Symbol:
Slc40a1
Name:
solute carrier family 40 member 1
RGD ID:
620180
Description:
Predicted to enable ferrous iron transmembrane transporter activity; identical protein binding activity; and peptide hormone binding activity. Predicted to be involved in intracellular iron ion homeostasis and iron ion export across plasma membrane. Predicted to act upstream of or within several processes, including multicellular organismal-level iron ion homeostasis; positive regulation of transcription by RNA polymerase II; and spleen trabecula formation. Predicted to be located in several cellular components, including cytosol; nucleoplasm; and synaptic vesicle. Predicted to be active in basolateral plasma membrane. Human ortholog(s) of this gene implicated in hemochromatosis type 4. Orthologous to human SLC40A1 (solute carrier family 40 member 1); PARTICIPATES IN iron efflux pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
CAR1; cell adhesion regulator; ferroportin; ferroportin 1; ferroportin-1; Fpn1; NEWGENE_620180; Slc11a3; Slc39a1; solute carrier family 39 (iron-regulated transporter), member 1; solute carrier family 40 (iron-regulated transporter), member 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SLC40A1 (solute carrier family 40 member 1)
HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Slc40a1 (solute carrier family 40 (iron-regulated transporter), member 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Slc40a1 (solute carrier family 40 member 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SLC40A1 (solute carrier family 40 member 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SLC40A1 (solute carrier family 40 member 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Slc40a1 (solute carrier family 40 member 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SLC40A1 (solute carrier family 40 member 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SLC40A1 (solute carrier family 40 member 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Slc40a1 (solute carrier family 40 member 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SLC40A1 (solute carrier family 40 member 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Slc40a1 (solute carrier family 40 (iron-regulated transporter), member 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
slc40a1 (solute carrier family 40 member 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
fpn-1.1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
fpn-1.2
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
slc40a1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 55,525,457 - 55,633,463 (-) NCBI GRCr8 mRatBN7.2 9 48,033,526 - 48,053,876 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 48,033,526 - 48,051,481 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 56,559,843 - 56,577,824 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 61,682,660 - 61,700,640 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 59,978,656 - 59,996,636 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 52,819,451 - 52,830,461 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 52,894,365 - 52,912,293 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 52,560,116 - 52,579,079 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 44,977,430 - 44,995,358 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 44,979,984 - 44,996,778 (-) NCBI Celera 9 45,700,875 - 45,718,803 (-) NCBI Celera Cytogenetic Map 9 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Slc40a1 Rat (+)-catechin multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of SLC40A1 mRNA CTD PMID:24763279 Slc40a1 Rat (+)-dexrazoxane multiple interactions ISO Slc40a1 (Mus musculus) 6480464 Dexrazoxane inhibits the reaction [Cyclophosphamide results in decreased expression of SLC40A1 protein] CTD PMID:37690746 Slc40a1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SLC40A1 mRNA CTD PMID:22079256 Slc40a1 Rat (1->4)-beta-D-glucan multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of SLC40A1 mRNA CTD PMID:36331819 Slc40a1 Rat 1,2-dimethylhydrazine decreases expression ISO Slc40a1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SLC40A1 mRNA CTD PMID:22206623 Slc40a1 Rat 1,3-dichloropropan-2-ol multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [Thiazoles binds to indoline] promotes the reaction [1 more ... CTD PMID:35870111 Slc40a1 Rat 1,3-dichloropropan-2-ol decreases expression ISO SLC40A1 (Homo sapiens) 6480464 1 and 3-dichloro-2-propanol results in decreased expression of SLC40A1 protein CTD PMID:35870111 Slc40a1 Rat 1,3-dichloropropan-2-ol decreases expression ISO Slc40a1 (Mus musculus) 6480464 1 and 3-dichloro-2-propanol results in decreased expression of SLC40A1 protein CTD PMID:35870111 Slc40a1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Slc40a1 (Mus musculus) 6480464 3 more ... CTD PMID:19679656 Slc40a1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO Slc40a1 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:19679656 Slc40a1 Rat 17alpha-ethynylestradiol affects expression ISO SLC40A1 (Homo sapiens) 6480464 Ethinyl Estradiol affects the expression of SLC40A1 mRNA CTD PMID:20170705 Slc40a1 Rat 17alpha-ethynylestradiol decreases expression ISO Slc40a1 (Mus musculus) 6480464 Ethinyl Estradiol results in decreased expression of SLC40A1 mRNA CTD PMID:27690074 Slc40a1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of SLC40A1 mRNA CTD PMID:17108234 Slc40a1 Rat 17alpha-ethynylestradiol increases expression ISO Slc40a1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of SLC40A1 mRNA CTD PMID:17942748 Slc40a1 Rat 17alpha-ethynylestradiol affects expression ISO Slc40a1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of SLC40A1 mRNA CTD PMID:17555576 Slc40a1 Rat 17beta-estradiol increases expression ISO Slc40a1 (Mus musculus) 6480464 Estradiol results in increased expression of SLC40A1 mRNA CTD PMID:16684588 Slc40a1 Rat 17beta-estradiol decreases expression ISO Slc40a1 (Mus musculus) 6480464 Estradiol results in decreased expression of SLC40A1 mRNA CTD PMID:39298647 Slc40a1 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of SLC40A1 mRNA CTD PMID:26496021 Slc40a1 Rat 17beta-estradiol multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of SLC40A1 mRNA CTD PMID:20660070 Slc40a1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases expression ISO SLC40A1 (Homo sapiens) 6480464 2 more ... CTD PMID:25686467 Slc40a1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO SLC40A1 (Homo sapiens) 6480464 2 more ... CTD PMID:19095052 Slc40a1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in decreased expression of SLC40A1 mRNA CTD PMID:16214954 Slc40a1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SLC40A1 mRNA CTD PMID:32109520 and PMID:34747641 Slc40a1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SLC40A1 mRNA CTD PMID:20959002 more ... Slc40a1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO SLC40A1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of SLC40A1 mRNA CTD PMID:22574217 Slc40a1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Slc40a1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SLC40A1 mRNA CTD PMID:21570461 Slc40a1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Slc40a1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SLC40A1 mRNA CTD PMID:19770486 and PMID:28213091 Slc40a1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Slc40a1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SLC40A1 mRNA and Tetrachlorodibenzodioxin results in increased expression of SLC40A1 protein CTD PMID:19933214 and PMID:28213091 Slc40a1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Slc40a1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Slc40a1 Rat 2-acetamidofluorene increases expression EXP 6480464 2-Acetylaminofluorene results in increased expression of SLC40A1 mRNA CTD PMID:21785164 Slc40a1 Rat 2-tert-butylhydroquinone increases expression ISO Slc40a1 (Mus musculus) 6480464 2-tert-butylhydroquinone results in increased expression of SLC40A1 mRNA CTD PMID:16014739 Slc40a1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Slc40a1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO SLC40A1 (Homo sapiens) 6480464 3 more ... CTD PMID:25686467 Slc40a1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Slc40a1 (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of SLC40A1 mRNA CTD PMID:25172293 Slc40a1 Rat 3,4-dihydroxybenzoate multiple interactions ISO Slc40a1 (Mus musculus) 6480464 3 more ... CTD PMID:19679656 Slc40a1 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Slc40a1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of SLC40A1 mRNA CTD PMID:26251327 Slc40a1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of SLC40A1 mRNA CTD PMID:28628672 Slc40a1 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of SLC40A1 mRNA CTD PMID:19162173 Slc40a1 Rat 4,4'-diaminodiphenylmethane increases expression ISO Slc40a1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of SLC40A1 mRNA CTD PMID:18648102 Slc40a1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of SLC40A1 mRNA CTD PMID:30951980 Slc40a1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Slc40a1 (Mus musculus) 6480464 bisphenol S results in decreased expression of SLC40A1 mRNA CTD PMID:39298647 Slc40a1 Rat 4,4'-sulfonyldiphenol increases expression ISO Slc40a1 (Mus musculus) 6480464 bisphenol S results in increased expression of SLC40A1 mRNA CTD PMID:30951980 Slc40a1 Rat 4-hydroxyphenyl retinamide increases expression ISO Slc40a1 (Mus musculus) 6480464 Fenretinide results in increased expression of SLC40A1 mRNA CTD PMID:28973697 Slc40a1 Rat 4-tert-Octylphenol increases expression EXP 6480464 4-tert-octylphenol results in increased expression of SLC40A1 mRNA CTD PMID:17011747 Slc40a1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole decreases expression ISO Slc40a1 (Mus musculus) 6480464 Omeprazole results in decreased expression of SLC40A1 protein CTD PMID:31669099 Slc40a1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of SLC40A1 mRNA CTD PMID:31881176 Slc40a1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of SLC40A1 mRNA CTD PMID:28959563 Slc40a1 Rat actinomycin D multiple interactions ISO Slc40a1 (Mus musculus) 6480464 Dactinomycin inhibits the reaction [Cadmium results in increased expression of SLC40A1 mRNA] CTD PMID:20090884 Slc40a1 Rat aflatoxin B1 affects expression ISO SLC40A1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of SLC40A1 protein CTD PMID:20106945 Slc40a1 Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of SLC40A1 mRNA CTD PMID:33354967 Slc40a1 Rat aflatoxin B1 decreases methylation ISO SLC40A1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of SLC40A1 gene CTD PMID:27153756 Slc40a1 Rat aflatoxin B1 increases expression ISO SLC40A1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of SLC40A1 mRNA CTD PMID:21632981 Slc40a1 Rat alcohol increases expression ISO SLC40A1 (Homo sapiens) 6480464 Alcohols results in increased expression of SLC40A1 mRNA CTD PMID:24025710 Slc40a1 Rat aldehydo-D-glucose increases expression ISO SLC40A1 (Homo sapiens) 6480464 Glucose results in increased expression of SLC40A1 protein CTD PMID:38483099 Slc40a1 Rat aldehydo-D-glucose increases expression EXP 6480464 Glucose results in increased expression of SLC40A1 protein CTD PMID:38483099 Slc40a1 Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of SLC40A1 mRNA CTD PMID:20488242 Slc40a1 Rat all-trans-retinoic acid multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of SLC40A1 mRNA CTD PMID:30951980 Slc40a1 Rat all-trans-retinoic acid increases expression ISO SLC40A1 (Homo sapiens) 6480464 Tretinoin results in increased expression of SLC40A1 mRNA CTD PMID:21934132 more ... Slc40a1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SLC40A1 mRNA CTD PMID:16483693 Slc40a1 Rat antirheumatic drug increases expression ISO SLC40A1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of SLC40A1 mRNA CTD PMID:24449571 Slc40a1 Rat apocynin multiple interactions ISO Slc40a1 (Mus musculus) 6480464 acetovanillone inhibits the reaction [[Paraquat co-treated with Maneb] results in decreased expression of SLC40A1 protein] CTD PMID:30797899 Slc40a1 Rat Aroclor 1254 decreases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of SLC40A1 mRNA CTD PMID:18178546 Slc40a1 Rat arsane multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SLC40A1 mRNA CTD PMID:39836092 Slc40a1 Rat arsenic atom multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SLC40A1 mRNA CTD PMID:39836092 Slc40a1 Rat arsenous acid increases expression ISO SLC40A1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of SLC40A1 mRNA CTD PMID:19128835 Slc40a1 Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of SLC40A1 mRNA and Atrazine results in decreased expression of SLC40A1 protein CTD PMID:34030342 Slc40a1 Rat azathioprine increases expression ISO SLC40A1 (Homo sapiens) 6480464 Azathioprine results in increased expression of SLC40A1 mRNA CTD PMID:22623647 Slc40a1 Rat Azoxymethane multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SLC40A1 mRNA CTD PMID:29950665 Slc40a1 Rat benzo[a]pyrene increases expression ISO SLC40A1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of SLC40A1 mRNA CTD PMID:20106945 more ... Slc40a1 Rat benzo[a]pyrene multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [Ethanol co-treated with Benzo(a)pyrene]] which results in increased expression of SLC40A1 mRNA CTD PMID:35412187 Slc40a1 Rat benzo[a]pyrene decreases methylation ISO SLC40A1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of SLC40A1 promoter CTD PMID:27901495 Slc40a1 Rat benzo[a]pyrene increases expression ISO Slc40a1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SLC40A1 mRNA CTD PMID:20127859 more ... Slc40a1 Rat benzo[a]pyrene diol epoxide I increases expression ISO SLC40A1 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Slc40a1 Rat bis(2-ethylhexyl) phthalate increases expression ISO SLC40A1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of SLC40A1 mRNA CTD PMID:31163220 Slc40a1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Slc40a1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of SLC40A1 mRNA CTD PMID:33754040 Slc40a1 Rat bisphenol A affects expression ISO SLC40A1 (Homo sapiens) 6480464 bisphenol A affects the expression of SLC40A1 mRNA CTD PMID:20170705 Slc40a1 Rat bisphenol A decreases expression ISO Slc40a1 (Mus musculus) 6480464 bisphenol A results in decreased expression of SLC40A1 mRNA CTD PMID:37894381 Slc40a1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SLC40A1 mRNA CTD PMID:33296240 Slc40a1 Rat bisphenol A increases expression ISO SLC40A1 (Homo sapiens) 6480464 bisphenol A results in increased expression of SLC40A1 mRNA CTD PMID:29275510 Slc40a1 Rat bisphenol A increases expression ISO Slc40a1 (Mus musculus) 6480464 bisphenol A results in increased expression of SLC40A1 mRNA CTD PMID:30951980 and PMID:33221593 Slc40a1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SLC40A1 mRNA CTD PMID:30816183 more ... Slc40a1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SLC40A1 mRNA CTD PMID:25181051 and PMID:30903817 Slc40a1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of SLC40A1 mRNA CTD PMID:26496021 Slc40a1 Rat bisphenol F increases expression ISO Slc40a1 (Mus musculus) 6480464 bisphenol F results in increased expression of SLC40A1 mRNA CTD PMID:30951980 Slc40a1 Rat busulfan multiple interactions ISO Slc40a1 (Mus musculus) 6480464 Deferoxamine inhibits the reaction [Busulfan results in decreased expression of SLC40A1 protein] more ... CTD PMID:32416107 Slc40a1 Rat busulfan decreases expression ISO Slc40a1 (Mus musculus) 6480464 Busulfan results in decreased expression of SLC40A1 protein CTD PMID:32416107 Slc40a1 Rat buta-1,3-diene increases expression ISO Slc40a1 (Mus musculus) 6480464 1 and 3-butadiene results in increased expression of SLC40A1 mRNA CTD PMID:29038090 Slc40a1 Rat cadmium atom multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SLC40A1 mRNA more ... CTD PMID:20090884 more ... Slc40a1 Rat cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of SLC40A1 mRNA CTD PMID:39025289 Slc40a1 Rat cadmium atom multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SLC40A1 mRNA and [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SLC40A1 protein CTD PMID:32645461 Slc40a1 Rat cadmium atom increases expression ISO Slc40a1 (Mus musculus) 6480464 Cadmium results in increased expression of SLC40A1 mRNA and Cadmium results in increased expression of SLC40A1 protein CTD PMID:20090884 and PMID:20688958 Slc40a1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of SLC40A1 protein CTD PMID:21540277 Slc40a1 Rat cadmium dichloride decreases expression ISO Slc40a1 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of SLC40A1 mRNA CTD PMID:34666113 Slc40a1 Rat cadmium dichloride multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SLC40A1 mRNA and [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SLC40A1 protein CTD PMID:32645461 Slc40a1 Rat cadmium dichloride multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SLC40A1 mRNA and [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SLC40A1 protein CTD PMID:32645461 Slc40a1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of SLC40A1 CTD PMID:17483498 Slc40a1 Rat cannabidiol increases expression ISO Slc40a1 (Mus musculus) 6480464 Cannabidiol results in increased expression of SLC40A1 mRNA CTD PMID:21542829 Slc40a1 Rat carbon nanotube increases expression ISO Slc40a1 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of SLC40A1 mRNA CTD PMID:25554681 Slc40a1 Rat CGP 52608 multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SLC40A1 gene] CTD PMID:28238834 Slc40a1 Rat chloroprene increases expression ISO Slc40a1 (Mus musculus) 6480464 Chloroprene results in increased expression of SLC40A1 mRNA CTD PMID:23125180 Slc40a1 Rat chlorpyrifos increases expression ISO SLC40A1 (Homo sapiens) 6480464 Chlorpyrifos results in increased expression of SLC40A1 mRNA CTD PMID:25176568 Slc40a1 Rat chlorpyrifos affects expression ISO Slc40a1 (Mus musculus) 6480464 Chlorpyrifos affects the expression of SLC40A1 mRNA CTD PMID:37019170 Slc40a1 Rat chromium(6+) decreases expression ISO Slc40a1 (Mus musculus) 6480464 chromium hexavalent ion results in decreased expression of SLC40A1 mRNA CTD PMID:24418189 Slc40a1 Rat chromium(6+) decreases expression EXP 6480464 chromium hexavalent ion results in decreased expression of SLC40A1 mRNA CTD PMID:24418189 Slc40a1 Rat ciguatoxin CTX1B affects expression ISO Slc40a1 (Mus musculus) 6480464 Ciguatoxins affects the expression of SLC40A1 mRNA CTD PMID:18353800 Slc40a1 Rat cisplatin multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of SLC40A1 mRNA and [Cisplatin co-treated with panobinostat] affects the expression of SLC40A1 mRNA CTD PMID:21791302 and PMID:27392435 Slc40a1 Rat cobalt atom multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 Cobalt inhibits the reaction [SLC40A1 protein results in increased export of Manganese] CTD PMID:22178646 Slc40a1 Rat cobalt atom multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [cobaltous chloride results in increased abundance of Cobalt] which results in increased expression of SLC40A1 protein CTD PMID:32750324 Slc40a1 Rat cobalt atom increases expression ISO Slc40a1 (Mus musculus) 6480464 Cobalt results in increased expression of SLC40A1 protein CTD PMID:20016736 Slc40a1 Rat cobalt dichloride multiple interactions EXP 6480464 Plicamycin inhibits the reaction [cobaltous chloride results in increased expression of SLC40A1 mRNA] CTD PMID:23814049 Slc40a1 Rat cobalt dichloride multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [cobaltous chloride results in increased abundance of Cobalt] which results in increased expression of SLC40A1 protein CTD PMID:32750324 Slc40a1 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of SLC40A1 mRNA CTD PMID:23814049 and PMID:24386269 Slc40a1 Rat copper atom affects expression ISO Slc40a1 (Mus musculus) 6480464 Copper affects the expression of SLC40A1 mRNA and Copper affects the expression of SLC40A1 protein CTD PMID:16614410 Slc40a1 Rat copper atom multiple interactions ISO Slc40a1 (Mus musculus) 6480464 EPAS1 gene mutant form inhibits the reaction [Copper deficiency results in increased expression of SLC40A1 mRNA] CTD PMID:23555700 Slc40a1 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of SLC40A1 mRNA and Copper deficiency results in increased expression of SLC40A1 protein CTD PMID:20164366 and PMID:21355016 Slc40a1 Rat copper atom increases expression ISO SLC40A1 (Homo sapiens) 6480464 Copper results in increased expression of SLC40A1 mRNA and Copper results in increased expression of SLC40A1 protein CTD PMID:12220667 Slc40a1 Rat copper atom decreases expression ISO SLC40A1 (Homo sapiens) 6480464 Copper deficiency results in decreased expression of SLC40A1 mRNA CTD PMID:18505688 Slc40a1 Rat copper atom decreases expression EXP 6480464 Copper deficiency results in decreased expression of SLC40A1 protein CTD PMID:18505688 Slc40a1 Rat copper atom increases expression ISO Slc40a1 (Mus musculus) 6480464 Copper deficiency results in increased expression of SLC40A1 mRNA more ... CTD PMID:20016736 and PMID:23555700 Slc40a1 Rat copper(0) affects expression ISO Slc40a1 (Mus musculus) 6480464 Copper affects the expression of SLC40A1 mRNA and Copper affects the expression of SLC40A1 protein CTD PMID:16614410 Slc40a1 Rat copper(0) multiple interactions ISO Slc40a1 (Mus musculus) 6480464 EPAS1 gene mutant form inhibits the reaction [Copper deficiency results in increased expression of SLC40A1 mRNA] CTD PMID:23555700 Slc40a1 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of SLC40A1 mRNA and Copper deficiency results in increased expression of SLC40A1 protein CTD PMID:20164366 and PMID:21355016 Slc40a1 Rat copper(0) increases expression ISO SLC40A1 (Homo sapiens) 6480464 Copper results in increased expression of SLC40A1 mRNA and Copper results in increased expression of SLC40A1 protein CTD PMID:12220667 Slc40a1 Rat copper(0) decreases expression ISO SLC40A1 (Homo sapiens) 6480464 Copper deficiency results in decreased expression of SLC40A1 mRNA CTD PMID:18505688 Slc40a1 Rat copper(0) decreases expression EXP 6480464 Copper deficiency results in decreased expression of SLC40A1 protein CTD PMID:18505688 Slc40a1 Rat copper(0) increases expression ISO Slc40a1 (Mus musculus) 6480464 Copper deficiency results in increased expression of SLC40A1 mRNA more ... CTD PMID:20016736 and PMID:23555700 Slc40a1 Rat copper(II) sulfate increases expression ISO SLC40A1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of SLC40A1 mRNA CTD PMID:19549813 Slc40a1 Rat crocidolite asbestos decreases expression ISO SLC40A1 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of SLC40A1 mRNA CTD PMID:18687144 Slc40a1 Rat crocidolite asbestos decreases expression ISO Slc40a1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of SLC40A1 mRNA CTD PMID:29279043 Slc40a1 Rat cyclophosphamide decreases expression ISO Slc40a1 (Mus musculus) 6480464 Cyclophosphamide results in decreased expression of SLC40A1 protein CTD PMID:32129080 and PMID:37690746 Slc40a1 Rat cyclophosphamide multiple interactions ISO Slc40a1 (Mus musculus) 6480464 Dexrazoxane inhibits the reaction [Cyclophosphamide results in decreased expression of SLC40A1 protein] CTD PMID:37690746 Slc40a1 Rat cyclosporin A decreases expression ISO Slc40a1 (Mus musculus) 6480464 Cyclosporine results in decreased expression of SLC40A1 mRNA CTD PMID:19770486 Slc40a1 Rat cyclosporin A decreases expression ISO SLC40A1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of SLC40A1 mRNA CTD PMID:20106945 and PMID:24907557 Slc40a1 Rat cytarabine decreases expression ISO SLC40A1 (Homo sapiens) 6480464 Cytarabine results in decreased expression of SLC40A1 mRNA CTD PMID:21198554 Slc40a1 Rat D-glucose increases expression ISO SLC40A1 (Homo sapiens) 6480464 Glucose results in increased expression of SLC40A1 protein CTD PMID:38483099 Slc40a1 Rat D-glucose increases expression EXP 6480464 Glucose results in increased expression of SLC40A1 protein CTD PMID:38483099 Slc40a1 Rat desferrioxamine B increases expression ISO Slc40a1 (Mus musculus) 6480464 Deferoxamine results in increased expression of SLC40A1 protein CTD PMID:31238089 Slc40a1 Rat desferrioxamine B multiple interactions ISO Slc40a1 (Mus musculus) 6480464 Deferoxamine inhibits the reaction [Busulfan results in decreased expression of SLC40A1 protein] and Deferoxamine inhibits the reaction [Valproic Acid results in increased expression of SLC40A1 mRNA] CTD PMID:32416107 and PMID:39147356 Slc40a1 Rat dexamethasone decreases expression ISO Slc40a1 (Mus musculus) 6480464 Dexamethasone results in decreased expression of SLC40A1 mRNA CTD PMID:22733784 Slc40a1 Rat dexamethasone multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of SLC40A1 mRNA CTD PMID:28628672 Slc40a1 Rat dexamethasone increases expression ISO SLC40A1 (Homo sapiens) 6480464 Dexamethasone results in increased expression of SLC40A1 mRNA CTD PMID:25047013 Slc40a1 Rat dextran sulfate multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SLC40A1 mRNA CTD PMID:29950665 Slc40a1 Rat diallyl trisulfide increases expression EXP 6480464 diallyl trisulfide results in increased expression of SLC40A1 mRNA CTD PMID:34014027 Slc40a1 Rat diarsenic trioxide increases expression ISO SLC40A1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of SLC40A1 mRNA CTD PMID:19128835 Slc40a1 Rat diazinon increases methylation ISO SLC40A1 (Homo sapiens) 6480464 Diazinon results in increased methylation of SLC40A1 gene CTD PMID:22964155 Slc40a1 Rat Dibutyl phosphate affects expression ISO SLC40A1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SLC40A1 mRNA CTD PMID:37042841 Slc40a1 Rat dibutyl phthalate increases expression ISO Slc40a1 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of SLC40A1 mRNA CTD PMID:17361019 and PMID:21266533 Slc40a1 Rat dicrotophos decreases expression ISO SLC40A1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of SLC40A1 mRNA CTD PMID:28302478 Slc40a1 Rat diethyl maleate multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 diethyl maleate inhibits the reaction [Lipopolysaccharides results in decreased expression of SLC40A1 mRNA] CTD PMID:21303654 Slc40a1 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of SLC40A1 mRNA CTD PMID:17011747 Slc40a1 Rat dimethyl fumarate multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 Dimethyl Fumarate inhibits the reaction [1 and 3-dichloro-2-propanol results in decreased expression of SLC40A1 protein] CTD PMID:35870111 Slc40a1 Rat diquat decreases expression EXP 6480464 Diquat results in decreased expression of SLC40A1 mRNA CTD PMID:21698372 Slc40a1 Rat dorsomorphin multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Slc40a1 Rat doxorubicin increases expression ISO Slc40a1 (Mus musculus) 6480464 Doxorubicin results in increased expression of SLC40A1 mRNA CTD PMID:25896364 Slc40a1 Rat doxorubicin increases expression ISO SLC40A1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of SLC40A1 mRNA CTD PMID:29803840 Slc40a1 Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of SLC40A1 mRNA CTD PMID:29391264 Slc40a1 Rat epoxiconazole decreases expression ISO Slc40a1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of SLC40A1 mRNA CTD PMID:35436446 Slc40a1 Rat erastin increases expression ISO SLC40A1 (Homo sapiens) 6480464 erastin results in increased expression of SLC40A1 protein CTD PMID:31323261 Slc40a1 Rat erastin decreases expression EXP 6480464 erastin results in decreased expression of SLC40A1 protein CTD PMID:32937103 Slc40a1 Rat ethanol increases expression ISO Slc40a1 (Mus musculus) 6480464 Ethanol results in increased expression of SLC40A1 mRNA and Ethanol results in increased expression of SLC40A1 protein CTD PMID:16737972 more ... Slc40a1 Rat ethanol multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [Ethanol co-treated with Benzo(a)pyrene]] which results in increased expression of SLC40A1 mRNA CTD PMID:35412187 Slc40a1 Rat ethanol multiple interactions ISO Slc40a1 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of SLC40A1 mRNA and HAMP protein inhibits the reaction [Ethanol results in increased expression of SLC40A1 protein] CTD PMID:16737972 and PMID:30319688 Slc40a1 Rat ferric ammonium citrate multiple interactions ISO Slc40a1 (Mus musculus) 6480464 SLC40A1 protein inhibits the reaction [ferric ammonium citrate results in increased expression of FTL1 mRNA] CTD PMID:19913091 Slc40a1 Rat ferric ammonium citrate increases expression ISO Slc40a1 (Mus musculus) 6480464 ferric ammonium citrate results in increased expression of SLC40A1 mRNA CTD PMID:19913091 Slc40a1 Rat ferric ammonium citrate increases expression EXP 6480464 ferric ammonium citrate results in increased expression of SLC40A1 mRNA CTD PMID:19913091 Slc40a1 Rat ferrostatin-1 multiple interactions ISO Slc40a1 (Mus musculus) 6480464 ferrostatin-1 inhibits the reaction [Busulfan results in decreased expression of SLC40A1 protein] and ferrostatin-1 inhibits the reaction [Valproic Acid results in increased expression of SLC40A1 mRNA] CTD PMID:32416107 and PMID:39147356 Slc40a1 Rat ferrostatin-1 multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 ferrostatin-1 affects the reaction [Valproic Acid results in decreased expression of SLC40A1 protein] CTD PMID:39147356 Slc40a1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of SLC40A1 mRNA CTD PMID:24793618 Slc40a1 Rat folic acid affects expression ISO SLC40A1 (Homo sapiens) 6480464 Folic Acid affects the expression of SLC40A1 mRNA CTD PMID:17868486 Slc40a1 Rat gadolinium trichloride decreases expression EXP 6480464 gadolinium chloride results in decreased expression of SLC40A1 CTD PMID:19721414 Slc40a1 Rat gallium nitrate decreases expression ISO SLC40A1 (Homo sapiens) 6480464 gallium nitrate results in decreased expression of SLC40A1 mRNA CTD PMID:18586083 Slc40a1 Rat Gastrodin multiple interactions ISO Slc40a1 (Mus musculus) 6480464 gastrodin inhibits the reaction [Glutamic Acid results in decreased expression of SLC40A1 protein] CTD PMID:31698019 Slc40a1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of SLC40A1 mRNA CTD PMID:33387578 Slc40a1 Rat glucose increases expression ISO SLC40A1 (Homo sapiens) 6480464 Glucose results in increased expression of SLC40A1 protein CTD PMID:38483099 Slc40a1 Rat glucose increases expression EXP 6480464 Glucose results in increased expression of SLC40A1 protein CTD PMID:38483099 Slc40a1 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of SLC40A1 mRNA CTD PMID:24915197 Slc40a1 Rat hexane decreases expression ISO Slc40a1 (Mus musculus) 6480464 n-hexane results in decreased expression of SLC40A1 mRNA CTD PMID:23353815 Slc40a1 Rat hypochlorous acid increases expression ISO Slc40a1 (Mus musculus) 6480464 Hypochlorous Acid results in increased expression of SLC40A1 mRNA CTD PMID:19376150 Slc40a1 Rat indoline multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [Thiazoles binds to indoline] promotes the reaction [1 and 3-dichloro-2-propanol results in decreased expression of SLC40A1 protein] CTD PMID:35870111 Slc40a1 Rat indometacin multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of SLC40A1 mRNA CTD PMID:28628672 Slc40a1 Rat inulin multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SLC40A1 mRNA CTD PMID:36331819 Slc40a1 Rat iron atom multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [HBB-B1 gene mutant form results in increased abundance of Iron] which results in increased expression of SLC40A1 mRNA more ... CTD PMID:17018382 more ... Slc40a1 Rat iron atom decreases expression ISO Slc40a1 (Mus musculus) 6480464 Iron results in decreased expression of SLC40A1 protein CTD PMID:22659129 Slc40a1 Rat iron atom decreases expression EXP 6480464 Iron results in decreased expression of SLC40A1 protein CTD PMID:22659129 Slc40a1 Rat iron atom increases expression EXP 6480464 Iron deficiency results in increased expression of SLC40A1 mRNA CTD PMID:19821111 and PMID:21540277 Slc40a1 Rat iron atom multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [CP protein results in increased oxidation of Iron] which results in increased stability of SLC40A1 protein more ... CTD PMID:20655381 and PMID:22178646 Slc40a1 Rat iron atom increases export ISO Slc40a1 (Mus musculus) 6480464 SLC40A1 protein mutant form results in increased export of Iron and SLC40A1 protein results in increased export of Iron CTD PMID:16457665 and PMID:21303654 Slc40a1 Rat iron atom decreases export ISO Slc40a1 (Mus musculus) 6480464 SLC40A1 protein mutant form results in decreased export of Iron CTD PMID:16457665 Slc40a1 Rat iron atom affects metabolic processing ISO Slc40a1 (Mus musculus) 6480464 SLC40A1 protein affects the metabolism of Iron CTD PMID:17194590 Slc40a1 Rat iron atom increases expression ISO Slc40a1 (Mus musculus) 6480464 Iron deficiency results in increased expression of SLC40A1 mRNA and Iron results in increased expression of SLC40A1 mRNA CTD PMID:16565419 more ... Slc40a1 Rat iron dextran multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [Iron-Dextran Complex results in increased abundance of Iron] which results in increased expression of SLC40A1 mRNA CTD PMID:33393188 Slc40a1 Rat iron dichloride decreases expression ISO SLC40A1 (Homo sapiens) 6480464 ferrous chloride results in decreased expression of SLC40A1 mRNA CTD PMID:35984750 Slc40a1 Rat iron(0) multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [CP protein results in increased oxidation of Iron] which results in increased stability of SLC40A1 protein more ... CTD PMID:20655381 and PMID:22178646 Slc40a1 Rat iron(0) increases export ISO Slc40a1 (Mus musculus) 6480464 SLC40A1 protein mutant form results in increased export of Iron and SLC40A1 protein results in increased export of Iron CTD PMID:16457665 and PMID:21303654 Slc40a1 Rat iron(0) decreases export ISO Slc40a1 (Mus musculus) 6480464 SLC40A1 protein mutant form results in decreased export of Iron CTD PMID:16457665 Slc40a1 Rat iron(0) affects metabolic processing ISO Slc40a1 (Mus musculus) 6480464 SLC40A1 protein affects the metabolism of Iron CTD PMID:17194590 Slc40a1 Rat iron(0) decreases expression ISO Slc40a1 (Mus musculus) 6480464 Iron results in decreased expression of SLC40A1 protein CTD PMID:22659129 Slc40a1 Rat iron(0) decreases expression EXP 6480464 Iron results in decreased expression of SLC40A1 protein CTD PMID:22659129 Slc40a1 Rat iron(0) increases expression EXP 6480464 Iron deficiency results in increased expression of SLC40A1 mRNA CTD PMID:19821111 and PMID:21540277 Slc40a1 Rat iron(0) multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [HBB-B1 gene mutant form results in increased abundance of Iron] which results in increased expression of SLC40A1 mRNA more ... CTD PMID:17018382 more ... Slc40a1 Rat iron(0) increases expression ISO Slc40a1 (Mus musculus) 6480464 Iron deficiency results in increased expression of SLC40A1 mRNA and Iron results in increased expression of SLC40A1 mRNA CTD PMID:16565419 more ... Slc40a1 Rat iron(2+) sulfate (anhydrous) multiple interactions ISO Slc40a1 (Mus musculus) 6480464 SLC40A1 protein inhibits the reaction [ferrous sulfate results in increased abundance of Reactive Oxygen Species] and SLC40A1 protein inhibits the reaction [ferrous sulfate results in increased uptake of Iron] CTD PMID:19913091 Slc40a1 Rat iron(III) nitrilotriacetate decreases expression ISO SLC40A1 (Homo sapiens) 6480464 ferric nitrilotriacetate results in decreased expression of SLC40A1 mRNA CTD PMID:11925462 Slc40a1 Rat isoprenaline increases expression ISO Slc40a1 (Mus musculus) 6480464 Isoproterenol results in increased expression of SLC40A1 mRNA CTD PMID:20003209 Slc40a1 Rat L-glutamic acid decreases expression ISO Slc40a1 (Mus musculus) 6480464 Glutamic Acid results in decreased expression of SLC40A1 protein CTD PMID:31698019 Slc40a1 Rat L-glutamic acid multiple interactions ISO Slc40a1 (Mus musculus) 6480464 gastrodin inhibits the reaction [Glutamic Acid results in decreased expression of SLC40A1 protein] CTD PMID:31698019 Slc40a1 Rat lamivudine multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [Zidovudine co-treated with Lamivudine] results in increased expression of SLC40A1 mRNA CTD PMID:18313992 Slc40a1 Rat lead diacetate multiple interactions EXP 6480464 [lead acetate results in increased abundance of Lead] which results in decreased expression of SLC40A1 mRNA more ... CTD PMID:36642386 and PMID:39276841 Slc40a1 Rat lead diacetate increases expression ISO Slc40a1 (Mus musculus) 6480464 lead acetate results in increased expression of SLC40A1 mRNA CTD PMID:30623991 Slc40a1 Rat lead diacetate decreases expression ISO Slc40a1 (Mus musculus) 6480464 lead acetate results in decreased expression of SLC40A1 mRNA CTD PMID:22613225 Slc40a1 Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of SLC40A1 mRNA and lead acetate results in decreased expression of SLC40A1 protein CTD PMID:23219683 Slc40a1 Rat lead(0) multiple interactions EXP 6480464 [lead acetate results in increased abundance of Lead] which results in decreased expression of SLC40A1 mRNA more ... CTD PMID:36642386 and PMID:39276841 Slc40a1 Rat lead(0) multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [Lead co-treated with N and N'-Bis(2-mercaptoethyl)isophthalamide] results in increased expression of SLC40A1 protein CTD PMID:34165617 Slc40a1 Rat lipopolysaccharide multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:21303654 and PMID:35811015 Slc40a1 Rat lipopolysaccharide multiple interactions ISO Slc40a1 (Mus musculus) 6480464 sulforaphane inhibits the reaction [Lipopolysaccharides results in decreased expression of SLC40A1 mRNA] CTD PMID:21303654 Slc40a1 Rat lipopolysaccharide decreases expression ISO Slc40a1 (Mus musculus) 6480464 Lipopolysaccharides results in decreased expression of SLC40A1 mRNA CTD PMID:16565419 more ... Slc40a1 Rat lipopolysaccharide decreases expression ISO SLC40A1 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of SLC40A1 mRNA CTD PMID:21303654 Slc40a1 Rat maneb multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [Paraquat co-treated with Maneb] results in decreased expression of SLC40A1 protein and acetovanillone inhibits the reaction [[Paraquat co-treated with Maneb] results in decreased expression of SLC40A1 protein] CTD PMID:30797899 Slc40a1 Rat manganese atom increases export ISO SLC40A1 (Homo sapiens) 6480464 SLC40A1 protein results in increased export of Manganese CTD PMID:22178646 Slc40a1 Rat manganese atom decreases expression ISO Slc40a1 (Mus musculus) 6480464 Manganese results in decreased expression of SLC40A1 mRNA CTD PMID:29020610 Slc40a1 Rat manganese atom multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 Cobalt inhibits the reaction [SLC40A1 protein results in increased export of Manganese] more ... CTD PMID:22178646 Slc40a1 Rat manganese(0) multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 Cobalt inhibits the reaction [SLC40A1 protein results in increased export of Manganese] more ... CTD PMID:22178646 Slc40a1 Rat manganese(0) decreases expression ISO Slc40a1 (Mus musculus) 6480464 Manganese results in decreased expression of SLC40A1 mRNA CTD PMID:29020610 Slc40a1 Rat manganese(0) increases export ISO SLC40A1 (Homo sapiens) 6480464 SLC40A1 protein results in increased export of Manganese CTD PMID:22178646 Slc40a1 Rat manganese(II) chloride decreases expression EXP 6480464 manganese chloride results in decreased expression of SLC40A1 mRNA CTD PMID:28801915 Slc40a1 Rat mercury dibromide increases expression ISO SLC40A1 (Homo sapiens) 6480464 mercuric bromide results in increased expression of SLC40A1 mRNA CTD PMID:26272509 Slc40a1 Rat mercury dibromide multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SLC40A1 mRNA CTD PMID:27188386 Slc40a1 Rat mercury dichloride increases expression EXP 6480464 Mercuric Chloride results in increased expression of SLC40A1 mRNA CTD PMID:16507785 Slc40a1 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of SLC40A1 mRNA CTD PMID:19564919 Slc40a1 Rat methamphetamine multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in decreased expression of SLC40A1 mRNA CTD PMID:19564919 Slc40a1 Rat methapyrilene increases expression ISO SLC40A1 (Homo sapiens) 6480464 Methapyrilene results in increased expression of SLC40A1 mRNA CTD PMID:28935588 Slc40a1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of SLC40A1 mRNA CTD PMID:20144635 Slc40a1 Rat methylmercury chloride decreases expression ISO SLC40A1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of SLC40A1 mRNA CTD PMID:23179753 Slc40a1 Rat mithramycin multiple interactions EXP 6480464 Plicamycin inhibits the reaction [cobaltous chloride results in increased expression of SLC40A1 mRNA] CTD PMID:23814049 Slc40a1 Rat mithramycin decreases expression EXP 6480464 Plicamycin results in decreased expression of SLC40A1 mRNA CTD PMID:23814049 Slc40a1 Rat N-acetyl-L-cysteine multiple interactions ISO Slc40a1 (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [Cadmium results in increased expression of SLC40A1 mRNA] CTD PMID:20090884 Slc40a1 Rat N-nitrosodiethylamine decreases expression ISO Slc40a1 (Mus musculus) 6480464 Diethylnitrosamine results in decreased expression of SLC40A1 mRNA and Diethylnitrosamine results in decreased expression of SLC40A1 protein CTD PMID:19061943 Slc40a1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of SLC40A1 mRNA CTD PMID:19638242 Slc40a1 Rat N-nitrosodiethylamine multiple interactions ISO Slc40a1 (Mus musculus) 6480464 Iron inhibits the reaction [Diethylnitrosamine results in decreased expression of SLC40A1 mRNA] and Iron inhibits the reaction [Diethylnitrosamine results in decreased expression of SLC40A1 protein] CTD PMID:19061943 Slc40a1 Rat naphthalene increases expression EXP 6480464 naphthalene analog results in increased expression of SLC40A1 mRNA CTD PMID:24976557 Slc40a1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of SLC40A1 mRNA CTD PMID:24136188 Slc40a1 Rat nickel atom multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 Nickel inhibits the reaction [SLC40A1 protein results in increased export of Manganese] CTD PMID:22178646 Slc40a1 Rat nickel atom decreases expression ISO SLC40A1 (Homo sapiens) 6480464 Nickel results in decreased expression of SLC40A1 mRNA CTD PMID:24768652 and PMID:25583101 Slc40a1 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of SLC40A1 mRNA CTD PMID:22110744 Slc40a1 Rat nickel sulfate increases expression ISO SLC40A1 (Homo sapiens) 6480464 nickel sulfate results in increased expression of SLC40A1 mRNA CTD PMID:22714537 Slc40a1 Rat nitric oxide decreases expression EXP 6480464 Nitric Oxide deficiency results in decreased expression of SLC40A1 protein CTD PMID:24184442 Slc40a1 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of SLC40A1 mRNA CTD PMID:33484710 Slc40a1 Rat omeprazole decreases expression ISO Slc40a1 (Mus musculus) 6480464 Omeprazole results in decreased expression of SLC40A1 protein CTD PMID:31669099 Slc40a1 Rat oxidopamine multiple interactions ISO Slc40a1 (Mus musculus) 6480464 Oxidopamine promotes the reaction [ACO1 protein results in decreased expression of SLC40A1 mRNA] and Oxidopamine promotes the reaction [IREB2 protein results in decreased expression of SLC40A1 mRNA] CTD PMID:19913091 Slc40a1 Rat oxidopamine decreases expression EXP 6480464 Oxidopamine results in decreased expression of SLC40A1 mRNA and Oxidopamine results in decreased expression of SLC40A1 protein CTD PMID:19913091 Slc40a1 Rat oxidopamine decreases expression ISO Slc40a1 (Mus musculus) 6480464 Oxidopamine results in decreased expression of SLC40A1 mRNA and Oxidopamine results in decreased expression of SLC40A1 protein CTD PMID:19913091 Slc40a1 Rat p-chloromercuribenzoic acid increases expression ISO SLC40A1 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of SLC40A1 mRNA CTD PMID:26272509 Slc40a1 Rat p-chloromercuribenzoic acid multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SLC40A1 mRNA CTD PMID:27188386 Slc40a1 Rat p-tert-Amylphenol increases expression EXP 6480464 4-tert-octylphenol results in increased expression of SLC40A1 mRNA CTD PMID:17011747 Slc40a1 Rat panobinostat increases expression ISO SLC40A1 (Homo sapiens) 6480464 panobinostat results in increased expression of SLC40A1 mRNA CTD PMID:26272509 Slc40a1 Rat panobinostat multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [Cisplatin co-treated with Panobinostat] affects the expression of SLC40A1 mRNA more ... CTD PMID:21791302 and PMID:27188386 Slc40a1 Rat paracetamol decreases expression ISO SLC40A1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of SLC40A1 mRNA CTD PMID:21420995 and PMID:29067470 Slc40a1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of SLC40A1 mRNA CTD PMID:33387578 Slc40a1 Rat paracetamol increases expression ISO SLC40A1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of SLC40A1 mRNA CTD PMID:22230336 Slc40a1 Rat paraquat multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [Paraquat co-treated with Maneb] results in decreased expression of SLC40A1 protein and acetovanillone inhibits the reaction [[Paraquat co-treated with Maneb] results in decreased expression of SLC40A1 protein] CTD PMID:30797899 Slc40a1 Rat paraquat increases expression ISO SLC40A1 (Homo sapiens) 6480464 Paraquat results in increased expression of SLC40A1 protein CTD PMID:37507096 Slc40a1 Rat paraquat multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 NFE2L2 protein promotes the reaction [Paraquat results in increased expression of SLC40A1 protein] CTD PMID:37507096 Slc40a1 Rat pentachlorophenol increases expression ISO Slc40a1 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of SLC40A1 mRNA CTD PMID:23892564 Slc40a1 Rat perfluorononanoic acid decreases expression ISO SLC40A1 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of SLC40A1 mRNA CTD PMID:32588087 Slc40a1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of SLC40A1 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SLC40A1 mRNA CTD PMID:36331819 Slc40a1 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of SLC40A1 mRNA CTD PMID:19162173 Slc40a1 Rat permethrin decreases expression EXP 6480464 Permethrin results in decreased expression of SLC40A1 mRNA CTD PMID:19017407 Slc40a1 Rat phenacetin increases expression EXP 6480464 Phenacetin results in increased expression of SLC40A1 mRNA CTD PMID:17082564 Slc40a1 Rat phenobarbital increases expression ISO Slc40a1 (Mus musculus) 6480464 Phenobarbital results in increased expression of SLC40A1 mRNA CTD PMID:25270620 Slc40a1 Rat phenylhydrazine increases expression EXP 6480464 phenylhydrazine results in increased expression of SLC40A1 mRNA CTD PMID:17082564 Slc40a1 Rat phenylmercury acetate increases expression ISO SLC40A1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of SLC40A1 mRNA CTD PMID:26272509 Slc40a1 Rat phenylmercury acetate multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SLC40A1 mRNA CTD PMID:27188386 Slc40a1 Rat phorone affects expression EXP 6480464 phorone affects the expression of SLC40A1 mRNA CTD PMID:18198479 Slc40a1 Rat pirinixic acid decreases expression ISO Slc40a1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of SLC40A1 mRNA CTD PMID:18445702 Slc40a1 Rat potassium chromate multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SLC40A1 mRNA CTD PMID:22079256 Slc40a1 Rat potassium chromate decreases expression ISO SLC40A1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of SLC40A1 mRNA CTD PMID:22079256 Slc40a1 Rat progesterone multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of SLC40A1 mRNA CTD PMID:20660070 Slc40a1 Rat quercetin decreases expression ISO SLC40A1 (Homo sapiens) 6480464 Quercetin results in decreased expression of SLC40A1 mRNA and Quercetin results in decreased expression of SLC40A1 protein CTD PMID:21632981 and PMID:25058155 Slc40a1 Rat quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of SLC40A1 mRNA CTD PMID:25058155 Slc40a1 Rat reactive oxygen species multiple interactions ISO Slc40a1 (Mus musculus) 6480464 SLC40A1 protein inhibits the reaction [ferrous sulfate results in increased abundance of Reactive Oxygen Species] CTD PMID:19913091 Slc40a1 Rat resveratrol multiple interactions ISO Slc40a1 (Mus musculus) 6480464 Resveratrol inhibits the reaction [Rotenone results in decreased expression of SLC40A1 protein] CTD PMID:34391968 Slc40a1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of SLC40A1 mRNA CTD PMID:28374803 Slc40a1 Rat rotenone multiple interactions ISO Slc40a1 (Mus musculus) 6480464 Resveratrol inhibits the reaction [Rotenone results in decreased expression of SLC40A1 protein] CTD PMID:34391968 Slc40a1 Rat rotenone decreases expression ISO Slc40a1 (Mus musculus) 6480464 Rotenone results in decreased expression of SLC40A1 protein CTD PMID:34391968 Slc40a1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of SLC40A1 mRNA CTD PMID:35811015 Slc40a1 Rat SB 431542 multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Slc40a1 Rat SCH 23390 multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in decreased expression of SLC40A1 mRNA CTD PMID:19564919 Slc40a1 Rat sclareol decreases expression ISO SLC40A1 (Homo sapiens) 6480464 sclareol results in decreased expression of SLC40A1 protein CTD PMID:37850667 Slc40a1 Rat silicon dioxide increases expression ISO Slc40a1 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of SLC40A1 mRNA CTD PMID:19073995 and PMID:29203145 Slc40a1 Rat silicon dioxide decreases expression ISO Slc40a1 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of SLC40A1 mRNA CTD PMID:23221170 Slc40a1 Rat silicon dioxide decreases expression ISO SLC40A1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of SLC40A1 mRNA CTD PMID:25895662 Slc40a1 Rat silver atom increases expression ISO SLC40A1 (Homo sapiens) 6480464 Silver results in increased expression of SLC40A1 mRNA CTD PMID:26014281 Slc40a1 Rat silver(0) increases expression ISO SLC40A1 (Homo sapiens) 6480464 Silver results in increased expression of SLC40A1 mRNA CTD PMID:26014281 Slc40a1 Rat sodium arsenite increases expression ISO SLC40A1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SLC40A1 mRNA CTD PMID:22714537 and PMID:29301061 Slc40a1 Rat sodium arsenite decreases expression ISO Slc40a1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of SLC40A1 mRNA CTD PMID:37682722 Slc40a1 Rat sodium arsenite multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SLC40A1 mRNA CTD PMID:39836092 Slc40a1 Rat sodium arsenite increases expression ISO Slc40a1 (Mus musculus) 6480464 sodium arsenite results in increased expression of SLC40A1 mRNA CTD PMID:25270620 Slc40a1 Rat sodium fluoride decreases expression ISO Slc40a1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of SLC40A1 mRNA and Sodium Fluoride results in decreased expression of SLC40A1 protein CTD PMID:29743442 Slc40a1 Rat sodium fluoride multiple interactions ISO Slc40a1 (Mus musculus) 6480464 Grape Seed Proanthocyanidins inhibits the reaction [Sodium Fluoride results in decreased expression of SLC40A1 mRNA] and Grape Seed Proanthocyanidins inhibits the reaction [Sodium Fluoride results in decreased expression of SLC40A1 protein] CTD PMID:29743442 Slc40a1 Rat succimer multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of SLC40A1 mRNA and [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of SLC40A1 mRNA CTD PMID:21641980 more ... Slc40a1 Rat sulforaphane multiple interactions ISO Slc40a1 (Mus musculus) 6480464 sulforaphane inhibits the reaction [Busulfan results in decreased expression of SLC40A1 protein] and sulforaphane inhibits the reaction [Lipopolysaccharides results in decreased expression of SLC40A1 mRNA] CTD PMID:21303654 and PMID:32416107 Slc40a1 Rat sulforaphane increases expression ISO Slc40a1 (Mus musculus) 6480464 sulforaphane results in increased expression of SLC40A1 protein CTD PMID:32416107 Slc40a1 Rat tamoxifen affects expression ISO Slc40a1 (Mus musculus) 6480464 Tamoxifen affects the expression of SLC40A1 mRNA CTD PMID:17555576 Slc40a1 Rat testosterone multiple interactions ISO Slc40a1 (Mus musculus) 6480464 1 more ... CTD PMID:33848595 Slc40a1 Rat testosterone increases expression ISO Slc40a1 (Mus musculus) 6480464 Testosterone deficiency results in increased expression of SLC40A1 mRNA CTD PMID:33848595 Slc40a1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of SLC40A1 protein CTD PMID:17544377 Slc40a1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of SLC40A1 mRNA CTD PMID:31150632 Slc40a1 Rat thiazoles multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [Thiazoles binds to indoline] promotes the reaction [1 and 3-dichloro-2-propanol results in decreased expression of SLC40A1 protein] CTD PMID:35870111 Slc40a1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of SLC40A1 mRNA CTD PMID:23411599 and PMID:34492290 Slc40a1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of SLC40A1 mRNA CTD PMID:34492290 Slc40a1 Rat titanium dioxide multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SLC40A1 mRNA CTD PMID:29950665 Slc40a1 Rat toluene increases expression EXP 6480464 Toluene results in increased expression of SLC40A1 mRNA CTD PMID:22967744 Slc40a1 Rat toosendanin decreases expression ISO Slc40a1 (Mus musculus) 6480464 toosendanin results in decreased expression of SLC40A1 protein CTD PMID:36801351 Slc40a1 Rat toosendanin decreases expression ISO SLC40A1 (Homo sapiens) 6480464 toosendanin results in decreased expression of SLC40A1 mRNA and toosendanin results in decreased expression of SLC40A1 protein CTD PMID:36801351 Slc40a1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of SLC40A1 mRNA CTD PMID:33387578 Slc40a1 Rat trichostatin A increases expression ISO SLC40A1 (Homo sapiens) 6480464 trichostatin A results in increased expression of SLC40A1 mRNA CTD PMID:24935251 and PMID:26272509 Slc40a1 Rat trichostatin A multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SLC40A1 mRNA CTD PMID:27188386 Slc40a1 Rat trimellitic anhydride decreases expression ISO Slc40a1 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of SLC40A1 mRNA CTD PMID:19042947 Slc40a1 Rat triptonide decreases expression ISO Slc40a1 (Mus musculus) 6480464 triptonide results in decreased expression of SLC40A1 mRNA CTD PMID:33045310 Slc40a1 Rat tunicamycin decreases expression ISO Slc40a1 (Mus musculus) 6480464 Tunicamycin results in decreased expression of SLC40A1 mRNA CTD PMID:17127020 Slc40a1 Rat valproic acid decreases expression ISO Slc40a1 (Mus musculus) 6480464 Valproic Acid results in decreased expression of SLC40A1 mRNA CTD PMID:21427059 Slc40a1 Rat valproic acid multiple interactions ISO Slc40a1 (Mus musculus) 6480464 Deferoxamine inhibits the reaction [Valproic Acid results in increased expression of SLC40A1 mRNA] and ferrostatin-1 inhibits the reaction [Valproic Acid results in increased expression of SLC40A1 mRNA] CTD PMID:39147356 Slc40a1 Rat valproic acid decreases expression ISO SLC40A1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SLC40A1 protein CTD PMID:39147356 Slc40a1 Rat valproic acid multiple interactions ISO SLC40A1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:39147356 Slc40a1 Rat valproic acid increases expression ISO SLC40A1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SLC40A1 mRNA CTD PMID:23179753 more ... Slc40a1 Rat valproic acid increases expression ISO Slc40a1 (Mus musculus) 6480464 Valproic Acid results in increased expression of SLC40A1 mRNA CTD PMID:24896083 and PMID:39147356 Slc40a1 Rat zidovudine multiple interactions ISO Slc40a1 (Mus musculus) 6480464 [Zidovudine co-treated with Lamivudine] results in increased expression of SLC40A1 mRNA CTD PMID:18313992 Slc40a1 Rat zidovudine increases expression ISO SLC40A1 (Homo sapiens) 6480464 Zidovudine results in increased expression of SLC40A1 mRNA CTD PMID:24292225 Slc40a1 Rat zinc atom decreases expression EXP 6480464 Zinc results in decreased expression of SLC40A1 protein CTD PMID:16614402 Slc40a1 Rat zinc atom multiple interactions ISO Slc40a1 (Mus musculus) 6480464 MTF1 mutant form inhibits the reaction [Zinc results in increased expression of SLC40A1 mRNA] CTD PMID:20688958 Slc40a1 Rat zinc atom increases expression ISO Slc40a1 (Mus musculus) 6480464 Zinc results in increased expression of SLC40A1 mRNA CTD PMID:20688958 Slc40a1 Rat zinc atom increases expression EXP 6480464 Zinc results in increased expression of SLC40A1 protein CTD PMID:16614402 Slc40a1 Rat zinc(0) decreases expression EXP 6480464 Zinc results in decreased expression of SLC40A1 protein CTD PMID:16614402 Slc40a1 Rat zinc(0) increases expression EXP 6480464 Zinc results in increased expression of SLC40A1 protein CTD PMID:16614402 Slc40a1 Rat zinc(0) increases expression ISO Slc40a1 (Mus musculus) 6480464 Zinc results in increased expression of SLC40A1 mRNA CTD PMID:20688958 Slc40a1 Rat zinc(0) multiple interactions ISO Slc40a1 (Mus musculus) 6480464 MTF1 mutant form inhibits the reaction [Zinc results in increased expression of SLC40A1 mRNA] CTD PMID:20688958 Slc40a1 Rat zoledronic acid increases expression ISO SLC40A1 (Homo sapiens) 6480464 zoledronic acid results in increased expression of SLC40A1 mRNA CTD PMID:24714768
(+)-catechin (ISO) (+)-dexrazoxane (ISO) (-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1,3-dichloropropan-2-ol (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-acetamidofluorene (EXP) 2-tert-butylhydroquinone (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP,ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-dihydroxybenzoate (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 4-tert-Octylphenol (EXP) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (ISO) acetamide (EXP) acrylamide (EXP) actinomycin D (ISO) aflatoxin B1 (EXP,ISO) alcohol (ISO) aldehydo-D-glucose (EXP,ISO) all-trans-retinoic acid (EXP,ISO) ammonium chloride (EXP) antirheumatic drug (ISO) apocynin (ISO) Aroclor 1254 (EXP) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atrazine (EXP) azathioprine (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) busulfan (ISO) buta-1,3-diene (ISO) cadmium atom (EXP,ISO) cadmium dichloride (EXP,ISO) cannabidiol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloroprene (ISO) chlorpyrifos (ISO) chromium(6+) (EXP,ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) cobalt atom (ISO) cobalt dichloride (EXP,ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclophosphamide (ISO) cyclosporin A (ISO) cytarabine (ISO) D-glucose (EXP,ISO) desferrioxamine B (ISO) dexamethasone (ISO) dextran sulfate (ISO) diallyl trisulfide (EXP) diarsenic trioxide (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) diethyl maleate (ISO) diethylstilbestrol (EXP) dimethyl fumarate (ISO) diquat (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) epoxiconazole (ISO) erastin (EXP,ISO) ethanol (ISO) ferric ammonium citrate (EXP,ISO) ferrostatin-1 (ISO) flutamide (EXP) folic acid (ISO) gadolinium trichloride (EXP) gallium nitrate (ISO) Gastrodin (ISO) gentamycin (EXP) glucose (EXP,ISO) glycidol (EXP) hexane (ISO) hypochlorous acid (ISO) indoline (ISO) indometacin (ISO) inulin (ISO) iron atom (EXP,ISO) iron dextran (ISO) iron dichloride (ISO) iron(0) (EXP,ISO) iron(2+) sulfate (anhydrous) (ISO) iron(III) nitrilotriacetate (ISO) isoprenaline (ISO) L-glutamic acid (ISO) lamivudine (ISO) lead diacetate (EXP,ISO) lead(0) (EXP,ISO) lipopolysaccharide (ISO) maneb (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (EXP) mercury dibromide (ISO) mercury dichloride (EXP) methamphetamine (EXP) methapyrilene (ISO) methimazole (EXP) methylmercury chloride (ISO) mithramycin (EXP) N-acetyl-L-cysteine (ISO) N-nitrosodiethylamine (EXP,ISO) naphthalene (EXP) nefazodone (EXP) nickel atom (ISO) nickel dichloride (EXP) nickel sulfate (ISO) nitric oxide (EXP) nitrofen (EXP) omeprazole (ISO) oxidopamine (EXP,ISO) p-chloromercuribenzoic acid (ISO) p-tert-Amylphenol (EXP) panobinostat (ISO) paracetamol (EXP,ISO) paraquat (ISO) pentachlorophenol (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) permethrin (EXP) phenacetin (EXP) phenobarbital (ISO) phenylhydrazine (EXP) phenylmercury acetate (ISO) phorone (EXP) pirinixic acid (ISO) potassium chromate (ISO) progesterone (ISO) quercetin (EXP,ISO) reactive oxygen species (ISO) resveratrol (ISO) rotenone (EXP,ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) SCH 23390 (EXP) sclareol (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium fluoride (ISO) succimer (ISO) sulforaphane (ISO) tamoxifen (ISO) testosterone (ISO) tetrachloromethane (EXP) thiazoles (ISO) thioacetamide (EXP) titanium dioxide (ISO) toluene (EXP) toosendanin (ISO) trichloroethene (EXP) trichostatin A (ISO) trimellitic anhydride (ISO) triptonide (ISO) tunicamycin (ISO) valproic acid (ISO) zidovudine (ISO) zinc atom (EXP,ISO) zinc(0) (EXP,ISO) zoledronic acid (ISO)
Biological Process
apoptotic process (IEA,ISO) endothelium development (IEA,ISO) establishment of localization in cell (IEA,ISO) intracellular iron ion homeostasis (IEA,ISO) iron ion export across plasma membrane (IEA,ISO,ISS) iron ion transmembrane transport (IBA,IEA,ISO) iron ion transport (IEA,ISO,NAS) lymphocyte homeostasis (IEA,ISO) monoatomic ion transport (IEA) multicellular organismal-level iron ion homeostasis (IEA,ISO) negative regulation of apoptotic process (IEA,ISO) positive regulation of transcription by RNA polymerase II (IEA,ISO) spleen development (IEA,ISO) spleen trabecula formation (IEA,ISO) transcription by RNA polymerase II (IEA,ISO) transmembrane transport (IEA)
1.
Interleukin-1beta up-regulates iron efflux in rat C6 glioma cells through modulation of ceruloplasmin and ferroportin-1 synthesis.
di Patti MC, etal., Neurosci Lett 2004 Jun 10;363(2):182-6.
2.
Ironing out Ferroportin.
Drakesmith H, etal., Cell Metab. 2015 Nov 3;22(5):777-87. doi: 10.1016/j.cmet.2015.09.006. Epub 2015 Oct 1.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Cloning and expressions of three mammalian homologues of Drosophila slit suggest possible roles for Slit in the formation and maintenance of the nervous system.
Itoh A, etal., Brain Res Mol Brain Res 1998 Nov 20;62(2):175-86.
5.
Distribution of ferroportin1 protein in different regions of developing rat brain.
Jiang DH, etal., Dev Neurosci 2002;24(2-3):94-8.
6.
DMT1 and FPN1 expression during infancy: developmental regulation of iron absorption.
Leong WI, etal., Am J Physiol Gastrointest Liver Physiol 2003 Dec;285(6):G1153-61. Epub 2003 Sep 04.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
GOA pipeline
RGD automated data pipeline
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Novel mutation in ferroportin1 is associated with autosomal dominant hemochromatosis.
Wallace DF, etal., Blood 2002 Jul 15;100(2):692-4.
14.
Hepcidin regulation of ferroportin 1 expression in the liver and intestine of the rat.
Yeh KY, etal., Am J Physiol Gastrointest Liver Physiol 2004 Mar;286(3):G385-94. Epub 2003 Oct 30.
Slc40a1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 55,525,457 - 55,633,463 (-) NCBI GRCr8 mRatBN7.2 9 48,033,526 - 48,053,876 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 48,033,526 - 48,051,481 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 56,559,843 - 56,577,824 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 61,682,660 - 61,700,640 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 59,978,656 - 59,996,636 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 52,819,451 - 52,830,461 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 52,894,365 - 52,912,293 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 52,560,116 - 52,579,079 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 44,977,430 - 44,995,358 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 44,979,984 - 44,996,778 (-) NCBI Celera 9 45,700,875 - 45,718,803 (-) NCBI Celera Cytogenetic Map 9 q22 NCBI
SLC40A1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 189,560,590 - 189,580,786 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 189,560,590 - 189,583,758 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 190,425,316 - 190,445,512 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 190,133,561 - 190,153,858 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 190,250,823 - 190,271,119 NCBI Celera 2 184,020,234 - 184,040,455 (-) NCBI Celera Cytogenetic Map 2 q32.2 NCBI HuRef 2 182,284,805 - 182,305,032 (-) NCBI HuRef CHM1_1 2 190,431,102 - 190,451,326 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 190,049,828 - 190,070,025 (-) NCBI T2T-CHM13v2.0
Slc40a1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 45,947,230 - 45,965,690 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 45,947,228 - 45,965,683 (-) Ensembl GRCm39 Ensembl GRCm38 1 45,908,070 - 45,926,532 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 45,908,068 - 45,926,523 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 45,964,915 - 45,982,439 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 45,852,630 - 45,870,079 (-) NCBI MGSCv36 mm8 Celera 1 46,240,344 - 46,257,933 (-) NCBI Celera Cytogenetic Map 1 C1.1 NCBI cM Map 1 23.96 NCBI
Slc40a1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955403 9,253,734 - 9,271,916 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955403 9,253,734 - 9,271,732 (+) NCBI ChiLan1.0 ChiLan1.0
SLC40A1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 92,254,018 - 92,274,565 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 92,269,001 - 92,289,544 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 76,867,908 - 76,888,403 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 194,787,575 - 194,808,129 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 194,787,575 - 194,810,993 (-) Ensembl panpan1.1 panPan2
SLC40A1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 37 308,054 - 329,037 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 37 303,104 - 368,865 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 37 1,278,631 - 1,299,609 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 37 196,731 - 217,705 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 37 183,743 - 312,839 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 37 209,278 - 230,249 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 37 177,455 - 198,429 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 37 205,666 - 226,640 (-) NCBI UU_Cfam_GSD_1.0
Slc40a1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 148,421,846 - 148,441,474 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936506 8,396,912 - 8,416,374 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936506 8,396,593 - 8,415,069 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SLC40A1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 94,141,988 - 94,167,408 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 94,140,635 - 94,161,793 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 105,177,377 - 105,198,528 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SLC40A1 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 75,076,286 - 75,097,742 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 75,075,971 - 75,096,271 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 124,382,259 - 124,402,681 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Slc40a1 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 464 Count of miRNA genes: 237 Interacting mature miRNAs: 285 Transcripts: ENSRNOT00000005228, ENSRNOT00000073557 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7411571 Bw138 Body weight QTL 138 14.3 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 9 32535505 77535505 Rat 1300180 Bw14 Body weight QTL 14 3.776 body mass (VT:0001259) body weight (CMO:0000012) 9 23754024 61381613 Rat 11353957 Bmd92 Bone mineral density QTL 92 0.01 tibia mineral mass (VT:1000283) volumetric bone mineral density (CMO:0001553) 9 46114199 91114199 Rat 631680 Cm11 Cardiac mass QTL 11 3.1 0.00089 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 9 20430519 65430519 Rat 70218 Cm28 Cardiac mass QTL 28 8.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 9 25268044 79271759 Rat 724544 Uae9 Urinary albumin excretion QTL 9 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 9 25268044 114175309 Rat 7207805 Bmd88 Bone mineral density QTL 88 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 9 23754024 58157242 Rat 631643 Bp120 Blood pressure QTL 120 3 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 22071200 67071200 Rat 12879506 Pur33 Proteinuria QTL 33 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 44649921 89649921 Rat 731164 Uae25 Urinary albumin excretion QTL 25 3.5 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 25661188 100929786 Rat 10058949 Gmadr5 Adrenal mass QTL 5 2 0.014 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 9 42791513 87976209 Rat 9589133 Insul26 Insulin level QTL 26 17.96 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 9 8952560 53952560 Rat 631211 Bw4 Body weight QTL4 5.31 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 9 5109826 50109826 Rat 7411609 Foco16 Food consumption QTL 16 25.6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 8952560 53952560 Rat 8662828 Vetf6 Vascular elastic tissue fragility QTL 6 3.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 9 36962359 92058970 Rat 61352 Bp34 Blood pressure QTL 34 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 42495343 79271511 Rat 6903937 Bp356 Blood pressure QTL 356 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 47902208 52283252 Rat 1598834 Memor11 Memory QTL 11 2.5 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 9 36962359 77814038 Rat 70186 Niddm26 Non-insulin dependent diabetes mellitus QTL 26 3.87 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 9 22071169 86369743 Rat 7207814 Bmd91 Bone mineral density QTL 91 3.5 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 9 23754144 83851531 Rat 6903941 Pur31 Proteinuria QTL 31 0.036 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 9 40194188 85194188 Rat 2290450 Scl57 Serum cholesterol level QTL 57 4.15 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 9 36962359 95410867 Rat 11353949 Bp393 Blood pressure QTL 393 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 40194188 85194188 Rat 11353951 Bp394 Blood pressure QTL 394 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 44649921 89649921 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 11353947 Bp392 Blood pressure QTL 392 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 7283252 52283252 Rat 1331757 Cdexp1 CD45RC expression in CD8 T cells QTL 1 4.3 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 9 1024537 67509080 Rat 7411656 Foco26 Food consumption QTL 26 9.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 32535505 77535505 Rat 1598823 Memor16 Memory QTL 16 1.9 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) 9 22133322 49968732 Rat 1641894 Alcrsp12 Alcohol response QTL 12 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 9 27468639 72468639 Rat
D9Rat60
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 48,035,934 - 48,036,057 (+) MAPPER mRatBN7.2 Rnor_6.0 9 52,896,774 - 52,896,896 NCBI Rnor6.0 Rnor_6.0 9 52,821,860 - 52,821,982 NCBI Rnor6.0 Rnor_5.0 9 52,562,590 - 52,562,712 UniSTS Rnor5.0 Rnor_5.0 9 52,487,676 - 52,487,798 UniSTS Rnor5.0 RGSC_v3.4 9 44,979,838 - 44,979,961 RGD RGSC3.4 RGSC_v3.4 9 44,979,839 - 44,979,961 UniSTS RGSC3.4 RGSC_v3.1 9 44,981,242 - 44,981,612 RGD Celera 9 45,703,284 - 45,703,406 UniSTS SHRSP x BN Map 9 41.0698 UniSTS SHRSP x BN Map 9 41.0698 RGD FHH x ACI Map 9 32.43 RGD Cytogenetic Map 9 q22 UniSTS
RH129386
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 48,033,867 - 48,034,064 (+) MAPPER mRatBN7.2 Rnor_6.0 9 52,894,707 - 52,894,903 NCBI Rnor6.0 Rnor_6.0 9 52,819,793 - 52,819,989 NCBI Rnor6.0 Rnor_5.0 9 52,485,609 - 52,485,805 UniSTS Rnor5.0 Rnor_5.0 9 52,560,523 - 52,560,719 UniSTS Rnor5.0 RGSC_v3.4 9 44,977,772 - 44,977,968 UniSTS RGSC3.4 Celera 9 45,701,217 - 45,701,413 UniSTS Cytogenetic Map 9 q22 UniSTS
RH136898
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 48,034,706 - 48,034,886 (+) MAPPER mRatBN7.2 Rnor_6.0 9 52,820,632 - 52,820,811 NCBI Rnor6.0 Rnor_6.0 9 52,895,546 - 52,895,725 NCBI Rnor6.0 Rnor_5.0 9 52,486,448 - 52,486,627 UniSTS Rnor5.0 Rnor_5.0 9 52,561,362 - 52,561,541 UniSTS Rnor5.0 RGSC_v3.4 9 44,978,611 - 44,978,790 UniSTS RGSC3.4 Celera 9 45,702,056 - 45,702,235 UniSTS Cytogenetic Map 9 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
88
87
56
25
56
6
214
97
93
44
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005228 ⟹ ENSRNOP00000005228
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 48,033,527 - 48,051,481 (-) Ensembl Rnor_6.0 Ensembl 9 52,894,365 - 52,912,293 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000095235 ⟹ ENSRNOP00000086572
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 48,033,526 - 48,049,019 (-) Ensembl
RefSeq Acc Id:
NM_133315 ⟹ NP_579849
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 55,525,532 - 55,543,460 (-) NCBI mRatBN7.2 9 48,033,526 - 48,051,455 (-) NCBI Rnor_6.0 9 52,819,451 - 52,830,461 (-) NCBI Rnor_5.0 9 52,560,116 - 52,579,079 (-) NCBI RGSC_v3.4 9 44,977,430 - 44,995,358 (-) RGD Celera 9 45,700,875 - 45,718,803 (-) RGD
Sequence:
CAGGCTTAGGGTCTACTGCGGCCGGTGGACCCTCCAACCCGCTTCCATAAGGCTTTAGCTTTCCAACTTCAGCTACAGTGTTAGCTAAGTTTGGAAAGAAGACATAAAGAAGACCCCGGTGGCAGCTT TGCTGTTCTTTGCCTTAGTTGTCCTTTGGGGTCTTTCGGCACAAGGCTGCTGTGCTTATAGCCGTGCTATCTCCGGTTCCTCACACTCCTGTGAAGAAGCCCCTGGGCAAGAGCAGCTAAAGCTACTA GCATCCGAACAAACAAGGGGAGAGCGTCTGGTGCCATGACCAAGTCAAGAGATCAGACCCATCAGGAAGGATGCTGTGGATCTTTAGCAAACTACCTGACCTCAGCAAAATTCCTCCTCTACCTTGGC CACTCTCTCTCCACTTGGGGGGATCGGATGTGGCACTTTGCAGTGTCTGTGTTTCTGGTGGAACTCTACGGAAACAGCCTCCTCTTGACAGCTGTCTACGGGTTGGTGGTGGCAGGCTCTGTTCTGGT CCTGGGAGCCATCATTGGTGACTGGGTGGATAAGAATGCCAGACTTAAAGTGGCCCAGACGTCCCTGGTGGTTCAGAATGTATCAGTCATTCTCTGCGGGATCATCCTGATGATGGTTTTCTTACACA AGAATGAGCTTCTGAACATGTATCATGGATGGGTCCTTACTGTCTGCTACATCCTGATCATCACCATTGCAAACATTGCGAATTTGGCCAGTACTGCCACTGCAATTACAATCCAAAGGGACTGGATT GTTGTCGTAGCAGGAGAAAACAGGAGCAGATTAGCAGACATGAATGCTACCATTAGAAGGATTGACCAGCTAACCAACATCCTGGCCCCCATGGCTGTTGGCCAGATTATGACATTCGGTTCCCCAGT CATTGGCTGTGGTTTCATTTCTGGTTGGAATTTGGTGTCCATGTGTGTGGAGTACTTCTTGCTCTGGAAGGTTTACCAGAAGACCCCTGCTCTGGCTGTAAAAGCTGCTCTCAAGGTAGAGGAGTCAG AACTGAAGCAGCTGACCTCACCTAAAGATACTGAGCCAAAACCTTTGGAGGGAACTCACCTAATGGGTGAGAAAGACTCTAACATCCGTGAACTTGAATGTGAACAAGAACCCACCTGTGCCTCCCAG ATCGCAGAACCCTTCCGCACTTTTCGAGATGGATGGGTCTCCTACTATAACCAGCCCGTATTTTTGGCTGGCATGGGCCTGGCTTTCCTCTATATGACAGTCCTGGGCTTCGACTGTATCACCACAGG ATATGCTTACACTCAGGGACTGAGTGGTTCCATCCTCAGTGTTTTGATGGGAGCATCAGCAATAACTGGAATAATGGGAACTGTGGCCTTCACTTGGCTACGTCGAAAATGTGGCCTTGTTCGGACTG GTCTGTTCTCAGGACTGGCTCAGCTTTCTTGTTTGATCTTGTGTGTGATCTCCGTGTTCATGCCTGGAAGCCCCTTGGACCTGTCTGTTTCTCCATTTGAAGATATCCGTTCTAGGTTTATACATGAG GAGGCAGTGTCCTCAACTACCAAAATACCTGAAACAGAAATGCTTATGTCTAATGTGTCTAATGTTGTCAATACCGTCCATGAGATGAGTACTAAATCCGTCCCCATAATCTCCGTCAGCCTGCTGTT TGCAGGAGTCATTGCTGCTAGAATCGGTCTTTGGTCCTTTGATTTGACTGTGACACAGTTGCTGCAAGAAAATGTAATTGAATCAGAAAGAGGCATTATCAATGGTGTGCAGAACTCCATGAACTACC TTCTCGACCTTCTGCATTTCATCATGGTCATCTTGGCCCCAAATCCTGAAGCTTTTGGCTTGCTAGTATTGATTTCAGTCTCCTTTGTGGCAATGGGACATCTTATGTATTTCCGTTTTGCCCAGAAG ACTCTGGGCAACCAGATTTTTGTTTGTGCTCCTGATGAAAAGGAAGTTACAGATGAAAGTCAGCCTAATACATCTGTTGTGTAAAATAGTTTAGCTGTGGCCCCTGTTACTAGATTTGTGGAGAGCAT GTGTGCTTATTTTGTACTACAGAATTCCAATAAATGCCTGCACTTTTCTCTGTTTTTACTACAGCTGTGCCTTAAGGGTTAGGGGCACTAACGAACCTTCACCAGCGAAGATGGTTATTTCTCCTTAC ATGTAAACATGGGGAAATAAGAGGGAGAGGAAAAGTCAGCATGTGGGTAGGATGGGTTTAATGGTAAAATGAGTTTCCCATACTCTTATGAGTATATTAAATTTTAAAGAGTGGCTGTCAGGTGAGTT AAATTACTCCATAGTAGATATTGTCCACTAGAATGCAGATAAATCAATTCACCCCAAAACTCACTCTTGTAAAAGTCTGGCTCACTTCCCTTTTTTTTTTAAAGATGAGTAGTATTTTTCTCAGTTAC GTTACAGAAACAAGTTTTTCTCCTTGTAGGAAGATTATAGTCTGATAATGAGCATTATTCTTATTAATCCCATTGAACTTAGGGAATTTATTATATGTGAAGGATGAAATACATAACTAAACTTCTTC AAAAGGCTCATGGTATAACCTTTGCATTTTGACTATCAGCTAGGGCAAAATATTACAGTAATGTGTGTATGTGGCTCTTCCTAAAATGACTGCAGAGAGAAGAAAAGCTGTAGATTTCTAGTGCAGTA CAGAAGGACTTAAAGCACGTTATTGGTGTGGTTGTAGAAACTGGAAGCTAATGGGGAGGACCTCACGTAACCAGAGTCACTGTTGTCAGTGATCACTAACTATCCTGGTATATGAAAGAGCTGGCCCT AGGCCTAGCACCTGACAGGCAGAAAAGCAGCCCACGCTTGGAAAGGACTGCACATCAATGATGAGCTTGTACAGAGCATTTTACCTTCACTGACTTGGGCCGACGTGTTTATTATCTCTGTCTTTTTC TAGAGCAAGAATAGTCACAAAGGTTCCCCTTTCAATATCTCTGAAAAGAATAAAGAAAAAACTGTTTGTAAATATTTTTTAAACTGTTCTACAAGTCTTTTTGTAATATGCAGTACCAACATGGGACA TTGCTTTAACTTTTGATGCACTTTCATGGAGACCGCCATGCGTTGCTAGGAGCACTTTCTTTCCATTTAATATTTTTCTTCACCCTTCTGCAGTATGACATAATGATTGACTATGTTATAAAATCTTC ATAAAATATTTCTATATAAAATGTTTGTAAAATCTTAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_039082988 ⟹ XP_038938916
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 55,525,457 - 55,633,463 (-) NCBI mRatBN7.2 9 48,033,541 - 48,053,876 (-) NCBI
RefSeq Acc Id:
XM_063266613 ⟹ XP_063122683
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 55,525,457 - 55,633,463 (-) NCBI
RefSeq Acc Id:
NP_579849 ⟸ NM_133315
- UniProtKB:
Q9Z1C9 (UniProtKB/Swiss-Prot), Q923U9 (UniProtKB/Swiss-Prot), G3V6H7 (UniProtKB/TrEMBL), A6INT8 (UniProtKB/TrEMBL), A0A9M1WP97 (UniProtKB/TrEMBL)
- Sequence:
MTKSRDQTHQEGCCGSLANYLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQNVSVILCGIILMMVFLHKNELLNMYHGWV LTVCYILIITIANIANLASTATAITIQRDWIVVVAGENRSRLADMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYFLLWKVYQKTPALAVKAALKVEESELKQLTSPKDTE PKPLEGTHLMGEKDSNIRELECEQEPTCASQIAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGSILSVLMGASAITGIMGTVAFTWLRRKCGLVRTGLFSGLAQLSCL ILCVISVFMPGSPLDLSVSPFEDIRSRFIHEEAVSSTTKIPETEMLMSNVSNVVNTVHEMSTKSVPIISVSLLFAGVIAARIGLWSFDLTVTQLLQENVIESERGIINGVQNSMNYLLDLLHFIMVIL APNPEAFGLLVLISVSFVAMGHLMYFRFAQKTLGNQIFVCAPDEKEVTDESQPNTSVV
hide sequence
Ensembl Acc Id:
ENSRNOP00000005228 ⟸ ENSRNOT00000005228
RefSeq Acc Id:
XP_038938916 ⟸ XM_039082988
- Peptide Label:
isoform X1
- UniProtKB:
Q923U9 (UniProtKB/Swiss-Prot), G3V6H7 (UniProtKB/Swiss-Prot), Q9Z1C9 (UniProtKB/Swiss-Prot), A6INT8 (UniProtKB/TrEMBL), A0A9M1WP97 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000086572 ⟸ ENSRNOT00000095235
RefSeq Acc Id:
XP_063122683 ⟸ XM_063266613
- Peptide Label:
isoform X1
- UniProtKB:
Q9Z1C9 (UniProtKB/Swiss-Prot), Q923U9 (UniProtKB/Swiss-Prot), G3V6H7 (UniProtKB/Swiss-Prot), A6INT8 (UniProtKB/TrEMBL), A0A9M1WP97 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Slc40a1
solute carrier family 40 member 1
NEWGENE_620180
solute carrier family 40 member 1
Data merged from RGD:11441106
737654
PROVISIONAL
2016-08-02
NEWGENE_620180
solute carrier family 40 member 1
Symbol and Name status set to provisional
70820
PROVISIONAL
2016-03-09
Slc40a1
solute carrier family 40 member 1
Slc40a1
solute carrier family 40 (iron-regulated transporter), member 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2012-10-16
Slc40a1
solute carrier family 40 (iron-regulated transporter), member 1
Slc40a1
solute carrier family 39 (iron-regulated transporter), member 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2004-09-10
Slc40a1
solute carrier family 39 (iron-regulated transporter), member 1
Slc39a1
Symbol and Name updated
1299863
APPROVED
2002-08-07
Slc39a1
solute carrier family 39 (iron-regulated transporter), member 1
Symbol and Name status set to provisional
70820
PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed in many specific regions of the brain
634086
gene_regulation
expression downregulated by hepcidin in an LPS-induced manner
1304454