Symbol:
Dffa
Name:
DNA fragmentation factor subunit alpha
RGD ID:
620334
Description:
Predicted to enable deoxyribonuclease inhibitor activity; protein domain specific binding activity; and protein folding chaperone. Predicted to be involved in chaperone-mediated protein folding; negative regulation of deoxyribonuclease activity; and negative regulation of execution phase of apoptosis. Predicted to act upstream of or within negative regulation of apoptotic DNA fragmentation; positive regulation of apoptotic process; and thymocyte apoptotic process. Predicted to be located in cytosol; nucleus; and plasma membrane. Predicted to be part of protein-containing complex. Predicted to be active in chromatin. Orthologous to human DFFA (DNA fragmentation factor subunit alpha); PARTICIPATES IN apoptotic cell death pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
DNA fragmentation factor, alpha polypeptide; DNA fragmentation factor, alpha subunit; ICAD-S
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 164,823,807 - 164,836,729 (+) NCBI GRCr8 mRatBN7.2 5 159,540,715 - 159,553,639 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 159,540,715 - 159,553,633 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 162,257,408 - 162,270,330 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 164,078,196 - 164,091,121 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 164,034,568 - 164,047,493 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 165,922,893 - 165,935,822 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 165,922,915 - 165,935,821 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 169,573,089 - 169,586,003 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 166,179,130 - 166,192,029 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 166,189,332 - 166,200,048 (+) NCBI Celera 5 157,811,683 - 157,824,582 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dffa Rat (+)-catechin decreases degradation ISO Dffa (Mus musculus) 6480464 Catechin results in decreased degradation of DFFA protein CTD PMID:16753784 Dffa Rat (+)-dexrazoxane decreases expression ISO Dffa (Mus musculus) 6480464 Dexrazoxane results in decreased expression of DFFA mRNA CTD PMID:26873546 Dffa Rat (1->4)-beta-D-glucan multiple interactions ISO Dffa (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of DFFA mRNA CTD PMID:36331819 Dffa Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression EXP 6480464 o more ... CTD PMID:22937105 Dffa Rat 1,2-dichloroethane decreases expression ISO Dffa (Mus musculus) 6480464 ethylene dichloride results in decreased expression of DFFA mRNA CTD PMID:28960355 Dffa Rat 17beta-estradiol increases expression ISO DFFA (Homo sapiens) 6480464 Estradiol results in increased expression of DFFA mRNA CTD PMID:31614463 Dffa Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of DFFA mRNA CTD PMID:19520675 Dffa Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of DFFA mRNA CTD PMID:33387578 Dffa Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Dffa (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of DFFA mRNA CTD PMID:21570461 Dffa Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of DFFA mRNA CTD PMID:21346803 Dffa Rat 4,4'-sulfonyldiphenol increases expression ISO DFFA (Homo sapiens) 6480464 bisphenol S results in increased expression of DFFA protein CTD PMID:34186270 Dffa Rat 4-hydroxynon-2-enal decreases expression ISO DFFA (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of DFFA mRNA CTD PMID:12419474 Dffa Rat 5-aza-2'-deoxycytidine affects expression ISO DFFA (Homo sapiens) 6480464 Decitabine affects the expression of DFFA mRNA CTD PMID:23300844 Dffa Rat 5-fluorouracil decreases expression ISO DFFA (Homo sapiens) 6480464 Fluorouracil results in decreased expression of DFFA mRNA CTD PMID:34151400 Dffa Rat [6]-Shogaol increases degradation ISO DFFA (Homo sapiens) 6480464 shogaol results in increased degradation of DFFA protein CTD PMID:18384088 Dffa Rat aclacinomycin A increases degradation ISO DFFA (Homo sapiens) 6480464 Aclarubicin results in increased degradation of DFFA protein CTD PMID:12370496 Dffa Rat actinomycin D multiple interactions ISO DFFA (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of DFFA protein CTD PMID:38460933 Dffa Rat aflatoxin B1 increases methylation ISO DFFA (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of DFFA gene CTD PMID:28458013 Dffa Rat all-trans-retinoic acid multiple interactions ISO DFFA (Homo sapiens) 6480464 [Tretinoin co-treated with IFNG protein] results in increased cleavage of DFFA protein and [Tretinoin co-treated with Paclitaxel] results in increased cleavage of DFFA protein CTD PMID:17701358 and PMID:17960384 Dffa Rat all-trans-retinoic acid decreases expression ISO DFFA (Homo sapiens) 6480464 Tretinoin results in decreased expression of DFFA mRNA CTD PMID:33167477 Dffa Rat all-trans-retinoic acid increases cleavage ISO DFFA (Homo sapiens) 6480464 Tretinoin results in increased cleavage of DFFA protein CTD PMID:17960384 Dffa Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of DFFA mRNA CTD PMID:16483693 Dffa Rat antirheumatic drug increases expression ISO DFFA (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of DFFA mRNA CTD PMID:24449571 Dffa Rat arsane multiple interactions ISO DFFA (Homo sapiens) 6480464 [Arsenic co-treated with Fluorides] results in decreased expression of DFFA mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of DFFA mRNA CTD PMID:19962721 and PMID:39836092 Dffa Rat arsenic atom multiple interactions ISO DFFA (Homo sapiens) 6480464 [Arsenic co-treated with Fluorides] results in decreased expression of DFFA mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of DFFA mRNA CTD PMID:19962721 and PMID:39836092 Dffa Rat arsenite(3-) multiple interactions ISO DFFA (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to DFFA mRNA] CTD PMID:32406909 Dffa Rat arsenous acid increases expression ISO DFFA (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of DFFA mRNA CTD PMID:17530438 Dffa Rat arsenous acid increases expression EXP 6480464 Arsenic Trioxide results in increased expression of DFFA mRNA CTD PMID:19730151 Dffa Rat arsenous acid multiple interactions ISO DFFA (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to DFFA protein] CTD PMID:26598702 Dffa Rat atrazine multiple interactions ISO DFFA (Homo sapiens) 6480464 [Atrazine co-treated with Arsenates] results in increased expression of DFFA mRNA CTD PMID:18585445 Dffa Rat benzene increases expression EXP 6480464 Benzene results in increased expression of DFFA protein CTD PMID:17171516 Dffa Rat benzo[a]pyrene multiple interactions ISO Dffa (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of DFFA mRNA] CTD PMID:22228805 Dffa Rat benzo[a]pyrene affects methylation ISO DFFA (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of DFFA intron CTD PMID:30157460 Dffa Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of DFFA protein CTD PMID:21467743 Dffa Rat benzo[a]pyrene decreases expression ISO Dffa (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of DFFA mRNA CTD PMID:22228805 Dffa Rat bis(2-chloroethyl) sulfide increases cleavage ISO DFFA (Homo sapiens) 6480464 Mustard Gas results in increased cleavage of DFFA protein CTD PMID:12482751 Dffa Rat bisphenol A decreases expression ISO DFFA (Homo sapiens) 6480464 bisphenol A results in decreased expression of DFFA protein CTD PMID:21277958 Dffa Rat bisphenol A increases expression ISO DFFA (Homo sapiens) 6480464 bisphenol A results in increased expression of DFFA protein CTD PMID:37567409 Dffa Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DFFA mRNA CTD PMID:30816183 and PMID:32528016 Dffa Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of DFFA mRNA CTD PMID:25181051 Dffa Rat bisphenol A decreases expression ISO Dffa (Mus musculus) 6480464 bisphenol A results in decreased expression of DFFA mRNA CTD PMID:26063408 Dffa Rat cadmium atom multiple interactions ISO DFFA (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of DFFA mRNA CTD PMID:35301059 Dffa Rat cadmium dichloride multiple interactions ISO DFFA (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of DFFA mRNA CTD PMID:35301059 Dffa Rat caffeine decreases phosphorylation ISO DFFA (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of DFFA protein CTD PMID:35688186 Dffa Rat capsaicin decreases expression ISO DFFA (Homo sapiens) 6480464 Capsaicin results in decreased expression of DFFA CTD PMID:16188123 Dffa Rat carbamazepine affects expression ISO DFFA (Homo sapiens) 6480464 Carbamazepine affects the expression of DFFA mRNA CTD PMID:24752500 Dffa Rat celecoxib multiple interactions ISO DFFA (Homo sapiens) 6480464 TNFSF10 protein promotes the reaction [Celecoxib results in increased cleavage of DFFA protein] CTD PMID:15572759 Dffa Rat CGP 52608 multiple interactions ISO DFFA (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to DFFA gene] CTD PMID:28238834 Dffa Rat cisplatin affects expression ISO DFFA (Homo sapiens) 6480464 Cisplatin affects the expression of DFFA mRNA CTD PMID:23300844 Dffa Rat copper atom multiple interactions ISO DFFA (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of DFFA mRNA CTD PMID:30911355 Dffa Rat copper(0) multiple interactions ISO DFFA (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of DFFA mRNA CTD PMID:30911355 Dffa Rat cyclosporin A increases expression ISO DFFA (Homo sapiens) 6480464 Cyclosporine results in increased expression of DFFA mRNA CTD PMID:25562108 Dffa Rat daunorubicin increases degradation ISO DFFA (Homo sapiens) 6480464 Daunorubicin results in increased degradation of DFFA protein CTD PMID:12370496 Dffa Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of DFFA mRNA CTD PMID:23640034 Dffa Rat deoxynivalenol decreases phosphorylation ISO Dffa (Mus musculus) 6480464 deoxynivalenol results in decreased phosphorylation of DFFA protein CTD PMID:23811945 Dffa Rat diallyl trisulfide increases degradation ISO DFFA (Homo sapiens) 6480464 diallyl trisulfide results in increased degradation of DFFA protein CTD PMID:23754639 Dffa Rat diarsenic trioxide increases expression EXP 6480464 Arsenic Trioxide results in increased expression of DFFA mRNA CTD PMID:19730151 Dffa Rat diarsenic trioxide increases expression ISO DFFA (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of DFFA mRNA CTD PMID:17530438 Dffa Rat diarsenic trioxide multiple interactions ISO DFFA (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to DFFA protein] CTD PMID:26598702 Dffa Rat Dibutyl phosphate affects expression ISO DFFA (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of DFFA mRNA CTD PMID:37042841 Dffa Rat diclofenac affects expression ISO DFFA (Homo sapiens) 6480464 Diclofenac affects the expression of DFFA mRNA CTD PMID:24752500 Dffa Rat dimethyl sulfoxide increases cleavage ISO Dffa (Mus musculus) 6480464 Dimethyl Sulfoxide results in increased cleavage of DFFA protein CTD PMID:22535522 Dffa Rat dorsomorphin multiple interactions ISO DFFA (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Dffa Rat doxorubicin increases degradation ISO DFFA (Homo sapiens) 6480464 Doxorubicin results in increased degradation of DFFA protein CTD PMID:12370496 Dffa Rat doxorubicin increases expression ISO Dffa (Mus musculus) 6480464 Doxorubicin results in increased expression of DFFA mRNA CTD PMID:26873546 Dffa Rat ellagic acid decreases expression ISO DFFA (Homo sapiens) 6480464 Ellagic Acid results in decreased expression of DFFA mRNA CTD PMID:12002526 Dffa Rat embelin increases cleavage ISO DFFA (Homo sapiens) 6480464 embelin results in increased cleavage of DFFA protein CTD PMID:28722333 Dffa Rat enzyme inhibitor multiple interactions ISO DFFA (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of DFFA protein CTD PMID:23301498 Dffa Rat equol increases activity ISO DFFA (Homo sapiens) 6480464 Equol results in increased activity of DFFA protein CTD PMID:18973749 Dffa Rat ethanol increases cleavage ISO Dffa (Mus musculus) 6480464 Ethanol results in increased cleavage of DFFA protein CTD PMID:22535522 Dffa Rat fenamidone decreases expression ISO Dffa (Mus musculus) 6480464 fenamidone results in decreased expression of DFFA mRNA CTD PMID:27029645 Dffa Rat folic acid decreases expression ISO Dffa (Mus musculus) 6480464 Folic Acid results in decreased expression of DFFA mRNA CTD PMID:25629700 Dffa Rat FR900359 affects phosphorylation ISO DFFA (Homo sapiens) 6480464 FR900359 affects the phosphorylation of DFFA protein CTD PMID:37730182 Dffa Rat furosemide affects expression EXP 6480464 Furosemide affects the expression of DFFA mRNA CTD PMID:17497460 Dffa Rat genistein decreases expression ISO Dffa (Mus musculus) 6480464 Genistein results in decreased expression of DFFA mRNA CTD PMID:30056207 Dffa Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of DFFA mRNA CTD PMID:33387578 Dffa Rat glyphosate decreases expression ISO DFFA (Homo sapiens) 6480464 Glyphosate results in decreased expression of DFFA mRNA CTD PMID:31295307 Dffa Rat hydrogen peroxide multiple interactions EXP 6480464 Quercetin inhibits the reaction [Hydrogen Peroxide results in increased degradation of DFFA protein] CTD PMID:14505808 Dffa Rat hydrogen peroxide increases degradation EXP 6480464 Hydrogen Peroxide results in increased degradation of DFFA protein CTD PMID:14505808 Dffa Rat isoflurane decreases expression EXP 6480464 Isoflurane results in decreased expression of DFFA mRNA CTD PMID:16978161 Dffa Rat ivermectin decreases expression ISO DFFA (Homo sapiens) 6480464 Ivermectin results in decreased expression of DFFA protein CTD PMID:32959892 Dffa Rat metformin multiple interactions ISO DFFA (Homo sapiens) 6480464 [Paclitaxel co-treated with Metformin] results in decreased expression of DFFA mRNA CTD PMID:29309887 Dffa Rat methyl methanesulfonate decreases expression ISO DFFA (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of DFFA mRNA CTD PMID:23649840 Dffa Rat Mitotane increases expression EXP 6480464 Mitotane results in increased expression of DFFA mRNA CTD PMID:23485034 Dffa Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Dffa (Mus musculus) 6480464 DFFA protein inhibits the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased ubiquitination of DFFB protein] CTD PMID:18178165 Dffa Rat nickel atom increases expression ISO DFFA (Homo sapiens) 6480464 Nickel results in increased expression of DFFA mRNA CTD PMID:25583101 Dffa Rat Nutlin-3 multiple interactions ISO DFFA (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of DFFA protein CTD PMID:38460933 Dffa Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of DFFA protein CTD PMID:19562491 Dffa Rat oxybenzone increases expression EXP 6480464 oxybenzone results in increased expression of DFFA mRNA CTD PMID:30316929 Dffa Rat p-menthan-3-ol increases expression ISO DFFA (Homo sapiens) 6480464 Menthol results in increased expression of DFFA mRNA CTD PMID:26760959 Dffa Rat paclitaxel multiple interactions ISO DFFA (Homo sapiens) 6480464 [Paclitaxel co-treated with Metformin] results in decreased expression of DFFA mRNA and [Tretinoin co-treated with Paclitaxel] results in increased cleavage of DFFA protein CTD PMID:17701358 and PMID:29309887 Dffa Rat paclitaxel increases cleavage ISO DFFA (Homo sapiens) 6480464 Paclitaxel results in increased cleavage of DFFA protein CTD PMID:18098270 Dffa Rat paclitaxel decreases expression ISO DFFA (Homo sapiens) 6480464 Paclitaxel results in decreased expression of DFFA protein CTD PMID:15907983 Dffa Rat paracetamol increases cleavage ISO Dffa (Mus musculus) 6480464 Acetaminophen results in increased cleavage of DFFA protein CTD PMID:14725611 Dffa Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of DFFA mRNA CTD PMID:33387578 Dffa Rat paracetamol decreases expression ISO DFFA (Homo sapiens) 6480464 Acetaminophen results in decreased expression of DFFA mRNA CTD PMID:21420995 Dffa Rat paracetamol increases response to substance ISO Dffa (Mus musculus) 6480464 DFFA protein results in increased susceptibility to Acetaminophen CTD PMID:14725611 Dffa Rat paracetamol multiple interactions ISO Dffa (Mus musculus) 6480464 DFFA affects the reaction [Acetaminophen results in increased cleavage of CASP3 protein] CTD PMID:14725611 Dffa Rat paraquat increases expression ISO DFFA (Homo sapiens) 6480464 Paraquat results in increased expression of DFFA mRNA CTD PMID:18836921 Dffa Rat Parthenin increases cleavage ISO DFFA (Homo sapiens) 6480464 parthenin analog results in increased cleavage of DFFA protein CTD PMID:25196075 Dffa Rat pentobarbital decreases expression EXP 6480464 Pentobarbital results in decreased expression of DFFA mRNA CTD PMID:16978161 Dffa Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Dffa (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of DFFA mRNA CTD PMID:36331819 Dffa Rat phenylmercury acetate increases expression ISO DFFA (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of DFFA mRNA CTD PMID:26272509 Dffa Rat phenylmercury acetate multiple interactions ISO DFFA (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DFFA mRNA CTD PMID:27188386 Dffa Rat piroxicam decreases expression ISO DFFA (Homo sapiens) 6480464 Piroxicam results in decreased expression of DFFA mRNA CTD PMID:21858171 Dffa Rat pterostilbene increases cleavage ISO Dffa (Mus musculus) 6480464 pterostilbene results in increased cleavage of DFFA protein CTD PMID:20681671 Dffa Rat pyrethrins increases expression ISO DFFA (Homo sapiens) 6480464 Pyrethrins results in increased expression of DFFA mRNA CTD PMID:35321623 Dffa Rat quercetin increases expression ISO DFFA (Homo sapiens) 6480464 Quercetin results in increased expression of DFFA mRNA CTD PMID:21632981 and PMID:23727915 Dffa Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [Hydrogen Peroxide results in increased degradation of DFFA protein] CTD PMID:14505808 Dffa Rat resveratrol decreases expression ISO DFFA (Homo sapiens) 6480464 resveratrol results in decreased expression of DFFA mRNA CTD PMID:12002526 Dffa Rat resveratrol increases expression ISO DFFA (Homo sapiens) 6480464 resveratrol results in increased expression of DFFA mRNA CTD PMID:12569576 Dffa Rat SB 431542 multiple interactions ISO DFFA (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Dffa Rat silver atom decreases expression ISO Dffa (Mus musculus) 6480464 Silver results in decreased expression of DFFA mRNA CTD PMID:27131904 Dffa Rat silver(0) decreases expression ISO Dffa (Mus musculus) 6480464 Silver results in decreased expression of DFFA mRNA CTD PMID:27131904 Dffa Rat sodium arsenite decreases expression ISO DFFA (Homo sapiens) 6480464 sodium arsenite results in decreased expression of DFFA mRNA CTD PMID:12760830 and PMID:38568856 Dffa Rat sodium arsenite multiple interactions ISO DFFA (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of DFFA mRNA CTD PMID:39836092 Dffa Rat sodium fluoride increases expression ISO Dffa (Mus musculus) 6480464 Sodium Fluoride results in increased expression of DFFA mRNA CTD PMID:21340527 Dffa Rat sunitinib decreases expression ISO DFFA (Homo sapiens) 6480464 Sunitinib results in decreased expression of DFFA mRNA CTD PMID:31533062 Dffa Rat T-2 toxin increases expression ISO DFFA (Homo sapiens) 6480464 T-2 Toxin results in increased expression of DFFA mRNA CTD PMID:34581912 Dffa Rat temozolomide increases expression ISO DFFA (Homo sapiens) 6480464 Temozolomide results in increased expression of DFFA mRNA CTD PMID:31758290 Dffa Rat titanium dioxide decreases methylation ISO Dffa (Mus musculus) 6480464 titanium dioxide results in decreased methylation of DFFA promoter alternative form CTD PMID:35295148 Dffa Rat triphenyl phosphate affects expression ISO DFFA (Homo sapiens) 6480464 triphenyl phosphate affects the expression of DFFA mRNA CTD PMID:37042841 Dffa Rat usnic acid increases expression ISO DFFA (Homo sapiens) 6480464 usnic acid results in increased expression of DFFA mRNA CTD PMID:32508146 Dffa Rat valproic acid decreases methylation ISO DFFA (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of DFFA gene CTD PMID:29154799 Dffa Rat valproic acid multiple interactions ISO DFFA (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DFFA mRNA CTD PMID:27188386 Dffa Rat valproic acid increases expression ISO DFFA (Homo sapiens) 6480464 Valproic Acid results in increased expression of DFFA mRNA CTD PMID:23179753 more ... Dffa Rat valproic acid affects expression ISO DFFA (Homo sapiens) 6480464 Valproic Acid affects the expression of DFFA mRNA CTD PMID:25979313 Dffa Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of DFFA mRNA CTD PMID:23034163 Dffa Rat zoledronic acid decreases expression ISO DFFA (Homo sapiens) 6480464 zoledronic acid results in decreased expression of DFFA mRNA CTD PMID:20977926
Imported Annotations - KEGG (archival)
(+)-catechin (ISO) (+)-dexrazoxane (ISO) (1->4)-beta-D-glucan (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP) 1,2-dichloroethane (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) [6]-Shogaol (ISO) aclacinomycin A (ISO) actinomycin D (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (EXP,ISO) atrazine (ISO) benzene (EXP) benzo[a]pyrene (EXP,ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) capsaicin (ISO) carbamazepine (ISO) celecoxib (ISO) CGP 52608 (ISO) cisplatin (ISO) copper atom (ISO) copper(0) (ISO) cyclosporin A (ISO) daunorubicin (ISO) decabromodiphenyl ether (EXP) deoxynivalenol (ISO) diallyl trisulfide (ISO) diarsenic trioxide (EXP,ISO) Dibutyl phosphate (ISO) diclofenac (ISO) dimethyl sulfoxide (ISO) dorsomorphin (ISO) doxorubicin (ISO) ellagic acid (ISO) embelin (ISO) enzyme inhibitor (ISO) equol (ISO) ethanol (ISO) fenamidone (ISO) folic acid (ISO) FR900359 (ISO) furosemide (EXP) genistein (ISO) gentamycin (EXP) glyphosate (ISO) hydrogen peroxide (EXP) isoflurane (EXP) ivermectin (ISO) metformin (ISO) methyl methanesulfonate (ISO) Mitotane (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) nickel atom (ISO) Nutlin-3 (ISO) ochratoxin A (EXP) oxybenzone (EXP) p-menthan-3-ol (ISO) paclitaxel (ISO) paracetamol (EXP,ISO) paraquat (ISO) Parthenin (ISO) pentobarbital (EXP) perfluorooctane-1-sulfonic acid (ISO) phenylmercury acetate (ISO) piroxicam (ISO) pterostilbene (ISO) pyrethrins (ISO) quercetin (EXP,ISO) resveratrol (ISO) SB 431542 (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sunitinib (ISO) T-2 toxin (ISO) temozolomide (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) usnic acid (ISO) valproic acid (ISO) vinclozolin (EXP) zoledronic acid (ISO)
Dffa Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 164,823,807 - 164,836,729 (+) NCBI GRCr8 mRatBN7.2 5 159,540,715 - 159,553,639 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 159,540,715 - 159,553,633 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 162,257,408 - 162,270,330 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 164,078,196 - 164,091,121 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 164,034,568 - 164,047,493 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 165,922,893 - 165,935,822 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 165,922,915 - 165,935,821 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 169,573,089 - 169,586,003 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 166,179,130 - 166,192,029 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 166,189,332 - 166,200,048 (+) NCBI Celera 5 157,811,683 - 157,824,582 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
DFFA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 10,456,522 - 10,472,529 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 10,456,522 - 10,472,529 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 10,516,579 - 10,532,586 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 10,443,175 - 10,455,200 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 9,631,993 - 9,644,017 (-) NCBI Celera Cytogenetic Map 1 p36.22 NCBI HuRef 1 9,674,182 - 9,686,174 (-) NCBI HuRef CHM1_1 1 10,508,330 - 10,520,370 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 10,000,139 - 10,016,137 (-) NCBI T2T-CHM13v2.0
Dffa Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 149,188,599 - 149,205,110 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 149,188,603 - 149,205,104 (+) Ensembl GRCm39 Ensembl GRCm38 4 149,104,142 - 149,120,653 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 149,104,146 - 149,120,647 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 148,478,262 - 148,494,759 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 147,947,953 - 147,964,450 (+) NCBI MGSCv36 mm8 Celera 4 151,371,738 - 151,386,868 (+) NCBI Celera Cytogenetic Map 4 E2 NCBI cM Map 4 78.87 NCBI
Dffa Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955486 3,273,712 - 3,274,510 (+) NCBI ChiLan1.0 ChiLan1.0
DFFA Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 217,754,203 - 217,768,613 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 216,400,486 - 216,414,533 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 9,221,096 - 9,232,813 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 10,445,553 - 10,457,547 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 10,445,553 - 10,457,547 (-) Ensembl panpan1.1 panPan2
DFFA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 85,364,819 - 85,372,473 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 85,364,851 - 85,373,772 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 81,966,306 - 81,973,968 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 86,099,825 - 86,107,488 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 86,099,863 - 86,109,086 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 82,847,197 - 82,854,858 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 83,849,698 - 83,857,360 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 84,912,608 - 84,920,270 (+) NCBI UU_Cfam_GSD_1.0
Dffa Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 33,811,757 - 33,821,826 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936623 4,296,681 - 4,307,159 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936623 4,296,995 - 4,307,069 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DFFA Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 70,724,590 - 70,736,236 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 70,725,403 - 70,736,264 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 64,658,250 - 64,669,091 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DFFA Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 121,312,291 - 121,324,055 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 121,311,954 - 121,323,402 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 25,226,082 - 25,238,468 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dffa
.
Assembly: RGSC_v3.4 Assembly: Rnor_6.0
Predicted Target Of
Count of predictions: 568 Count of miRNA genes: 265 Interacting mature miRNAs: 357 Transcripts: ENSRNOT00000059522 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 631272 Lanf1 Left ventricular atrial natriuretic factor QTL 1 12 heart left ventricle natriuretic peptide A amount (VT:0010596) heart left ventricle natriuretic peptide A level (CMO:0002165) 5 151113452 166875058 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2302369 Scl60 Serum cholesterol level QTL 60 3.13 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 143608201 161165651 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1549904 Neuinf1 Neuroinflammation QTL 1 3 0 nervous system integrity trait (VT:0010566) blood T lymphocyte count (CMO:0000110) 5 154828214 166875058 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 2313096 Bmd78 Bone mineral density QTL 78 3.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 5 144377876 161317411 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 1354631 Swd2 Spike wave discharge measurement QTL 2 3.64 0.0002 brain electrophysiology trait (VT:0010557) brain total spike-and-wave discharge duration (CMO:0001740) 5 151113452 164465185 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 1298090 Bp155 Blood pressure QTL 155 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 151006154 161165494 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000059522 ⟹ ENSRNOP00000063043
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 159,540,715 - 159,553,633 (+) Ensembl Rnor_6.0 Ensembl 5 165,922,923 - 165,935,821 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000089179 ⟹ ENSRNOP00000070485
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 165,922,915 - 165,935,820 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000102581 ⟹ ENSRNOP00000094512
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 159,540,962 - 159,553,633 (+) Ensembl
RefSeq Acc Id:
NM_001398977 ⟹ NP_001385906
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 164,823,807 - 164,836,729 (+) NCBI mRatBN7.2 5 159,540,715 - 159,553,639 (+) NCBI
RefSeq Acc Id:
NM_053679 ⟹ NP_446131
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 164,823,807 - 164,836,729 (+) NCBI mRatBN7.2 5 159,540,715 - 159,553,639 (+) NCBI Rnor_6.0 5 165,922,923 - 165,935,822 (+) NCBI Rnor_5.0 5 169,573,089 - 169,586,003 (+) NCBI RGSC_v3.4 5 166,179,130 - 166,192,029 (+) RGD Celera 5 157,811,683 - 157,824,582 (+) RGD
Sequence:
GGCAAAGCTTAGGGAAGCCGCTCTGGGCTACCTGGGATTTCCCAGAGTCGCCAAGTCCCACTTTGAGGATGGAGCTATCCCGGGGAGCCAGCGCCCCGGACCCGGACGATGTCGGGCCTCTCAAACCG
hide sequence
RefSeq Acc Id:
NP_446131 ⟸ NM_053679
- Peptide Label:
isoform 2
- UniProtKB:
Q498U6 (UniProtKB/TrEMBL), F7FCC9 (UniProtKB/TrEMBL), Q9JLT3 (UniProtKB/TrEMBL)
- Sequence:
MELSRGASAPDPDDVGPLKPCLLRRNHSREQHGVAASSLEELRSKACELLAIDKSLTPVTLVLAEDGTIVDDEDYFLCLPSNTKFVALACNEKWAYNDSDGGTAWLSQESFDTDQTDSGAGVKWKNVA
hide sequence
Ensembl Acc Id:
ENSRNOP00000070485 ⟸ ENSRNOT00000089179
Ensembl Acc Id:
ENSRNOP00000063043 ⟸ ENSRNOT00000059522
Ensembl Acc Id:
ENSRNOP00000094512 ⟸ ENSRNOT00000102581
RefSeq Acc Id:
NP_001385906 ⟸ NM_001398977
- Peptide Label:
isoform 1
RGD ID: 13694268 Promoter ID: EPDNEW_R4793 Type: multiple initiation site Name: Dffa_1 Description: DNA fragmentation factor subunit alpha SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 165,922,966 - 165,923,026 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-26
Dffa
DNA fragmentation factor subunit alpha
Dffa
DNA fragmentation factor, alpha polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-02-25
Dffa
DNA fragmentation factor, alpha polypeptide
Dffa
DNA fragmentation factor, alpha subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Dffa
DNA fragmentation factor, alpha subunit
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Dffa
DNA fragmentation factor, alpha subunit
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_cellular_localization
localized to the nucleus
632505
gene_physical_interaction
forms a complex with DFF40/caspase-activated DNase (CAD)
632505
