Symbol:
Akr7a2
Name:
aldo-keto reductase family 7, member A2
RGD ID:
620311
Description:
Enables aldose reductase (NADPH) activity. Predicted to be involved in daunorubicin metabolic process and doxorubicin metabolic process. Located in nuclear envelope. Orthologous to human AKR7A2 (aldo-keto reductase family 7 member A2); INTERACTS WITH (+)-schisandrin B; 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
aflatoxin B1 aldehyde reductase member 2; Aiar; aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase); rAFAR2; SSA reductase; succinic semialdehyde reductase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
AKR7A2 (aldo-keto reductase family 7 member A2)
HGNC
Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Akr7a5 (aldo-keto reductase family 7, member A5)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Akr7a2 (aldo-keto reductase family 7 member A2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOC100981962 (aflatoxin B1 aldehyde reductase member 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
AKR7A2 (aldo-keto reductase family 7 member A2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101974041 (aflatoxin B1 aldehyde reductase member 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
AKR7A2 (aldo-keto reductase family 7 member A2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LOC103225480 (aflatoxin B1 aldehyde reductase member 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
AKR7A3 (aldo-keto reductase family 7 member A3)
HGNC
OrthoDB
Homo sapiens (human):
AKR7L (aldo-keto reductase family 7 like (gene/pseudogene))
HGNC
Ensembl
Alliance orthologs 3
Homo sapiens (human):
AKR7A2 (aldo-keto reductase family 7 member A2)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Mus musculus (house mouse):
Akr7a5 (aldo-keto reductase family 7, member A5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Akr7a5 (aldo-keto reductase family 7, member A5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
akr7a3 (aldo-keto reductase family 7, member A3 (aflatoxin aldehyde reductase))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
AAD10
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoInspector)
Saccharomyces cerevisiae (baker's yeast):
AAD14
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoInspector)
Caenorhabditis elegans (roundworm):
mec-14
Alliance
DIOPT (Ensembl Compara|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):
akr7a2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
akr7a2
Alliance
DIOPT (OMA|OrthoFinder|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 156,835,589 - 156,844,127 (+) NCBI GRCr8 GRCr8 Ensembl 5 156,835,551 - 156,844,109 (+) Ensembl GRCr8 Ensembl mRatBN7.2 5 151,552,375 - 151,560,914 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 151,552,343 - 151,560,909 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 154,250,866 - 154,259,404 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 156,025,214 - 156,033,752 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 156,006,202 - 156,014,739 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 157,759,448 - 157,768,473 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 157,759,416 - 157,768,471 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 161,499,603 - 161,508,628 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 158,097,679 - 158,106,217 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 149,932,592 - 149,941,127 (+) NCBI Celera RGSC_v3.1 5 158,107,717 - 158,116,254 (+) NCBI Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Akr7a2 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of AKR7A2 mRNA] CTD PMID:31150632 Akr7a2 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane affects expression EXP 6480464 o,p'-DDT affects the expression of AKR7A2 mRNA CTD PMID:17984292 Akr7a2 Rat 1,2-dimethylhydrazine increases expression ISO Akr7a5 (Mus musculus) 6480464 1,2-Dimethylhydrazine results in increased expression of AKR7A5 mRNA CTD PMID:22206623 Akr7a2 Rat 1,2-dimethylhydrazine multiple interactions ISO Akr7a5 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of AKR7A5 mRNA] CTD PMID:22206623 Akr7a2 Rat 1,2-naphthoquinone increases reduction ISO AKR7A2 (Homo sapiens) 6480464 AKR7A2 protein results in increased reduction of 1,2-naphthoquinone CTD PMID:10510318 Akr7a2 Rat 14-Deoxy-11,12-didehydroandrographolide decreases expression ISO AKR7A2 (Homo sapiens) 6480464 14-deoxy-11,12-didehydroandrographolide results in decreased expression of AKR7A2 mRNA CTD PMID:22101062 Akr7a2 Rat 16-Ketoestrone increases reduction ISO AKR7A2 (Homo sapiens) 6480464 AKR7A2 protein results in increased reduction of 16-ketoestrone CTD PMID:10510318 Akr7a2 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of AKR7A5 mRNA CTD PMID:16926038 Akr7a2 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of AKR7A2 mRNA CTD PMID:26496021 Akr7a2 Rat 17beta-estradiol increases expression ISO Akr7a5 (Mus musculus) 6480464 Estradiol results in increased expression of AKR7A5 mRNA CTD PMID:39298647 Akr7a2 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2,2',4,4'-tetrabromodiphenyl ether results in increased expression of AKR7A2 mRNA CTD PMID:21394737|PMID:31826744|PMID:32679240 Akr7a2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of AKR7A2 mRNA CTD PMID:18796159|PMID:33387578 Akr7a2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of AKR7A2 mRNA CTD PMID:32109520|PMID:34747641 Akr7a2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Akr7a5 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of AKR7A5 mRNA CTD PMID:21570461 Akr7a2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Akr7a5 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of AKR7A5 mRNA CTD PMID:19465110 Akr7a2 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of AKR7A2 mRNA CTD PMID:21346803 Akr7a2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression EXP 6480464 2,2',4,4',5-brominated diphenyl ether results in decreased expression of AKR7A2 protein CTD PMID:19954255 Akr7a2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Akr7a5 (Mus musculus) 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of AKR7A5 mRNA CTD PMID:38648751 Akr7a2 Rat 2,6-dimethoxyphenol multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization more ... CTD PMID:38598786 Akr7a2 Rat 2-methylcholine affects expression ISO AKR7A2 (Homo sapiens) 6480464 beta-methylcholine affects the expression of AKR7A2 mRNA CTD PMID:21179406 Akr7a2 Rat 2-nitrobenzaldehyde increases reduction ISO AKR7A2 (Homo sapiens) 6480464 AKR7A2 protein results in increased reduction of 2-nitrobenzaldehyde CTD PMID:10510318 Akr7a2 Rat 2-nitrobenzaldehyde affects reduction ISO Akr7a5 (Mus musculus) 6480464 2-nitrobenzaldehyde affects the reduction of AKR7A5 protein CTD PMID:12604212 Akr7a2 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO AKR7A2 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of AKR7A2 protein CTD PMID:31675489 Akr7a2 Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of AKR7A2 mRNA CTD PMID:30071829 Akr7a2 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of AKR7A2 protein CTD PMID:34915118 Akr7a2 Rat 3-nitrobenzaldehyde affects reduction ISO Akr7a5 (Mus musculus) 6480464 3-nitrobenzaldehyde affects the reduction of AKR7A5 protein; 3-nitrobenzaldehyde analog affects the reduction of AKR7A5 protein CTD PMID:12604212 Akr7a2 Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1,2-dithiol-3-thione results in increased expression of AKR7A2 mRNA CTD PMID:19162173 Akr7a2 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Akr7a5 (Mus musculus) 6480464 4,4'-diaminodiphenylmethane results in decreased expression of AKR7A5 mRNA CTD PMID:18648102 Akr7a2 Rat 4,4'-sulfonyldiphenol increases expression ISO Akr7a5 (Mus musculus) 6480464 bisphenol S results in increased expression of AKR7A5 mRNA CTD PMID:39298647 Akr7a2 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2,6-dinitrotoluene affects the expression of AKR7A2 mRNA CTD PMID:21346803 Akr7a2 Rat 4-hydroxynon-2-enal decreases response to substance ISO AKR7A2 (Homo sapiens) 6480464 AKR7A2 protein results in decreased susceptibility to 4-hydroxy-2-nonenal CTD PMID:22001351 Akr7a2 Rat 4-hydroxynon-2-enal affects response to substance ISO AKR7A2 (Homo sapiens) 6480464 AKR7A2 protein affects the susceptibility to 4-hydroxy-2-nonenal CTD PMID:30849339 Akr7a2 Rat 4-hydroxynon-2-enal increases response to substance ISO AKR7A2 (Homo sapiens) 6480464 AKR7A2 mutant form results in increased susceptibility to 4-hydroxy-2-nonenal CTD PMID:22964423 Akr7a2 Rat 4-hydroxynon-2-enal multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 7-hydroxycoumarin affects the reaction [AKR7A2 mutant form results in increased susceptibility to 4-hydroxy-2-nonenal]; AKR7A2 protein more ... CTD PMID:22964423|PMID:30849339 Akr7a2 Rat 4-hydroxynon-2-enal increases expression ISO AKR7A2 (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in increased expression of AKR7A2 mRNA; 4-hydroxy-2-nonenal results in increased expression of AKR7A2 more ... CTD PMID:22964423|PMID:30849339 Akr7a2 Rat 4-nitrobenzaldehyde multiple interactions ISO Akr7a5 (Mus musculus) 6480464 Ethacrynic Acid inhibits the reaction [4-nitrobenzaldehyde affects the reduction of AKR7A5 protein]; Indomethacin inhibits the more ... CTD PMID:12604212 Akr7a2 Rat 4-nitrobenzaldehyde affects reduction ISO Akr7a5 (Mus musculus) 6480464 4-nitrobenzaldehyde affects the reduction of AKR7A5 protein CTD PMID:12604212 Akr7a2 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of AKR7A2 mRNA CTD PMID:19483382 Akr7a2 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of AKR7A2 mRNA CTD PMID:19483382 Akr7a2 Rat 7,12-dimethyltetraphene multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 AKR7A2 protein results in increased reduction of and affects the activity of 9,10-Dimethyl-1,2-benzanthracene CTD PMID:21910479 Akr7a2 Rat 9,10-phenanthroquinone increases reduction ISO AKR7A2 (Homo sapiens) 6480464 AKR7A2 protein results in increased reduction of 9,10-phenanthrenequinone CTD PMID:10510318 Akr7a2 Rat 9,10-phenanthroquinone multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 AKR7A2 protein results in increased reduction of and affects the activity of 9,10-phenanthrenequinone CTD PMID:21910479 Akr7a2 Rat 9,10-phenanthroquinone affects reduction ISO Akr7a5 (Mus musculus) 6480464 9,10-phenanthrenequinone affects the reduction of AKR7A5 protein CTD PMID:12604212 Akr7a2 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of AKR7A2 mRNA CTD PMID:31881176 Akr7a2 Rat acrolein multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Akr7a2 Rat acrylamide decreases expression ISO AKR7A2 (Homo sapiens) 6480464 Acrylamide results in decreased expression of AKR7A2 mRNA CTD PMID:32763439 Akr7a2 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of AKR7A2 mRNA CTD PMID:22545673 Akr7a2 Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of AKR7A2 mRNA CTD PMID:23630614 Akr7a2 Rat Aflatoxin B2 alpha decreases methylation ISO AKR7A2 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of AKR7A2 3' UTR CTD PMID:30157460 Akr7a2 Rat alpha-pinene multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Akr7a2 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of AKR7A2 mRNA CTD PMID:19483382 Akr7a2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of AKR7A2 mRNA CTD PMID:16483693 Akr7a2 Rat antimycin A decreases expression ISO AKR7A2 (Homo sapiens) 6480464 Antimycin A results in decreased expression of AKR7A2 mRNA CTD PMID:33512557 Akr7a2 Rat aristolochic acid A increases expression ISO AKR7A2 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of AKR7A2 protein CTD PMID:33212167 Akr7a2 Rat Aroclor 1254 decreases expression ISO Akr7a5 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of AKR7A5 mRNA CTD PMID:23650126 Akr7a2 Rat atorvastatin calcium increases expression ISO AKR7A2 (Homo sapiens) 6480464 Atorvastatin results in increased expression of AKR7A2 mRNA; Atorvastatin results in increased expression of AKR7A2 more ... CTD PMID:38484826 Akr7a2 Rat azoxystrobin decreases expression ISO AKR7A2 (Homo sapiens) 6480464 azoxystrobin results in decreased expression of AKR7A2 mRNA CTD PMID:33512557 Akr7a2 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of AKR7A2 mRNA CTD PMID:19483382 Akr7a2 Rat benzo[a]pyrene-7,8-dione multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [[AKR7A2 protein co-treated with NADP] results in increased reduction of and affects the activity of more ... CTD PMID:21910479 Akr7a2 Rat beta-naphthoflavone increases expression EXP 6480464 beta-Naphthoflavone results in increased expression of AKR7A2 mRNA; beta-Naphthoflavone results in increased expression of AKR7A2 more ... CTD PMID:19389873 Akr7a2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of AKR7A2 mRNA CTD PMID:26496021 Akr7a2 Rat bisphenol A decreases expression ISO Akr7a5 (Mus musculus) 6480464 bisphenol A results in decreased expression of AKR7A5 mRNA CTD PMID:35598803 Akr7a2 Rat bisphenol A multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of AKR7A2 gene CTD PMID:31601247 Akr7a2 Rat bisphenol A decreases methylation ISO AKR7A2 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of AKR7A2 gene CTD PMID:31601247 Akr7a2 Rat bisphenol A increases expression ISO Akr7a5 (Mus musculus) 6480464 bisphenol A results in increased expression of AKR7A5 mRNA CTD PMID:33221593 Akr7a2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of AKR7A2 mRNA CTD PMID:30816183 Akr7a2 Rat bisphenol A affects expression ISO AKR7A2 (Homo sapiens) 6480464 bisphenol A affects the expression of AKR7A2 mRNA CTD PMID:30903817 Akr7a2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of AKR7A2 gene CTD PMID:28505145 Akr7a2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of AKR7A2 mRNA CTD PMID:25181051 Akr7a2 Rat bisphenol AF increases expression ISO AKR7A2 (Homo sapiens) 6480464 bisphenol AF results in increased expression of AKR7A2 protein CTD PMID:34186270 Akr7a2 Rat bisphenol F increases expression ISO AKR7A2 (Homo sapiens) 6480464 bisphenol F results in increased expression of AKR7A2 protein CTD PMID:34186270 Akr7a2 Rat bortezomib multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [BRCA1 mutant form results in increased susceptibility to Bortezomib] which results in decreased expression of more ... CTD PMID:25522274 Akr7a2 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of AKR7A2 protein CTD PMID:28903499 Akr7a2 Rat cadmium atom multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of AKR7A2 more ... CTD PMID:35301059 Akr7a2 Rat cadmium dichloride multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of AKR7A2 more ... CTD PMID:35301059 Akr7a2 Rat CGP 52608 multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to AKR7A2 gene] CTD PMID:28238834 Akr7a2 Rat chenodeoxycholic acid multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650|PMID:33819548 Akr7a2 Rat chlordecone multiple interactions ISO Akr7a5 (Mus musculus) 6480464 Chlordecone promotes the reaction [Biomarkers metabolite binds to AKR7A5 gene] CTD PMID:31084621 Akr7a2 Rat cisplatin increases expression ISO AKR7A2 (Homo sapiens) 6480464 Cisplatin results in increased expression of AKR7A2 mRNA CTD PMID:27594783 Akr7a2 Rat clofibrate decreases expression ISO Akr7a5 (Mus musculus) 6480464 Clofibrate results in decreased expression of AKR7A5 mRNA CTD PMID:17585979 Akr7a2 Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of AKR7A2 protein CTD PMID:16470657 Akr7a2 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of AKR7A2 mRNA CTD PMID:19483382 Akr7a2 Rat cobalt dichloride decreases expression ISO AKR7A2 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of AKR7A2 mRNA CTD PMID:19376846 Akr7a2 Rat copper(II) sulfate decreases expression ISO AKR7A2 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of AKR7A2 mRNA CTD PMID:19549813 Akr7a2 Rat cyclosporin A decreases expression ISO AKR7A2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of AKR7A2 mRNA CTD PMID:20106945|PMID:25562108 Akr7a2 Rat cyclosporin A multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650 Akr7a2 Rat deguelin decreases expression ISO AKR7A2 (Homo sapiens) 6480464 deguelin results in decreased expression of AKR7A2 mRNA CTD PMID:33512557 Akr7a2 Rat deoxycholic acid multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650|PMID:33819548 Akr7a2 Rat Dibutyl phosphate affects expression ISO AKR7A2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of AKR7A2 mRNA CTD PMID:37042841 Akr7a2 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of AKR7A2 mRNA CTD PMID:21266533 Akr7a2 Rat dibutyl phthalate decreases expression ISO Akr7a5 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of AKR7A5 mRNA CTD PMID:17361019|PMID:21266533 Akr7a2 Rat dimethylarsinic acid multiple interactions ISO Akr7a5 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 Akr7a2 Rat dioxygen multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [[AKR7A2 protein co-treated with NADP] results in increased reduction of and affects the activity of more ... CTD PMID:21910479 Akr7a2 Rat doxorubicin increases metabolic processing ISO AKR7A2 (Homo sapiens) 6480464 AKR7A2 results in increased metabolism of Doxorubicin CTD PMID:20837989 Akr7a2 Rat doxorubicin increases phosphorylation ISO AKR7A2 (Homo sapiens) 6480464 Doxorubicin results in increased phosphorylation of AKR7A2 protein CTD PMID:30817976 Akr7a2 Rat doxorubicin decreases expression ISO AKR7A2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of AKR7A2 mRNA CTD PMID:30817976 Akr7a2 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of AKR7A2 mRNA CTD PMID:29391264 Akr7a2 Rat epoxiconazole increases expression ISO Akr7a5 (Mus musculus) 6480464 epoxiconazole results in increased expression of AKR7A5 mRNA CTD PMID:35436446 Akr7a2 Rat etacrynic acid multiple interactions ISO Akr7a5 (Mus musculus) 6480464 Ethacrynic Acid inhibits the reaction [4-nitrobenzaldehyde affects the reduction of AKR7A5 protein] CTD PMID:12604212 Akr7a2 Rat fenpyroximate decreases expression ISO AKR7A2 (Homo sapiens) 6480464 fenpyroximate results in decreased expression of AKR7A2 mRNA CTD PMID:33512557 Akr7a2 Rat folic acid multiple interactions ISO Akr7a5 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of AKR7A5 mRNA] CTD PMID:22206623 Akr7a2 Rat FR900359 increases phosphorylation ISO AKR7A2 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of AKR7A2 protein CTD PMID:37730182 Akr7a2 Rat fulvestrant multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of AKR7A2 gene CTD PMID:31601247 Akr7a2 Rat furan affects binding EXP 6480464 furan binds to AKR7A2 protein CTD PMID:22240984 Akr7a2 Rat furfural multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization more ... CTD PMID:38598786 Akr7a2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of AKR7A2 mRNA CTD PMID:33387578 Akr7a2 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of AKR7A2 mRNA CTD PMID:24136188 Akr7a2 Rat glutathione increases expression EXP 6480464 Glutathione deficiency results in increased expression of AKR7A2 mRNA CTD PMID:15345336 Akr7a2 Rat glutathione multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 AKR7A2 protein inhibits the reaction [Vitamin K 3 results in decreased abundance of Glutathione] CTD PMID:22001351 Akr7a2 Rat glycochenodeoxycholic acid multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650|PMID:33819548 Akr7a2 Rat glycocholic acid multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650|PMID:33819548 Akr7a2 Rat glycodeoxycholic acid multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650|PMID:33819548 Akr7a2 Rat hexanal decreases response to substance ISO Akr7a5 (Mus musculus) 6480464 AKR7A5 protein results in decreased susceptibility to n-hexanal CTD PMID:24590062 Akr7a2 Rat hydrogen peroxide multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [[AKR7A2 protein co-treated with NADP] results in increased reduction of and affects the activity of more ... CTD PMID:21910479 Akr7a2 Rat hydrogen peroxide decreases response to substance ISO Akr7a5 (Mus musculus) 6480464 AKR7A5 protein results in decreased susceptibility to Hydrogen Peroxide CTD PMID:24590062 Akr7a2 Rat hydrogen peroxide increases expression ISO AKR7A2 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of AKR7A2 protein CTD PMID:22964423 Akr7a2 Rat hydrogen peroxide increases response to substance ISO AKR7A2 (Homo sapiens) 6480464 AKR7A2 mutant form results in increased susceptibility to Hydrogen Peroxide CTD PMID:22964423 Akr7a2 Rat hypochlorous acid decreases expression ISO Akr7a5 (Mus musculus) 6480464 Hypochlorous Acid results in decreased expression of AKR7A5 mRNA CTD PMID:19376150 Akr7a2 Rat indole-3-methanol increases expression EXP 6480464 indole-3-carbinol results in increased expression of AKR7A5 CTD PMID:9806166 Akr7a2 Rat indometacin multiple interactions ISO Akr7a5 (Mus musculus) 6480464 Indomethacin inhibits the reaction [4-nitrobenzaldehyde affects the reduction of AKR7A5 protein] CTD PMID:12604212 Akr7a2 Rat inulin multiple interactions ISO Akr7a5 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of AKR7A5 mRNA CTD PMID:36331819 Akr7a2 Rat isatin affects reduction ISO Akr7a5 (Mus musculus) 6480464 Isatin affects the reduction of AKR7A5 protein CTD PMID:12604212 Akr7a2 Rat isatin increases reduction ISO AKR7A2 (Homo sapiens) 6480464 AKR7A2 protein results in increased reduction of Isatin CTD PMID:10510318 Akr7a2 Rat ivermectin decreases expression ISO AKR7A2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of AKR7A2 protein CTD PMID:32959892 Akr7a2 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of AKR7A2 mRNA CTD PMID:19483382 Akr7a2 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of AKR7A2 mRNA CTD PMID:24136188 Akr7a2 Rat menadione multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 AKR7A2 protein inhibits the reaction [Vitamin K 3 results in decreased abundance of Glutathione]; AKR7A2 more ... CTD PMID:22001351 Akr7a2 Rat menadione increases metabolic processing ISO Akr7a5 (Mus musculus) 6480464 AKR7A5 protein results in increased metabolism of Vitamin K 3 CTD PMID:24590062 Akr7a2 Rat menadione decreases response to substance ISO AKR7A2 (Homo sapiens) 6480464 AKR7A2 protein results in decreased susceptibility to Vitamin K 3 CTD PMID:22001351 Akr7a2 Rat methamphetamine decreases methylation ISO Akr7a5 (Mus musculus) 6480464 Methamphetamine results in decreased methylation of AKR7A5 promoter CTD PMID:26307267 Akr7a2 Rat methylarsonic acid multiple interactions ISO Akr7a5 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 Akr7a2 Rat methylglyoxal decreases response to substance ISO Akr7a5 (Mus musculus) 6480464 AKR7A5 protein results in decreased susceptibility to Pyruvaldehyde CTD PMID:24590062 Akr7a2 Rat methylglyoxal increases expression ISO AKR7A2 (Homo sapiens) 6480464 Pyruvaldehyde results in increased expression of AKR7A2 mRNA; Pyruvaldehyde results in increased expression of AKR7A2 more ... CTD PMID:25451587 Akr7a2 Rat methylglyoxal decreases response to substance ISO AKR7A2 (Homo sapiens) 6480464 AKR7A2 protein results in decreased susceptibility to Pyruvaldehyde CTD PMID:22001351|PMID:25451587 Akr7a2 Rat Muconic dialdehyde decreases response to substance ISO AKR7A2 (Homo sapiens) 6480464 AKR7A2 protein results in decreased susceptibility to muconaldehyde CTD PMID:22001351 Akr7a2 Rat Muconic dialdehyde decreases response to substance ISO Akr7a5 (Mus musculus) 6480464 AKR7A5 protein results in decreased susceptibility to muconaldehyde analog CTD PMID:24590062 Akr7a2 Rat N-nitrosomorpholine decreases expression EXP 6480464 N-nitrosomorpholine results in decreased expression of AKR7A2 protein CTD PMID:19716841 Akr7a2 Rat NADP zwitterion multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [[AKR7A2 protein co-treated with NADP] results in increased reduction of and affects the activity of more ... CTD PMID:21910479 Akr7a2 Rat NADP(+) multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [[AKR7A2 protein co-treated with NADP] results in increased reduction of and affects the activity of more ... CTD PMID:21910479 Akr7a2 Rat naphthalenes multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 AKR7A2 protein results in increased reduction of and affects the activity of Naphthalenes CTD PMID:21910479 Akr7a2 Rat naringin multiple interactions ISO Akr7a5 (Mus musculus) 6480464 naringin inhibits the reaction [Acetaminophen results in decreased expression of AKR7A5 protein] CTD PMID:35166444 Akr7a2 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of AKR7A2 mRNA CTD PMID:24136188 Akr7a2 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of AKR7A2 mRNA CTD PMID:24136188 Akr7a2 Rat nitrates multiple interactions ISO Akr7a5 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of AKR7A5 more ... CTD PMID:35964746 Akr7a2 Rat non-2-enal decreases response to substance ISO Akr7a5 (Mus musculus) 6480464 AKR7A5 protein results in decreased susceptibility to 2-nonenal CTD PMID:24590062 Akr7a2 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of AKR7A2 mRNA CTD PMID:19483382 Akr7a2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of AKR7A2 mRNA CTD PMID:25729387 Akr7a2 Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of AKR7A2 mRNA CTD PMID:25729387 Akr7a2 Rat ozone multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268|PMID:35430440 Akr7a2 Rat ozone multiple interactions ISO Akr7a5 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 Akr7a2 Rat paracetamol increases expression ISO AKR7A2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of AKR7A2 mRNA CTD PMID:25704631 Akr7a2 Rat paracetamol multiple interactions ISO Akr7a5 (Mus musculus) 6480464 naringin inhibits the reaction [Acetaminophen results in decreased expression of AKR7A5 protein] CTD PMID:35166444 Akr7a2 Rat paracetamol decreases expression ISO Akr7a5 (Mus musculus) 6480464 Acetaminophen results in decreased expression of AKR7A5 protein CTD PMID:35166444 Akr7a2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of AKR7A2 mRNA CTD PMID:33387578 Akr7a2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Akr7a5 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of AKR7A5 mRNA CTD PMID:36331819 Akr7a2 Rat perfluorooctanoic acid increases expression ISO AKR7A2 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of AKR7A2 protein CTD PMID:26879310 Akr7a2 Rat phenobarbital affects expression ISO AKR7A2 (Homo sapiens) 6480464 Phenobarbital affects the expression of AKR7A2 mRNA CTD PMID:19159669 Akr7a2 Rat phlorizin increases expression ISO Akr7a5 (Mus musculus) 6480464 Phlorhizin results in increased expression of AKR7A2 mRNA CTD PMID:22538082 Akr7a2 Rat picoxystrobin decreases expression ISO AKR7A2 (Homo sapiens) 6480464 picoxystrobin results in decreased expression of AKR7A2 mRNA CTD PMID:33512557 Akr7a2 Rat pirinixic acid multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Akr7a2 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of AKR7A2 mRNA CTD PMID:19483382 Akr7a2 Rat piroxicam decreases expression ISO AKR7A2 (Homo sapiens) 6480464 Piroxicam results in decreased expression of AKR7A2 mRNA CTD PMID:21858171 Akr7a2 Rat Propiverine affects binding EXP 6480464 propiverine binds to AKR7A2 protein CTD PMID:29273565 Akr7a2 Rat pyrimidifen decreases expression ISO AKR7A2 (Homo sapiens) 6480464 pyrimidifen results in decreased expression of AKR7A2 mRNA CTD PMID:33512557 Akr7a2 Rat quercetin multiple interactions ISO Akr7a5 (Mus musculus) 6480464 Quercetin inhibits the reaction [4-nitrobenzaldehyde affects the reduction of AKR7A5 protein] CTD PMID:12604212 Akr7a2 Rat raloxifene affects expression EXP 6480464 Raloxifene Hydrochloride affects the expression of AKR7A2 mRNA CTD PMID:16079270 Akr7a2 Rat reactive oxygen species multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 AKR7A2 protein inhibits the reaction [Vitamin K 3 results in increased abundance of Reactive Oxygen more ... CTD PMID:22001351 Akr7a2 Rat rotenone decreases expression ISO AKR7A2 (Homo sapiens) 6480464 Rotenone results in decreased expression of AKR7A2 mRNA CTD PMID:33512557 Akr7a2 Rat sodium arsenate multiple interactions ISO Akr7a5 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 Akr7a2 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of AKR7A2 protein CTD PMID:29459688 Akr7a2 Rat sodium arsenite multiple interactions ISO Akr7a5 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 Akr7a2 Rat sodium arsenite decreases expression ISO AKR7A2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of AKR7A2 mRNA CTD PMID:38568856 Akr7a2 Rat sodium chloride multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ... CTD PMID:38598786 Akr7a2 Rat sodium fluoride decreases expression ISO Akr7a5 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of AKR7A2 protein CTD PMID:28918527 Akr7a2 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of AKR7A2 mRNA CTD PMID:19281266 Akr7a2 Rat succinic semialdehyde increases reduction ISO AKR7A2 (Homo sapiens) 6480464 AKR7A2 protein results in increased reduction of succinic semialdehyde CTD PMID:10510318 Akr7a2 Rat succinic semialdehyde affects reduction ISO Akr7a5 (Mus musculus) 6480464 succinic semialdehyde affects the reduction of AKR7A5 protein CTD PMID:12604212 Akr7a2 Rat superoxide multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [[AKR7A2 protein co-treated with NADP] results in increased reduction of and affects the activity of more ... CTD PMID:21910479 Akr7a2 Rat tartrazine multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Akr7a2 Rat tebufenpyrad decreases expression ISO AKR7A2 (Homo sapiens) 6480464 4-chloro-N-((4-(1,1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of AKR7A2 mRNA CTD PMID:33512557 Akr7a2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of AKR7A2 mRNA CTD PMID:31150632 Akr7a2 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of AKR7A2 mRNA] CTD PMID:31150632 Akr7a2 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of AKR7A2 mRNA CTD PMID:19483382 Akr7a2 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of AKR7A2 mRNA CTD PMID:34492290 Akr7a2 Rat thiram decreases expression ISO AKR7A2 (Homo sapiens) 6480464 Thiram results in decreased expression of AKR7A2 mRNA CTD PMID:38568856 Akr7a2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of AKR7A2 mRNA CTD PMID:25729387 Akr7a2 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of AKR7A2 mRNA CTD PMID:25729387 Akr7a2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of AKR7A2 mRNA CTD PMID:33387578 Akr7a2 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of AKR7A2 mRNA CTD PMID:30589522 Akr7a2 Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of AKR7A2 protein CTD PMID:32519852 Akr7a2 Rat umbelliferone increases expression ISO AKR7A2 (Homo sapiens) 6480464 7-hydroxycoumarin results in increased expression of AKR7A2 mRNA; 7-hydroxycoumarin results in increased expression of AKR7A2 more ... CTD PMID:22964423|PMID:28263721|PMID:30849339 Akr7a2 Rat umbelliferone multiple interactions ISO AKR7A2 (Homo sapiens) 6480464 7-hydroxycoumarin affects the reaction [AKR7A2 mutant form results in increased susceptibility to 4-hydroxy-2-nonenal] CTD PMID:22964423 Akr7a2 Rat valproic acid multiple interactions ISO Akr7a5 (Mus musculus) 6480464 Valproic Acid inhibits the reaction [4-nitrobenzaldehyde affects the reduction of AKR7A5 protein] CTD PMID:12604212 Akr7a2 Rat vancomycin increases expression ISO Akr7a5 (Mus musculus) 6480464 Vancomycin results in increased expression of AKR7A5 mRNA CTD PMID:18930951 Akr7a2 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of AKR7A2 mRNA CTD PMID:22570695
(+)-schisandrin B (EXP) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP) 1,2-dimethylhydrazine (ISO) 1,2-naphthoquinone (ISO) 14-Deoxy-11,12-didehydroandrographolide (ISO) 16-Ketoestrone (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrotoluene (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2-methylcholine (ISO) 2-nitrobenzaldehyde (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (EXP) 3-chloropropane-1,2-diol (EXP) 3-nitrobenzaldehyde (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxynon-2-enal (ISO) 4-nitrobenzaldehyde (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) 9,10-phenanthroquinone (ISO) acetamide (EXP) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (EXP) Aflatoxin B2 alpha (ISO) alpha-pinene (ISO) amiodarone (EXP) ammonium chloride (EXP) antimycin A (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) atorvastatin calcium (ISO) azoxystrobin (ISO) benzbromarone (EXP) benzo[a]pyrene-7,8-dione (ISO) beta-naphthoflavone (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) bortezomib (ISO) Brodifacoum (EXP) cadmium atom (ISO) cadmium dichloride (ISO) CGP 52608 (ISO) chenodeoxycholic acid (ISO) chlordecone (ISO) cisplatin (ISO) clofibrate (EXP,ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) deguelin (ISO) deoxycholic acid (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dimethylarsinic acid (ISO) dioxygen (ISO) doxorubicin (ISO) endosulfan (EXP) epoxiconazole (ISO) etacrynic acid (ISO) fenpyroximate (ISO) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) furan (EXP) furfural (ISO) gentamycin (EXP) glafenine (EXP) glutathione (EXP,ISO) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) hexanal (ISO) hydrogen peroxide (ISO) hypochlorous acid (ISO) indole-3-methanol (EXP) indometacin (ISO) inulin (ISO) isatin (ISO) ivermectin (ISO) L-ethionine (EXP) leflunomide (EXP) menadione (ISO) methamphetamine (ISO) methylarsonic acid (ISO) methylglyoxal (ISO) Muconic dialdehyde (ISO) N-nitrosomorpholine (EXP) NADP zwitterion (ISO) NADP(+) (ISO) naphthalenes (ISO) naringin (ISO) nefazodone (EXP) nimesulide (EXP) nitrates (ISO) non-2-enal (ISO) omeprazole (EXP) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) phlorizin (ISO) picoxystrobin (ISO) pirinixic acid (EXP,ISO) piroxicam (ISO) Propiverine (EXP) pyrimidifen (ISO) quercetin (ISO) raloxifene (EXP) reactive oxygen species (ISO) rotenone (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) sodium fluoride (ISO) Soman (EXP) succinic semialdehyde (ISO) superoxide (ISO) tartrazine (ISO) tebufenpyrad (ISO) tetrachloromethane (EXP) thioacetamide (EXP) thiram (ISO) topotecan (EXP) trichloroethene (EXP) triphenyl phosphate (EXP) Triptolide (EXP) umbelliferone (ISO) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP)
1.
Proteomic analysis of pancreatic ductal adenocarcinoma compared with normal adjacent pancreatic tissue and pancreatic benign cystadenoma.
Cui Y, etal., Pancreatology. 2009;9(1-2):89-98. Epub 2008 Dec 12.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Novel homodimeric and heterodimeric rat gamma-hydroxybutyrate synthases that associate with the Golgi apparatus define a distinct subclass of aldo-keto reductase 7 family proteins.
Kelly VP, etal., Biochem J 2002 Sep 15;366(Pt 3):847-61.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
Androgen-regulated expression of a novel member of the aldo-keto reductase superfamily in regrowing rat prostate.
Nishi N, etal., Endocrinology 2000 Sep;141(9):3194-9.
8.
Elevation of AKR7A2 (succinic semialdehyde reductase) in neurodegenerative disease.
Picklo MJ, etal., Brain Res. 2001 Oct 19;916(1-2):229-38.
9.
Aflatoxin B1 aldehyde reductase (AFAR) genes cluster at 1p35-1p36.1 in a region frequently altered in human tumour cells.
Praml C, etal., Oncogene 2003 Jul 24;22(30):4765-73.
10.
GOA pipeline
RGD automated data pipeline
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Akr7a2 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 156,835,589 - 156,844,127 (+) NCBI GRCr8 GRCr8 Ensembl 5 156,835,551 - 156,844,109 (+) Ensembl GRCr8 Ensembl mRatBN7.2 5 151,552,375 - 151,560,914 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 151,552,343 - 151,560,909 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 154,250,866 - 154,259,404 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 156,025,214 - 156,033,752 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 156,006,202 - 156,014,739 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 157,759,448 - 157,768,473 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 157,759,416 - 157,768,471 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 161,499,603 - 161,508,628 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 158,097,679 - 158,106,217 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 149,932,592 - 149,941,127 (+) NCBI Celera RGSC_v3.1 5 158,107,717 - 158,116,254 (+) NCBI Cytogenetic Map 5 q36 NCBI
AKR7A2 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 19,302,708 - 19,312,146 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 19,301,991 - 19,312,144 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 19,629,202 - 19,638,640 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 19,503,046 - 19,511,227 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 19,375,768 - 19,383,946 NCBI Celera 1 17,957,442 - 17,965,624 (-) NCBI Celera Cytogenetic Map 1 p36.13 NCBI HuRef 1 17,875,577 - 17,884,829 (-) NCBI HuRef CHM1_1 1 19,738,505 - 19,747,943 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 19,126,242 - 19,135,681 (-) NCBI T2T-CHM13v2.0
Akr7a5 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 139,038,005 - 139,046,097 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 139,038,055 - 139,045,737 (+) Ensembl GRCm39 Ensembl GRCm38 4 139,310,720 - 139,318,786 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 139,310,744 - 139,318,426 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 138,866,659 - 138,874,701 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 138,582,820 - 138,590,501 (+) NCBI MGSCv36 mm8 Celera 4 141,097,258 - 141,105,993 (+) NCBI Celera Cytogenetic Map 4 D3 NCBI cM Map 4 70.64 NCBI
Akr7a2 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955452 6,844 - 13,868 (-) NCBI ChiLan1.0 ChiLan1.0
LOC100981962 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 207,802,957 - 207,822,054 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 206,919,935 - 206,938,840 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 18,262,631 - 18,270,783 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 19,309,211 - 19,317,836 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 19,309,471 - 19,317,227 (-) Ensembl panpan1.1 panPan2
AKR7A2 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 79,334,179 - 79,343,880 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 79,334,205 - 79,343,007 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 75,849,105 - 75,858,155 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 79,956,898 - 79,965,951 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 79,956,898 - 79,968,886 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 76,717,803 - 76,726,853 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 77,727,438 - 77,736,710 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 78,798,535 - 78,808,663 (+) NCBI UU_Cfam_GSD_1.0
LOC101974041 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
AKR7A2 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 77,754,174 - 77,761,667 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 77,754,172 - 77,761,609 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 71,816,268 - 71,823,705 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LOC103225480 (Chlorocebus sabaeus - green monkey)
.
Predicted Target Of
Count of predictions: 40 Count of miRNA genes: 36 Interacting mature miRNAs: 40 Transcripts: ENSRNOT00000024063 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 2302369 Scl60 Serum cholesterol level QTL 60 3.13 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 143608201 161165651 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 1300119 Bp180 Blood pressure QTL 180 3.82 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 144358090 157869054 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 1354631 Swd2 Spike wave discharge measurement QTL 2 3.64 0.0002 brain electrophysiology trait (VT:0010557) brain total spike-and-wave discharge duration (CMO:0001740) 5 151113452 164465185 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631263 Cm24 Cardiac mass QTL 24 3.5 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 5 143799107 158428037 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 631272 Lanf1 Left ventricular atrial natriuretic factor QTL 1 12 heart left ventricle natriuretic peptide A amount (VT:0010596) heart left ventricle natriuretic peptide A level (CMO:0002165) 5 151113452 166875058 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 2313096 Bmd78 Bone mineral density QTL 78 3.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 5 144377876 161317411 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298090 Bp155 Blood pressure QTL 155 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 151006154 161165494 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat
Afar
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 151,560,717 - 151,560,886 (+) MAPPER mRatBN7.2 Rnor_6.0 5 157,768,277 - 157,768,445 NCBI Rnor6.0 Rnor_5.0 5 161,508,432 - 161,508,600 UniSTS Rnor5.0 RGSC_v3.4 5 158,106,021 - 158,106,189 UniSTS RGSC3.4 Celera 5 149,940,931 - 149,941,099 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024063 ⟹ ENSRNOP00000024063
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 157,759,416 - 157,768,301 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000083629 ⟹ ENSRNOP00000072789
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 Ensembl 5 156,835,551 - 156,844,109 (+) Ensembl mRatBN7.2 Ensembl 5 151,552,343 - 151,560,909 (+) Ensembl Rnor_6.0 Ensembl 5 157,759,448 - 157,768,471 (+) Ensembl
RefSeq Acc Id:
NM_134407 ⟹ NP_599234
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 156,835,589 - 156,844,127 (+) NCBI mRatBN7.2 5 151,552,375 - 151,560,914 (+) NCBI Rnor_6.0 5 157,759,448 - 157,768,473 (+) NCBI Rnor_5.0 5 161,499,603 - 161,508,628 (+) NCBI RGSC_v3.4 5 158,097,679 - 158,106,217 (+) RGD Celera 5 149,932,592 - 149,941,127 (+) RGD
Sequence:
CGCTGCTGTACGCTGCGCGTGGCGCTCTGGGCCTTCGGTCGCGCGTCCTCTCGCCATGTCCCGGTCTCCGGCACCCCGCGCCGTCTCTGGCGCCCCTCTCCGGCCCGGTACGGTGCTGGGCACCATGG AGATGGGGCGCCGCATGGATGCGAGTGCTAGCGCTGCGACCGTACGCGCCTTCCTGGAGCGCGGCCTCAACGAGCTGGACACGGCCTTCATGTATTGCGACGGCCAGTCCGAAAGCATCCTGGGCAGC CTGGGGCTCGGGCTGGGCAGCGGCGACTGCACAGTGAAAATTGCCACCAAGGCCAACCCTTGGGACGGGAAGTCGCTGAAGCCTGACAGTGTCCGGTCCCAATTAGAGACGTCATTGAAGCGGCTGCA GTGTCCCCGGGTGGACCTCTTCTACTTACACGCTCCTGACCACGGCACTCCTATCGTGGAGACCCTGCAGGCCTGCCAACAGCTGCATCAGGAGGGCAAGTTTGTGGAGCTTGGCTTGTCCAACTATG CCTCCTGGGAGGTAGCCGAGATCTATACCCTCTGTAAAAGCAACGGCTGGATCCTGCCAACTGTGTACCAGGGCATGTACAACGCCACCACCCGGCAGGTGGAGACTGAGCTCCTCCCCTGCCTCAGA TACTTCGGACTGAGGTTCTATGCCTACAACCCTTTGGCTGGAGGCCTGCTGACTGGCAAATACAGATATGAAGACAAGGATGGGAAACAGCCCGAGGGCCGCTTCTTTGGGAATAGCTGGTCTGAGAC CTACAGGAACCGCTTCTGGAAGGAACACCACTTTGAGGCCATTGCCCTGGTAGAAAAGGCCCTGAAGACCACCTATGGCACCAGTGCCCCCAGCATGACCTCGGCTGCCCTGCGCTGGATGTACCATC ACTCACAGCTCCAGGGCACCCGAGGGGACGCAGTCATCTTGGGCATGTCCAGCCTGGAGCAGCTGGAGCAGAACTTGGCGGCCACTGAGGAAGGTCCCCTGGAGCCCGCTGTCGTGGAGGCCTTTAAC CAAGCCTGGAACGTGGTCGCCCACGAGTGTCCCAACTACTTCAGATAGACTGTCGTGACTCAAGACGCCAGGGCTTTTCTGCCAACTCTTAGAGTCACACCCTGGCCACTCCTTGCCCAGTGCTGACC TAGTGTGGTCTTTTCTGCTGGTCTCCATCCACTCCCTGCTCTTTTCCCGTCTGAATAAAGCAGGCGTCCGACCTAGCTGCAGCCCGGACTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_599234 ⟸ NM_134407
- UniProtKB:
Q9JM82 (UniProtKB/Swiss-Prot), Q8K435 (UniProtKB/Swiss-Prot), Q6P765 (UniProtKB/Swiss-Prot), Q8CG45 (UniProtKB/Swiss-Prot), A0A0G2K3V2 (UniProtKB/TrEMBL), A6ITL3 (UniProtKB/TrEMBL)
- Sequence:
MSRSPAPRAVSGAPLRPGTVLGTMEMGRRMDASASAATVRAFLERGLNELDTAFMYCDGQSESILGSLGLGLGSGDCTVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPRVDLFYLHAPDHGTPI VETLQACQQLHQEGKFVELGLSNYASWEVAEIYTLCKSNGWILPTVYQGMYNATTRQVETELLPCLRYFGLRFYAYNPLAGGLLTGKYRYEDKDGKQPEGRFFGNSWSETYRNRFWKEHHFEAIALVE KALKTTYGTSAPSMTSAALRWMYHHSQLQGTRGDAVILGMSSLEQLEQNLAATEEGPLEPAVVEAFNQAWNVVAHECPNYFR
hide sequence
Ensembl Acc Id:
ENSRNOP00000024063 ⟸ ENSRNOT00000024063
Ensembl Acc Id:
ENSRNOP00000072789 ⟸ ENSRNOT00000083629
RGD ID: 13694210
Promoter ID: EPDNEW_R4728
Type: initiation region
Name: Akr7a2_1
Description: aldo-keto reductase family 7, member A2
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 157,759,427 - 157,759,487 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-06-10
Akr7a2
aldo-keto reductase family 7, member A2
Akr7a2
aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2005-11-17
Akr7a2
aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)
Symbol and Name status set to approved
1299863
APPROVED
2002-08-07
Akr7a2
aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)
Symbol and Name status set to provisional
70820
PROVISIONAL
Note Type
Note
Reference
gene_cellular_localization
Golgi-associated
625492
gene_protein
has a low K(m) and high activity towards succinic semialdehyde
625492