.0
Dnajc5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 181,162,141 - 181,194,679 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 181,162,278 - 181,196,926 (+) Ensembl GRCm39 Ensembl GRCm38 2 181,518,858 - 181,552,886 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 181,520,485 - 181,555,133 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 181,255,210 - 181,286,954 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 181,449,912 - 181,481,656 (+) NCBI MGSCv36 mm8 Celera 2 185,601,949 - 185,633,720 (+) NCBI Celera Cytogenetic Map 2 H4 NCBI cM Map 2 103.63 NCBI
Dnajc5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955528 317,891 - 366,293 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955528 317,891 - 366,299 (-) NCBI ChiLan1.0 ChiLan1.0
DNAJC5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 69,707,007 - 69,748,067 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 69,699,028 - 69,740,072 (+) NCBI NHGRI_mPanPan1 PanPan1.1 20 61,848,236 - 61,856,265 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 61,848,236 - 61,856,265 (+) Ensembl panpan1.1 panPan2
DNAJC5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ROS_Cfam_1.0 24 48,520,496 - 48,548,620 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 48,514,370 - 48,545,332 (+) Ensembl ROS_Cfam_1.0 Ensembl
Dnajc5 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 195,630,910 - 195,685,765 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936514 11,131,074 - 11,139,446 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936514 11,131,666 - 11,139,404 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DNAJC5
DNAJC5
Dnajc5
.
Predicted Target Of
Count of predictions: 52 Count of miRNA genes: 46 Interacting mature miRNAs: 52 Transcripts: ENSRNOT00000020581 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
9589106 Insul23 Insulin level QTL 23 13.86 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 3 131635904 169034231 Rat 1300161 Rf10 Renal function QTL 10 3.57 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 3 161192952 169034231 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 8552791 Vie2 Viral induced encephalitis QTL 2 4.1 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 3 145956084 169034231 Rat 1298068 Bp167 Blood pressure QTL 167 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 141074471 169034231 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 2317883 Alcrsp26 Alcohol response QTL 26 1.8 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 3 145526770 169034231 Rat 8552952 Pigfal13 Plasma insulin-like growth factor 1 level QTL 13 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 138799500 169034231 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2298477 Eau4 Experimental allergic uveoretinitis QTL 4 0.0011 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 3 137398739 169034231 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020581 ⟹ ENSRNOP00000020581
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 168,621,969 - 168,652,678 (+) Ensembl Rnor_6.0 Ensembl 3 177,013,604 - 177,043,902 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000086046 ⟹ ENSRNOP00000070142
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 3 177,040,707 - 177,043,381 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000102827 ⟹ ENSRNOP00000078729
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 Ensembl 3 188,999,470 - 189,034,089 (+) Ensembl mRatBN7.2 Ensembl 3 168,621,986 - 168,655,935 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000111615 ⟹ ENSRNOP00000088442
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 168,621,986 - 168,655,649 (+) Ensembl
RefSeq Acc Id:
NM_024161 ⟹ NP_077075
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 188,999,902 - 189,030,200 (+) NCBI mRatBN7.2 3 168,622,380 - 168,652,680 (+) NCBI Rnor_6.0 3 177,013,604 - 177,043,902 (+) NCBI Rnor_5.0 3 180,723,449 - 180,758,075 (+) NCBI RGSC_v3.4 3 170,655,557 - 170,685,855 (+) RGD Celera 3 163,934,331 - 163,964,588 (-) RGD
Sequence:
CCGCGCGGCCGCCTCCGCGGCTCCCGGAACGCAGAAGCTGGTGTAGGGAGGCGGGCAGTGAAGGCTCCGAGGCTTGTTCACATTCGGGGAAGCAGAAAATTGCCTCATAGTTACTAACCTAACATGGC
hide sequence
RefSeq Acc Id:
XM_008762544 ⟹ XP_008760766
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 188,999,508 - 189,033,455 (+) NCBI mRatBN7.2 3 168,621,920 - 168,656,570 (+) NCBI Rnor_6.0 3 177,012,718 - 177,047,787 (+) NCBI
Sequence:
AGATGAAGATAAAGGTCTCCCTCTCCCTGCGGCCTCCCTCTCTAGTTCTTTTGGTAAGTAGTAA
hide sequence
RefSeq Acc Id:
XM_008762545 ⟹ XP_008760767
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 188,999,509 - 189,033,455 (+) NCBI mRatBN7.2 3 168,621,916 - 168,656,570 (+) NCBI Rnor_6.0 3 177,012,717 - 177,047,787 (+) NCBI
Sequence:
TAGATGAAGATAAAGGTCTCCCTCTCCCTGCGGCCTCCCTCTCTAGTTCTTTTGGTAAGTAGTA
hide sequence
RefSeq Acc Id:
XR_352967
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 188,999,508 - 189,033,455 (+) NCBI mRatBN7.2 3 168,621,920 - 168,656,570 (+) NCBI Rnor_6.0 3 177,012,718 - 177,047,787 (+) NCBI Rnor_5.0 3 180,723,449 - 180,758,075 (+) NCBI
Sequence:
AGATGAAGATAAAGGTCTCCCTCTCCCTGCGGCCTCCCTCTCTAGTTCTTTTGGTAAGTAGTAATAAATTTTTTGAGGCTTAAATGAAGTACTGAACAAATTTAAACGCAAGTCGAGCAGTTTTACTC
hide sequence
RefSeq Acc Id:
XR_352968
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 188,999,508 - 189,030,020 (+) NCBI mRatBN7.2 3 168,621,914 - 168,656,570 (+) NCBI Rnor_6.0 3 177,012,714 - 177,047,787 (+) NCBI Rnor_5.0 3 180,723,449 - 180,758,075 (+) NCBI
Sequence:
CTATAGATGAAGATAAAGGTCTCCCTCTCCCTGCGGCCTCCCTCTCTAGTTCTTTTGGTAAGTAGTAATAAATTTTTTGAGGCTTAAATGAAGTACTGAACAAATTTAAACGCAAGTCGAGCAGTTTT
hide sequence
RefSeq Acc Id:
NP_077075 ⟸ NM_024161
- UniProtKB:
P60905 (UniProtKB/Swiss-Prot), A6KLZ8 (UniProtKB/TrEMBL), A0A8I6A9F3 (UniProtKB/TrEMBL)
- Sequence:
MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFVVCGLLTCCYCCCCLCCC
hide sequence
RefSeq Acc Id:
XP_008760766 ⟸ XM_008762544
- Peptide Label:
isoform X1
- Sequence:
MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFVVCGLLTCCYCCCCLCCC
hide sequence
RefSeq Acc Id:
XP_008760767 ⟸ XM_008762545
- Peptide Label:
isoform X1
- Sequence:
MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFVVCGLLTCCYCCCCLCCC
hide sequence
Ensembl Acc Id:
ENSRNOP00000020581 ⟸ ENSRNOT00000020581
Ensembl Acc Id:
ENSRNOP00000070142 ⟸ ENSRNOT00000086046
Ensembl Acc Id:
ENSRNOP00000088442 ⟸ ENSRNOT00000111615
Ensembl Acc Id:
ENSRNOP00000078729 ⟸ ENSRNOT00000102827
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-11-25
Dnajc5
DnaJ heat shock protein family (Hsp40) member C5
Dnajc5
DnaJ (Hsp40) homolog, subfamily C, member 5
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Dnajc5
DnaJ (Hsp40) homolog, subfamily C, member 5
cysteine string protein
Name updated
1299863 APPROVED
2004-09-10
Dnajc5
cysteine string protein
Csp
Symbol and Name updated
1299863 APPROVED
2002-08-07
Csp
cysteine string protein
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_physical_interaction
forms homo-oligomers with itself
632545
gene_physical_interaction
forms a complex with Hsp90 and Hsc70 in synaptic membranes
632546
