Gene: Ppp1r1a (protein phosphatase 1, regulatory (inhibitor) subunit 1A) Rattus norvegicus
Analyze
Symbol:
Ppp1r1a
Name:
protein phosphatase 1, regulatory (inhibitor) subunit 1A
RGD ID:
62018
Description:
Predicted to enable protein phosphatase inhibitor activity. Predicted to be involved in intracellular signal transduction. Located in extracellular space. Orthologous to human PPP1R1A (protein phosphatase 1 regulatory inhibitor subunit 1A); PARTICIPATES IN long term potentiation; INTERACTS WITH 17beta-estradiol; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
I-1; IPP-1; PP1 inhibitor 1; protein phosphatase 1 regulatory subunit 1A; protein phosphatase inhibitor 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PPP1R1A (protein phosphatase 1 regulatory inhibitor subunit 1A)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ppp1r1a (protein phosphatase 1, regulatory inhibitor subunit 1A)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ppp1r1a (protein phosphatase 1 regulatory inhibitor subunit 1A)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PPP1R1A (protein phosphatase 1 regulatory inhibitor subunit 1A)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PPP1R1A (protein phosphatase 1 regulatory inhibitor subunit 1A)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ppp1r1a (protein phosphatase 1 regulatory inhibitor subunit 1A)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PPP1R1A (protein phosphatase 1 regulatory inhibitor subunit 1A)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PPP1R1A (protein phosphatase 1 regulatory inhibitor subunit 1A)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ppp1r1a (protein phosphatase 1 regulatory inhibitor subunit 1A)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Ppp1r1a (protein phosphatase 1, regulatory inhibitor subunit 1A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PPP1R1A (protein phosphatase 1 regulatory inhibitor subunit 1A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ppp1r1a
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 136,533,031 - 136,540,687 (-) NCBI GRCr8 mRatBN7.2 7 134,654,578 - 134,662,236 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 134,654,579 - 134,662,230 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 136,410,417 - 136,418,114 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 138,639,788 - 138,647,485 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 138,625,389 - 138,633,131 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 145,146,480 - 145,154,131 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 145,146,481 - 145,154,131 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 142,925,730 - 142,933,709 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 142,428,730 - 142,436,381 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 142,508,919 - 142,516,570 (-) NCBI Celera 7 131,078,656 - 131,086,307 (-) NCBI Celera Cytogenetic Map 7 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Disease Annotations - CTD
Only show annotations with direct experimental evidence (0 objects hidden)
Ppp1r1a Rat 1,1-dichloroethene decreases expression ISO RGD:62310 6480464 vinylidene chloride results in decreased expression of PPP1R1A mRNA CTD PMID:26682919 Ppp1r1a Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:62310 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PPP1R1A mRNA CTD PMID:17942748 Ppp1r1a Rat 17beta-estradiol decreases expression ISO RGD:737038 6480464 Estradiol results in decreased expression of PPP1R1A mRNA CTD PMID:20106945 Ppp1r1a Rat 17beta-estradiol increases expression ISO RGD:737038 6480464 Estradiol results in increased expression of PPP1R1A mRNA CTD PMID:36828454 Ppp1r1a Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PPP1R1A mRNA CTD PMID:32145629 Ppp1r1a Rat 17beta-estradiol decreases expression ISO RGD:62310 6480464 Estradiol results in decreased expression of PPP1R1A mRNA CTD PMID:19484750 Ppp1r1a Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:737038 6480464 Tetrachlorodibenzodioxin results in decreased expression of PPP1R1A mRNA CTD PMID:20106945 Ppp1r1a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:62310 6480464 Tetrachlorodibenzodioxin affects the expression of PPP1R1A mRNA CTD PMID:21570461 Ppp1r1a Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:62310 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PPP1R1A mRNA CTD PMID:17942748 Ppp1r1a Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of PPP1R1A mRNA CTD PMID:32109520 Ppp1r1a Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:737038 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Ppp1r1a Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:737038 6480464 bisphenol S results in decreased methylation of PPP1R1A gene CTD PMID:31601247 Ppp1r1a Rat 4-hydroxyphenyl retinamide decreases expression ISO RGD:62310 6480464 Fenretinide results in decreased expression of PPP1R1A mRNA CTD PMID:28973697 Ppp1r1a Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PPP1R1A mRNA CTD PMID:24780913 Ppp1r1a Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PPP1R1A mRNA CTD PMID:30047161 Ppp1r1a Rat aflatoxin B1 affects expression ISO RGD:737038 6480464 Aflatoxin B1 affects the expression of PPP1R1A protein CTD PMID:20106945 Ppp1r1a Rat aflatoxin B1 decreases expression ISO RGD:737038 6480464 Aflatoxin B1 results in decreased expression of PPP1R1A mRNA CTD PMID:22100608|PMID:27153756 Ppp1r1a Rat aflatoxin B1 decreases methylation ISO RGD:737038 6480464 Aflatoxin B1 results in decreased methylation of PPP1R1A gene CTD PMID:27153756 Ppp1r1a Rat all-trans-retinoic acid decreases expression ISO RGD:737038 6480464 Tretinoin results in decreased expression of PPP1R1A mRNA CTD PMID:21934132 Ppp1r1a Rat alpha-Zearalanol decreases expression EXP 6480464 Zeranol results in decreased expression of PPP1R1A mRNA CTD PMID:35163327 Ppp1r1a Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PPP1R1A mRNA CTD PMID:16483693 Ppp1r1a Rat benzo[a]pyrene decreases expression ISO RGD:737038 6480464 Benzo(a)pyrene results in decreased expression of PPP1R1A mRNA CTD PMID:20106945|PMID:21871943|PMID:32234424 Ppp1r1a Rat benzo[a]pyrene increases methylation ISO RGD:737038 6480464 Benzo(a)pyrene results in increased methylation of PPP1R1A promoter CTD PMID:27901495 Ppp1r1a Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of PPP1R1A mRNA CTD PMID:26496021 Ppp1r1a Rat bisphenol A increases expression ISO RGD:737038 6480464 bisphenol A results in increased expression of PPP1R1A mRNA CTD PMID:36828454 Ppp1r1a Rat bisphenol A multiple interactions ISO RGD:737038 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PPP1R1A gene; [INS protein co-treated more ... CTD PMID:28628672|PMID:31601247 Ppp1r1a Rat bisphenol A increases methylation ISO RGD:62310 6480464 bisphenol A results in increased methylation of PPP1R1A promoter CTD PMID:27312807 Ppp1r1a Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PPP1R1A gene CTD PMID:28505145 Ppp1r1a Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PPP1R1A mRNA CTD PMID:25181051|PMID:32145629|PMID:34947998 Ppp1r1a Rat chlordecone increases expression ISO RGD:62310 6480464 Chlordecone results in increased expression of PPP1R1A mRNA CTD PMID:33711761 Ppp1r1a Rat ciguatoxin CTX1B affects expression ISO RGD:62310 6480464 Ciguatoxins affects the expression of PPP1R1A mRNA CTD PMID:18353800 Ppp1r1a Rat clozapine decreases expression EXP 6480464 Clozapine results in decreased expression of PPP1R1A mRNA CTD PMID:15860345 Ppp1r1a Rat cyclosporin A decreases expression ISO RGD:737038 6480464 Cyclosporine results in decreased expression of PPP1R1A mRNA CTD PMID:20106945 Ppp1r1a Rat cyclosporin A increases expression ISO RGD:737038 6480464 Cyclosporine results in increased expression of PPP1R1A mRNA CTD PMID:27989131 Ppp1r1a Rat dexamethasone increases expression ISO RGD:737038 6480464 Dexamethasone results in increased expression of PPP1R1A mRNA CTD PMID:25047013 Ppp1r1a Rat dexamethasone multiple interactions ISO RGD:737038 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Ppp1r1a Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of PPP1R1A mRNA CTD PMID:25152437 Ppp1r1a Rat dorsomorphin multiple interactions ISO RGD:737038 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Ppp1r1a Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of PPP1R1A mRNA CTD PMID:29391264 Ppp1r1a Rat entinostat multiple interactions ISO RGD:737038 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Ppp1r1a Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of PPP1R1A mRNA CTD PMID:18035473 Ppp1r1a Rat folic acid decreases expression ISO RGD:62310 6480464 Folic Acid results in decreased expression of PPP1R1A mRNA CTD PMID:25629700 Ppp1r1a Rat fonofos increases methylation ISO RGD:737038 6480464 Fonofos results in increased methylation of PPP1R1A promoter CTD PMID:22847954 Ppp1r1a Rat fulvestrant multiple interactions ISO RGD:737038 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PPP1R1A gene CTD PMID:31601247 Ppp1r1a Rat furan increases expression EXP 6480464 furan results in increased expression of PPP1R1A mRNA CTD PMID:27387713 Ppp1r1a Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PPP1R1A mRNA CTD PMID:22061828 Ppp1r1a Rat haloperidol decreases expression EXP 6480464 Haloperidol results in decreased expression of PPP1R1A mRNA CTD PMID:15860345 Ppp1r1a Rat indometacin multiple interactions ISO RGD:737038 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Ppp1r1a Rat mercury dibromide decreases expression ISO RGD:737038 6480464 mercuric bromide results in decreased expression of PPP1R1A mRNA CTD PMID:26272509 Ppp1r1a Rat mercury dibromide multiple interactions ISO RGD:737038 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Ppp1r1a Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of PPP1R1A mRNA CTD PMID:30047161 Ppp1r1a Rat methylmercury chloride decreases expression ISO RGD:737038 6480464 methylmercuric chloride results in decreased expression of PPP1R1A mRNA CTD PMID:28001369 Ppp1r1a Rat mono(2-ethylhexyl) phthalate affects expression ISO RGD:62310 6480464 mono-(2-ethylhexyl)phthalate affects the expression of PPP1R1A mRNA CTD PMID:21195148 Ppp1r1a Rat Monobutylphthalate affects expression ISO RGD:62310 6480464 monobutyl phthalate affects the expression of PPP1R1A mRNA CTD PMID:21195148 Ppp1r1a Rat N-methyl-4-phenylpyridinium increases expression ISO RGD:737038 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PPP1R1A mRNA CTD PMID:24810058 Ppp1r1a Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of PPP1R1A mRNA CTD PMID:15010824 Ppp1r1a Rat N-Nitrosopyrrolidine decreases expression ISO RGD:737038 6480464 N-Nitrosopyrrolidine results in decreased expression of PPP1R1A mRNA CTD PMID:32234424 Ppp1r1a Rat nickel atom decreases expression ISO RGD:737038 6480464 Nickel results in decreased expression of PPP1R1A mRNA CTD PMID:25583101 Ppp1r1a Rat O-methyleugenol decreases expression ISO RGD:737038 6480464 methyleugenol results in decreased expression of PPP1R1A mRNA CTD PMID:32234424 Ppp1r1a Rat okadaic acid decreases expression ISO RGD:737038 6480464 Okadaic Acid results in decreased expression of PPP1R1A mRNA CTD PMID:38832940 Ppp1r1a Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of PPP1R1A mRNA CTD PMID:23665939 Ppp1r1a Rat panobinostat multiple interactions ISO RGD:737038 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Ppp1r1a Rat panobinostat increases expression ISO RGD:737038 6480464 panobinostat results in increased expression of PPP1R1A mRNA CTD PMID:26272509 Ppp1r1a Rat paracetamol decreases expression ISO RGD:737038 6480464 Acetaminophen results in decreased expression of PPP1R1A mRNA CTD PMID:26690555|PMID:29067470 Ppp1r1a Rat paracetamol increases expression ISO RGD:737038 6480464 Acetaminophen results in increased expression of PPP1R1A mRNA CTD PMID:21420995 Ppp1r1a Rat parathion increases methylation ISO RGD:737038 6480464 Parathion results in increased methylation of PPP1R1A promoter CTD PMID:22847954 Ppp1r1a Rat perfluorononanoic acid decreases expression ISO RGD:737038 6480464 perfluoro-n-nonanoic acid results in decreased expression of PPP1R1A mRNA CTD PMID:32588087 Ppp1r1a Rat perfluorooctane-1-sulfonic acid affects expression ISO RGD:62310 6480464 perfluorooctane sulfonic acid affects the expression of PPP1R1A mRNA CTD PMID:19429403 Ppp1r1a Rat perfluorooctanoic acid affects expression ISO RGD:62310 6480464 perfluorooctanoic acid affects the expression of PPP1R1A mRNA CTD PMID:19429403 Ppp1r1a Rat phenylmercury acetate decreases expression ISO RGD:737038 6480464 Phenylmercuric Acetate results in decreased expression of PPP1R1A mRNA CTD PMID:26272509 Ppp1r1a Rat phenylmercury acetate multiple interactions ISO RGD:737038 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Ppp1r1a Rat progesterone decreases expression ISO RGD:737038 6480464 Progesterone results in decreased expression of PPP1R1A mRNA CTD PMID:21540246 Ppp1r1a Rat quercetin decreases expression ISO RGD:737038 6480464 Quercetin results in decreased expression of PPP1R1A mRNA CTD PMID:15309432 Ppp1r1a Rat resveratrol multiple interactions ISO RGD:737038 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of PPP1R1A mRNA CTD PMID:23557933 Ppp1r1a Rat SB 431542 multiple interactions ISO RGD:737038 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Ppp1r1a Rat silicon dioxide decreases expression ISO RGD:737038 6480464 Silicon Dioxide analog results in decreased expression of PPP1R1A mRNA CTD PMID:25895662 Ppp1r1a Rat silver atom decreases expression ISO RGD:62310 6480464 Silver results in decreased expression of PPP1R1A mRNA CTD PMID:27131904 Ppp1r1a Rat silver(0) decreases expression ISO RGD:62310 6480464 Silver results in decreased expression of PPP1R1A mRNA CTD PMID:27131904 Ppp1r1a Rat sodium arsenite decreases expression ISO RGD:737038 6480464 sodium arsenite results in decreased expression of PPP1R1A mRNA CTD PMID:29301061 Ppp1r1a Rat sodium fluoride increases expression ISO RGD:62310 6480464 Sodium Fluoride results in increased expression of PPP1R1A mRNA CTD PMID:27862939 Ppp1r1a Rat sunitinib decreases expression ISO RGD:737038 6480464 Sunitinib results in decreased expression of PPP1R1A mRNA CTD PMID:31533062 Ppp1r1a Rat terbufos increases methylation ISO RGD:737038 6480464 terbufos results in increased methylation of PPP1R1A promoter CTD PMID:22847954 Ppp1r1a Rat testosterone decreases expression ISO RGD:62310 6480464 Testosterone results in decreased expression of PPP1R1A mRNA CTD PMID:20403060 Ppp1r1a Rat testosterone decreases expression ISO RGD:737038 6480464 Testosterone results in decreased expression of PPP1R1A mRNA CTD PMID:33359661 Ppp1r1a Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of PPP1R1A mRNA CTD PMID:26496021 Ppp1r1a Rat thalidomide decreases expression ISO RGD:62310 6480464 Thalidomide results in decreased expression of PPP1R1A mRNA CTD PMID:26217789 Ppp1r1a Rat titanium dioxide decreases expression ISO RGD:62310 6480464 titanium dioxide results in decreased expression of PPP1R1A mRNA CTD PMID:23557971 Ppp1r1a Rat trichostatin A increases expression ISO RGD:737038 6480464 trichostatin A results in increased expression of PPP1R1A mRNA CTD PMID:24935251 Ppp1r1a Rat triclosan decreases expression ISO RGD:737038 6480464 Triclosan results in decreased expression of PPP1R1A mRNA CTD PMID:30510588 Ppp1r1a Rat triphenyl phosphate increases expression ISO RGD:737038 6480464 triphenyl phosphate results in increased expression of PPP1R1A mRNA CTD PMID:28934090 Ppp1r1a Rat troglitazone increases expression ISO RGD:737038 6480464 troglitazone results in increased expression of PPP1R1A mRNA CTD PMID:28934090 Ppp1r1a Rat valproic acid affects expression ISO RGD:737038 6480464 Valproic Acid affects the expression of PPP1R1A mRNA CTD PMID:25979313 Ppp1r1a Rat valproic acid multiple interactions ISO RGD:737038 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Ppp1r1a Rat valproic acid increases expression ISO RGD:737038 6480464 Valproic Acid results in increased expression of PPP1R1A mRNA CTD PMID:23179753|PMID:27188386|PMID:28001369 Ppp1r1a Rat vancomycin increases expression ISO RGD:62310 6480464 Vancomycin results in increased expression of PPP1R1A mRNA CTD PMID:18930951 Ppp1r1a Rat zearalenone increases expression ISO RGD:737038 6480464 Zearalenone results in increased expression of PPP1R1A mRNA CTD PMID:36828454 Ppp1r1a Rat zoledronic acid decreases expression ISO RGD:737038 6480464 zoledronic acid results in decreased expression of PPP1R1A mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
1,1-dichloroethene (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) chlordecone (ISO) ciguatoxin CTX1B (ISO) clozapine (EXP) cyclosporin A (ISO) dexamethasone (ISO) diuron (EXP) dorsomorphin (ISO) endosulfan (EXP) entinostat (ISO) flavonoids (EXP)
References
References - curated
#
Reference Title
Reference Citation
1.
Detection and quantification of protein phosphatase inhibitor-1 gene expression in total rat liver and isolated hepatocytes.
Aleem EA, etal., Mol Cell Biochem 2001 Jan;217(1-2):1-12.
2.
Molecular cloning of protein phosphatase inhibitor-1 and its expression in rat and rabbit tissues.
Elbrecht A, etal., J Biol Chem 1990 Aug 15;265(23):13415-8.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Potential of Protein Phosphatase Inhibitor 1 As Biomarker of Pancreatic beta-Cell Injury In Vitro and In Vivo.
Jiang L, etal., Diabetes. 2013 Aug;62(8):2683-8. doi: 10.2337/db12-1507. Epub 2013 Apr 4.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
GOA pipeline
RGD automated data pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Additional References at PubMed
Genomics
Comparative Map Data
Ppp1r1a (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 136,533,031 - 136,540,687 (-) NCBI GRCr8 mRatBN7.2 7 134,654,578 - 134,662,236 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 134,654,579 - 134,662,230 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 136,410,417 - 136,418,114 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 138,639,788 - 138,647,485 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 138,625,389 - 138,633,131 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 145,146,480 - 145,154,131 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 145,146,481 - 145,154,131 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 142,925,730 - 142,933,709 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 142,428,730 - 142,436,381 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 142,508,919 - 142,516,570 (-) NCBI Celera 7 131,078,656 - 131,086,307 (-) NCBI Celera Cytogenetic Map 7 q36 NCBI
PPP1R1A (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 54,579,246 - 54,588,659 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 54,575,387 - 54,588,659 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 54,973,030 - 54,982,443 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 53,259,291 - 53,268,710 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 53,259,299 - 53,268,707 NCBI Celera 12 54,624,894 - 54,634,311 (-) NCBI Celera Cytogenetic Map 12 q13.2 NCBI HuRef 12 52,011,832 - 52,016,913 (-) NCBI HuRef CHM1_1 12 54,939,731 - 54,949,148 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 54,545,797 - 54,555,209 (-) NCBI T2T-CHM13v2.0
Ppp1r1a (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 103,438,706 - 103,446,465 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 103,438,706 - 103,446,430 (-) Ensembl GRCm39 Ensembl GRCm38 15 103,530,279 - 103,538,027 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 103,530,279 - 103,538,003 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 103,360,710 - 103,368,423 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 103,358,313 - 103,365,995 (-) NCBI MGSCv36 mm8 Celera 15 105,688,277 - 105,695,984 (-) NCBI Celera Cytogenetic Map 15 F3 NCBI cM Map 15 59.01 NCBI
Ppp1r1a (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955458 1,819,366 - 1,823,867 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955458 1,819,366 - 1,823,864 (-) NCBI ChiLan1.0 ChiLan1.0
PPP1R1A (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 39,586,156 - 39,594,552 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 39,582,925 - 39,591,321 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 34,158,956 - 34,167,350 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 34,887,168 - 34,896,360 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 34,882,975 - 34,898,218 (+) Ensembl panpan1.1 panPan2
PPP1R1A (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 766,757 - 770,994 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 766,338 - 771,598 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 45,482,576 - 45,490,666 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 761,676 - 770,078 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 761,653 - 770,038 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 754,299 - 762,405 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 762,376 - 770,488 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 45,886,785 - 45,894,624 (-) NCBI UU_Cfam_GSD_1.0
Ppp1r1a (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 61,389,455 - 61,397,676 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936512 11,767,172 - 11,775,573 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936512 11,765,769 - 11,775,573 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PPP1R1A (Sus scrofa - pig)
PPP1R1A (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 50,695,896 - 50,704,191 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 50,696,032 - 50,704,219 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 195,332,472 - 195,341,778 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ppp1r1a (Heterocephalus glaber - naked mole-rat)
miRNA Target Status (No longer updated)
Predicted Target Of
Count of predictions: 135 Count of miRNA genes: 102 Interacting mature miRNAs: 118 Transcripts: ENSRNOT00000055271 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
QTLs in Region (GRCr8)
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1354582 Stl11 Serum triglyceride level QTL 11 3.42 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 119513385 135012528 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
Markers in Region
RH127463
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 134,654,201 - 134,654,408 (+) MAPPER mRatBN7.2 Rnor_6.0 7 145,146,104 - 145,146,310 NCBI Rnor6.0 Rnor_5.0 7 142,925,354 - 142,925,560 UniSTS Rnor5.0 RGSC_v3.4 7 142,428,354 - 142,428,560 UniSTS RGSC3.4 Celera 7 131,078,280 - 131,078,486 UniSTS RH 3.4 Map 7 1063.5 UniSTS Cytogenetic Map 7 q36 UniSTS
RH130620
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 134,654,856 - 134,655,051 (+) MAPPER mRatBN7.2 Rnor_6.0 7 145,146,759 - 145,146,953 NCBI Rnor6.0 Rnor_5.0 7 142,926,009 - 142,926,203 UniSTS Rnor5.0 RGSC_v3.4 7 142,429,009 - 142,429,203 UniSTS RGSC3.4 Celera 7 131,078,935 - 131,079,129 UniSTS RH 3.4 Map 7 1063.5 UniSTS Cytogenetic Map 7 q36 UniSTS
AA997855
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 136,533,875 - 136,534,432 (+) Marker Load Pipeline mRatBN7.2 7 134,655,422 - 134,655,979 (+) MAPPER mRatBN7.2 Rnor_6.0 7 145,147,325 - 145,147,881 NCBI Rnor6.0 Rnor_5.0 7 142,926,575 - 142,927,131 UniSTS Rnor5.0 RGSC_v3.4 7 142,429,575 - 142,430,131 UniSTS RGSC3.4 Celera 7 131,079,501 - 131,080,057 UniSTS RH 3.4 Map 7 1064.9 UniSTS Cytogenetic Map 7 q36 UniSTS
Expression
RNA-SEQ Expression
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
83
82
51
25
51
6
210
97
93
45
55
31
Too many to show, limit is 500. Download them if you would like to view them all.
Sequence
Ensembl Acc Id:
ENSRNOT00000055271 ⟹ ENSRNOP00000052146
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 134,654,579 - 134,662,229 (-) Ensembl Rnor_6.0 Ensembl 7 145,146,481 - 145,154,131 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000105860 ⟹ ENSRNOP00000079380
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 134,655,776 - 134,662,230 (-) Ensembl
RefSeq Acc Id:
NM_022676 ⟹ NP_073167
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 136,533,031 - 136,540,682 (-) NCBI mRatBN7.2 7 134,654,578 - 134,662,229 (-) NCBI Rnor_6.0 7 145,146,480 - 145,154,131 (-) NCBI Rnor_5.0 7 142,925,730 - 142,933,709 (-) NCBI RGSC_v3.4 7 142,428,730 - 142,436,381 (-) RGD Celera 7 131,078,656 - 131,086,307 (-) RGD
Sequence:
AGTCCCCAAGCGGAGCCGGGCGCGCCGAGCCAGGAGCTGGGAGCCGAGCGCCGGGCTGGGGCCG GGGCCGGAGCGCAGCGAAAAGGGAGCGCGCCCGCCCCAGCCCGAGGTCCGCCGCCGCCGGACCG GGCGCCATGGAGCCCGACAACAGTCCACGGAAGATCCAGTTTACGGTTCCGCTGCTGGAGCCTC ACCTGGACCCGGAGGCAGCCGAGCAGATTCGGAGGCGCCGCCCCACCCCTGCCACACTTGTGCT GACCAGCGACCAGTCATCCCCAGAAGTAGATGAAGACCGGATCCCCAACCCACTTCTCAAGTCC ACACTGTCAATGTCTCCACGGCAACGGAAGAAGATGACAAGGACTACACCCACCATGAAAGAGC TCCAGACAATGGTTGAACATCACCTAGGGCAACAGAAACAAGGGGAAGAACCTGAGGGAGCCAC TGAGAGCACAGGGAACCAGGAGTCCTGCCCACCTGGGATCCCAGACACAGGCTCAGCGTCAAGG CCAGATACCTCGGGGACAGCACAAAAGCCTGCAGAATCCAAACCCAAGACTCAGGAGCAGCGTG GTGTGGAGCCCAGCACAGAGGACCTTTCAGCCCACATGCTACCACTGGATTCCCAAGGAGCCAG CTTGGTCTGACAGAAGTTGACATCCGGGGATCGCCAGTGAGTGTGGAAGTTCATGGACACTGGA TGTTTCTTAATCTCTTGTTTTTAAACGTGATAAATTTGGTGTTAGGTCCTTGGTGCTTTTCTTC TTTCCAGCCTGGGGATTCCTTCCTCCCTCGGCTCTTGTCTGCACCCCACAGCCCCCACCCTCAG GACCAACTAAGCTAGGAAATAGGAAACTGACTGAAGCCTAGCCTCTACTAGCATAAAGAAAAAG AGGAGTGTGGAAGTAGGAGATCACTTCAAGGCTTTCCTTTCTTACTGTGGAAAGCTCCGCCCAC GTAGCAGGGCCGCCTACTTGGGAGACTGCCACTCTAAAGCAGATACCCAGACCAGCGAGGGCTT GCTATAGCACCATCTGCTGGACATAAATGGGAAGTGCATCTTGTCCCGAAACCCCTGACAAAGG GAGTATTTGGAATCTGGTTCCAATTGTGTGGCACTGTTCCTTATTCTAACCTGACAACAAAGAC TGTCAGAAAACCCAGTGACTAGAAACCCCTCTTCCATTGTCCTACCTACTAAGGTCAGGGCAAG ACTAACACCATGCACAAATGGAGAAGTGGTCTCTGATTCTAGCCAGGCTTCTGCTGCTGATTCT GATTTTCCCAAAGAATTAAAGAGATGGAGGGAGAAGGAAGACTCTTTCGTCCCCTTTTCTTCAG CAGTACCACATAGCTAAGAAGAGCATAGCCTGGGCAGTGAAGGACTGTGTGCCGTAGCGCCCCA CCCCCACCCCCAGATAGGCTTTACTTGAATCCCCGCTTCAACACTCATGGAGAATACCATGGCA GAGTTCTGTCTAGCTTAGGAAGATAACTATAAATGACACGTGAGAGAGCTTCTACCTAATGAAC ACCACACACATCCAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_006242437 ⟹ XP_006242499
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 136,533,829 - 136,540,687 (-) NCBI mRatBN7.2 7 134,654,813 - 134,662,236 (-) NCBI Rnor_6.0 7 145,147,278 - 145,154,105 (-) NCBI Rnor_5.0 7 142,925,730 - 142,933,709 (-) NCBI
Sequence:
GAGCCAGGAGCTGGGAGCCGAGCGCCGGGCTGGGGCCGGGGCCGGAGCGCAGCGAAAAGGGAGC GCGCCCGCCCCAGCCCGAGGTCCGCCGCCGCCGGACCGGGCGCCATGGAGCCCGACAACAGTCC ACGGAAGATCCAGTTTACGGTTCCGCTGCTGGAGCCTCACCTGGACCCGGAGGCAGCCGAGCAG ATTCGGAGGCGCCGCCCCACCCCTGCCACACTTGTGCTGACCAGCGACCAGTCATCCCCAGTAG ATGAAGACCGGATCCCCAACCCACTTCTCAAGTCCACACTGTCAATGTCTCCACGGCAACGGAA GAAGATGACAAGGACTACACCCACCATGAAAGAGCTCCAGACAATGGTTGAACATCACCTAGGG CAACAGAAACAAGGGGAAGAACCTGAGGGAGCCACTGAGAGCACAGGGAACCAGGAGTCCTGCC CACCTGGGATCCCAGACACAGGCTCAGCGTCAAGGCCAGATACCTCGGGGACAGCACAAAAGCC TGCAGAATCCAAACCCAAGACTCAGGAGCAGCGTGGTGTGGAGCCCAGCACAGAGGACCTTTCA GCCCACATGCTACCACTGGATTCCCAAGGAGCCAGCTTGGTCTGACAGAAGTTGACATCCGGGG ATCGCCAGTGAGTGTGGAAGTTCATGGACACTGGATGTTTCTTAATCTCTTGTTTTTAAACGTG ATAAATTTGGTGTTAGGTC
hide sequence
RefSeq Acc Id:
NP_073167 ⟸ NM_022676
- UniProtKB:
Q6DSU5 (UniProtKB/Swiss-Prot), P19103 (UniProtKB/Swiss-Prot), A6KD17 (UniProtKB/TrEMBL), A6KD15 (UniProtKB/TrEMBL)
- Sequence:
MEPDNSPRKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEVDEDRIPNPLLKSTL SMSPRQRKKMTRTTPTMKELQTMVEHHLGQQKQGEEPEGATESTGNQESCPPGIPDTGSASRPD TSGTAQKPAESKPKTQEQRGVEPSTEDLSAHMLPLDSQGASLV
hide sequence
RefSeq Acc Id:
XP_006242499 ⟸ XM_006242437
- Peptide Label:
isoform X1
- UniProtKB:
A6KD15 (UniProtKB/TrEMBL)
- Sequence:
MEPDNSPRKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPVDEDRIPNPLLKSTLS MSPRQRKKMTRTTPTMKELQTMVEHHLGQQKQGEEPEGATESTGNQESCPPGIPDTGSASRPDT SGTAQKPAESKPKTQEQRGVEPSTEDLSAHMLPLDSQGASLV
hide sequence
Ensembl Acc Id:
ENSRNOP00000052146 ⟸ ENSRNOT00000055271
Ensembl Acc Id:
ENSRNOP00000079380 ⟸ ENSRNOT00000105860
Promoters
RGD ID: 13695720
Promoter ID: EPDNEW_R6245
Type: initiation region
Name: Ppp1r1a_1
Description: protein phosphatase 1, regulatory subunit 1A
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 145,154,131 - 145,154,191 EPDNEW
Additional Information
Nomenclature History
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Ppp1r1a
protein phosphatase 1, regulatory (inhibitor) subunit 1A
Name updated
70584
APPROVED
RGD Curation Notes
Note Type
Note
Reference
gene_regulation
may be threonine phosphorylated by cAMP-dependent protein kinase
61702