Symbol:
Prdx1
Name:
peroxiredoxin 1
RGD ID:
620039
Description:
Enables heme binding activity; identical protein binding activity; and peroxiredoxin activity. Involved in response to oxidative stress. Located in euchromatin; mitochondrial matrix; and peroxisomal matrix. Human ortholog(s) of this gene implicated in methylmalonic aciduria and homocystinuria type cblC. Orthologous to human PRDX1 (peroxiredoxin 1); INTERACTS WITH 1,2,4-trimethylbenzene; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Hbp23; heme-binding 23 kDa protein; MGC108617; peroxiredoxin-1; thioredoxin peroxidase 2; thioredoxin-dependent peroxide reductase 2; thioredoxin-dependent peroxiredoxin 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRDX1 (peroxiredoxin 1)
RGD
RGD
Mus musculus (house mouse):
Prdx1 (peroxiredoxin 1)
RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Prdx1 (peroxiredoxin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRDX1 (peroxiredoxin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRDX1 (peroxiredoxin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prdx1 (peroxiredoxin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRDX1 (peroxiredoxin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PRDX1 (peroxiredoxin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prdx1 (peroxiredoxin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PRDX2 (peroxiredoxin 2)
HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
PRDX1 (peroxiredoxin 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Prdx1 (peroxiredoxin 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Prdx1 (peroxiredoxin 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
prdx1 (peroxiredoxin 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
prdx-2
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG6888
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Jafrac1
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
TSA1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
TSA2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
prdx1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
prdx1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
prdx2
Alliance
DIOPT (Hieranoid|OMA|OrthoInspector)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 135,383,906 - 135,399,504 (+) NCBI GRCr8 GRCr8 Ensembl 5 135,383,906 - 135,399,504 (+) Ensembl GRCr8 Ensembl mRatBN7.2 5 130,147,258 - 130,162,856 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 130,147,204 - 130,162,856 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 132,772,005 - 132,788,840 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 134,526,605 - 134,543,441 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 134,549,011 - 134,565,848 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 135,536,413 - 135,551,986 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 135,536,413 - 135,551,990 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 139,332,556 - 139,348,210 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 136,975,780 - 136,991,630 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 128,674,439 - 128,690,018 (+) NCBI Celera RGSC_v3.1 5 136,981,005 - 136,996,856 (+) NCBI Cytogenetic Map 5 q35 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prdx1 Rat (+)-catechin multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of PRDX1 mRNA CTD PMID:24763279 Prdx1 Rat (1->4)-beta-D-glucan multiple interactions ISO Prdx1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PRDX1 mRNA CTD PMID:36331819 Prdx1 Rat (S)-naringenin decreases expression ISO PRDX1 (Homo sapiens) 6480464 naringenin results in decreased expression of PRDX1 mRNA; naringenin results in decreased expression of PRDX1 more ... CTD PMID:27838343 Prdx1 Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of PRDX1 protein CTD PMID:17337753 Prdx1 Rat 1,2-dichloroethane decreases expression ISO Prdx1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of PRDX1 mRNA CTD PMID:28960355 Prdx1 Rat 1,2-dimethylhydrazine multiple interactions ISO Prdx1 (Mus musculus) 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PRDX1 mRNA CTD PMID:22206623 Prdx1 Rat 1-chloro-2,4-dinitrobenzene affects oxidation ISO PRDX1 (Homo sapiens) 6480464 Dinitrochlorobenzene affects the oxidation of PRDX1 protein CTD PMID:18789312 Prdx1 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO PRDX1 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to PRDX1 protein CTD PMID:32991956 Prdx1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of PRDX1 mRNA CTD PMID:15576828|PMID:16174780|PMID:17557909 Prdx1 Rat 17beta-estradiol affects expression ISO PRDX1 (Homo sapiens) 6480464 Estradiol affects the expression of PRDX1 mRNA CTD PMID:22574217 Prdx1 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one affects splicing ISO PRDX1 (Homo sapiens) 6480464 Metribolone affects the splicing of PRDX1 mRNA CTD PMID:17010196 Prdx1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO PRDX1 (Homo sapiens) 6480464 2,2',4,4'-tetrabromodiphenyl ether results in increased expression of PRDX1 mRNA CTD PMID:26808241 Prdx1 Rat 2,3,7,8-tetrabromodibenzodioxine increases expression ISO Prdx1 (Mus musculus) 6480464 2,3,7,8-tetrabromodibenzo-4-dioxin results in increased expression of PRDX1 protein CTD PMID:27604104 Prdx1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Prdx1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PRDX1 mRNA CTD PMID:21570461 Prdx1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRDX1 mRNA CTD PMID:34747641 Prdx1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Prdx1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRDX1 mRNA CTD PMID:28213091 Prdx1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Prdx1 (Mus musculus) 6480464 [NFE2L2 gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression more ... CTD PMID:21846477 Prdx1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Prdx1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PRDX1 mRNA CTD PMID:15034205|PMID:15591033 Prdx1 Rat 2,4-diaminotoluene increases expression ISO Prdx1 (Mus musculus) 6480464 2,4-diaminotoluene results in increased expression of PRDX1 mRNA CTD PMID:22016648 Prdx1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Prdx1 (Mus musculus) 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of PRDX1 mRNA CTD PMID:38648751 Prdx1 Rat 2-amino-14,16-dimethyloctadecan-3-ol increases expression ISO PRDX1 (Homo sapiens) 6480464 2-amino-14,16-dimethyloctadecan-3-ol results in increased expression of PRDX1 protein CTD PMID:32044396 Prdx1 Rat 2-butoxyethanol increases expression ISO Prdx1 (Mus musculus) 6480464 n-butoxyethanol results in increased expression of PRDX1 mRNA CTD PMID:19812364 Prdx1 Rat 2-hydroxypropanoic acid decreases expression ISO PRDX1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PRDX1 mRNA CTD PMID:30851411 Prdx1 Rat 2-tert-butylhydroquinone increases expression ISO Prdx1 (Mus musculus) 6480464 2-tert-butylhydroquinone results in increased expression of PRDX1 mRNA CTD PMID:16014739 Prdx1 Rat 3,3',4,4',5-pentachlorobiphenyl affects expression ISO Prdx1 (Mus musculus) 6480464 3,4,5,3',4'-pentachlorobiphenyl affects the expression of PRDX1 mRNA CTD PMID:37080397 Prdx1 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO PRDX1 (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of PRDX1 protein CTD PMID:30098271 Prdx1 Rat 3,4-dihydrocoumarin increases expression ISO Prdx1 (Mus musculus) 6480464 3,4-dihydrocoumarin results in increased expression of PRDX1 mRNA CTD PMID:22016648 Prdx1 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of PRDX1 protein CTD PMID:26597043 Prdx1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of PRDX1 protein CTD PMID:34915118 Prdx1 Rat 3-chloropropane-1,2-diol affects expression EXP 6480464 alpha-Chlorohydrin analog affects the expression of PRDX1 protein CTD PMID:26597043 Prdx1 Rat 3H-1,2-dithiole-3-thione multiple interactions ISO Prdx1 (Mus musculus) 6480464 [1,2-dithiol-3-thione results in increased activity of NFE2L2 protein] which results in increased expression of PRDX1 more ... CTD PMID:22495766 Prdx1 Rat 4,4'-sulfonyldiphenol increases expression ISO Prdx1 (Mus musculus) 6480464 bisphenol S results in increased expression of PRDX1 mRNA CTD PMID:39298647 Prdx1 Rat 4-hydroxynon-2-enal affects binding ISO PRDX1 (Homo sapiens) 6480464 4-hydroxy-2-nonenal analog binds to PRDX1 CTD PMID:18232660 Prdx1 Rat 4-hydroxynon-2-enal increases expression ISO Prdx1 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in increased expression of PRDX1 mRNA CTD PMID:19191707 Prdx1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PRDX1 mRNA CTD PMID:30047161|PMID:31068541 Prdx1 Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione increases expression ISO Prdx1 (Mus musculus) 6480464 Uric Acid results in increased expression of PRDX1 protein CTD PMID:23619996 Prdx1 Rat 8-hydroxy-2'-deoxyguanosine multiple interactions ISO Prdx1 (Mus musculus) 6480464 PRDX1 protein inhibits the reaction [HRAS protein mutant form results in increased abundance of 8-Hydroxy-2'-Deoxyguanosine] CTD PMID:27517622 Prdx1 Rat 9,10-phenanthroquinone multiple interactions ISO PRDX1 (Homo sapiens) 6480464 9,10-phenanthrenequinone promotes the reaction [PRDX1 protein binds to PRDX1 protein] CTD PMID:32493877 Prdx1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of PRDX1 mRNA CTD PMID:31881176 Prdx1 Rat acrolein increases oxidation ISO PRDX1 (Homo sapiens) 6480464 Acrolein results in increased oxidation of PRDX1 protein CTD PMID:19135121 Prdx1 Rat acrylamide increases expression ISO PRDX1 (Homo sapiens) 6480464 Acrylamide results in increased expression of PRDX1 mRNA CTD PMID:32763439 Prdx1 Rat actinomycin D multiple interactions ISO Prdx1 (Mus musculus) 6480464 Dactinomycin inhibits the reaction [sodium arsenate results in increased expression of PRDX1 mRNA]; Dactinomycin inhibits more ... CTD PMID:11796722 Prdx1 Rat aflatoxin B1 decreases methylation ISO PRDX1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PRDX1 intron CTD PMID:30157460 Prdx1 Rat aldehydo-D-glucose increases expression ISO PRDX1 (Homo sapiens) 6480464 Glucose results in increased expression of PRDX1 mRNA CTD PMID:32942007 Prdx1 Rat aldehydo-D-glucose multiple interactions ISO Prdx1 (Mus musculus) 6480464 [Glucose co-treated with gastrodin] affects the expression of PRDX1 mRNA CTD PMID:33764184 Prdx1 Rat aldehydo-D-glucose multiple interactions EXP 6480464 [Glucose co-treated with gastrodin] affects the expression of PRDX1 mRNA CTD PMID:33764184 Prdx1 Rat all-trans-retinoic acid decreases expression ISO PRDX1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of PRDX1 mRNA CTD PMID:12875902|PMID:16054129|PMID:21934132|PMID:33167477 Prdx1 Rat amiodarone decreases expression ISO PRDX1 (Homo sapiens) 6480464 Amiodarone results in decreased expression of PRDX1 mRNA CTD PMID:36586010 Prdx1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PRDX1 mRNA CTD PMID:16483693 Prdx1 Rat amphibole asbestos affects expression ISO PRDX1 (Homo sapiens) 6480464 Asbestos, Amphibole affects the expression of PRDX1 protein CTD PMID:20855422 Prdx1 Rat amphibole asbestos increases expression ISO PRDX1 (Homo sapiens) 6480464 Asbestos, Amphibole results in increased expression of PRDX1 protein CTD PMID:20855422 Prdx1 Rat antimonite multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [Antimony Potassium Tartrate results in increased abundance of antimonite] which results in increased expression of more ... CTD PMID:32076005 Prdx1 Rat Aroclor 1254 increases expression ISO Prdx1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of PRDX1 mRNA CTD PMID:34265337 Prdx1 Rat arsane increases expression ISO PRDX1 (Homo sapiens) 6480464 Arsenic results in increased expression of PRDX1 mRNA CTD PMID:19945496|PMID:29247444|PMID:33736254|PMID:36720308 Prdx1 Rat arsane multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:33736254|PMID:39836092 Prdx1 Rat arsane affects methylation ISO PRDX1 (Homo sapiens) 6480464 Arsenic affects the methylation of PRDX1 gene CTD PMID:25304211 Prdx1 Rat arsenic atom increases expression ISO PRDX1 (Homo sapiens) 6480464 Arsenic results in increased expression of PRDX1 mRNA CTD PMID:19945496|PMID:29247444|PMID:33736254|PMID:36720308 Prdx1 Rat arsenic atom multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:33736254|PMID:39836092 Prdx1 Rat arsenic atom affects methylation ISO PRDX1 (Homo sapiens) 6480464 Arsenic affects the methylation of PRDX1 gene CTD PMID:25304211 Prdx1 Rat arsenite ion affects binding ISO PRDX1 (Homo sapiens) 6480464 Arsenites analog binds to PRDX1 protein CTD PMID:19874836 Prdx1 Rat arsenite(3-) multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of arsenite] which results in increased expression of PRDX1 more ... CTD PMID:32076005|PMID:32406909 Prdx1 Rat arsenous acid increases expression ISO PRDX1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PRDX1 mRNA CTD PMID:20458559 Prdx1 Rat asbestos increases expression ISO PRDX1 (Homo sapiens) 6480464 Asbestos results in increased expression of PRDX1 protein CTD PMID:22537621 Prdx1 Rat astaxanthin multiple interactions ISO Prdx1 (Mus musculus) 6480464 astaxanthine inhibits the reaction [LEPR gene mutant form results in increased expression of PRDX1 mRNA] CTD PMID:16964424 Prdx1 Rat atrazine increases expression ISO PRDX1 (Homo sapiens) 6480464 Atrazine results in increased expression of PRDX1 protein CTD PMID:25275270 Prdx1 Rat atrazine increases expression ISO Prdx1 (Mus musculus) 6480464 Atrazine results in increased expression of PRDX1 mRNA CTD PMID:36216167 Prdx1 Rat atrazine multiple interactions ISO Prdx1 (Mus musculus) 6480464 Lycopene inhibits the reaction [Atrazine results in increased expression of PRDX1 mRNA] CTD PMID:36216167 Prdx1 Rat atrazine decreases expression ISO PRDX1 (Homo sapiens) 6480464 Atrazine results in decreased expression of PRDX1 mRNA CTD PMID:22378314 Prdx1 Rat azoxystrobin increases expression ISO PRDX1 (Homo sapiens) 6480464 azoxystrobin results in increased expression of PRDX1 mRNA CTD PMID:33512557 Prdx1 Rat benzo[a]pyrene multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of [Benzo(a)pyrene co-treated with ceric oxide]] which results in more ... CTD PMID:17292933|PMID:36982514 Prdx1 Rat benzo[a]pyrene increases methylation ISO PRDX1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PRDX1 5' UTR; Benzo(a)pyrene results in increased methylation of more ... CTD PMID:27901495 Prdx1 Rat benzo[a]pyrene increases expression ISO Prdx1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PRDX1 mRNA CTD PMID:15034205|PMID:22228805 Prdx1 Rat benzo[a]pyrene increases expression ISO PRDX1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PRDX1 mRNA; Benzo(a)pyrene results in increased expression of PRDX1 more ... CTD PMID:17292933|PMID:31255691|PMID:32890658 Prdx1 Rat bis(2-chloroethyl) sulfide increases expression ISO Prdx1 (Mus musculus) 6480464 Mustard Gas results in increased expression of PRDX1 mRNA CTD PMID:15674844 Prdx1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Prdx1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PRDX1 mRNA CTD PMID:33754040 Prdx1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PRDX1 mRNA CTD PMID:25181051 Prdx1 Rat bisphenol A decreases expression ISO PRDX1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PRDX1 protein CTD PMID:37567409 Prdx1 Rat bisphenol A increases expression ISO Prdx1 (Mus musculus) 6480464 bisphenol A results in increased expression of PRDX1 mRNA CTD PMID:33221593 Prdx1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PRDX1 gene CTD PMID:28505145 Prdx1 Rat bisphenol A decreases expression ISO Prdx1 (Mus musculus) 6480464 bisphenol A results in decreased expression of PRDX1 protein CTD PMID:24909818|PMID:35999755 Prdx1 Rat bisphenol AF increases expression ISO PRDX1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PRDX1 protein CTD PMID:34186270 Prdx1 Rat bisphenol F increases expression ISO Prdx1 (Mus musculus) 6480464 bisphenol F results in increased expression of PRDX1 mRNA CTD PMID:38685157 Prdx1 Rat butyric acid decreases expression ISO PRDX1 (Homo sapiens) 6480464 Butyric Acid results in decreased expression of PRDX1 protein CTD PMID:34581912 Prdx1 Rat cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of PRDX1 mRNA CTD PMID:17327700 Prdx1 Rat cadmium atom increases oxidation ISO Prdx1 (Mus musculus) 6480464 Cadmium results in increased oxidation of PRDX1 protein CTD PMID:24077948 Prdx1 Rat cadmium atom multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PRDX1 more ... CTD PMID:33040242|PMID:35301059|PMID:37325564 Prdx1 Rat cadmium atom increases expression ISO PRDX1 (Homo sapiens) 6480464 Cadmium results in increased expression of PRDX1 protein CTD PMID:16440303 Prdx1 Rat cadmium dichloride increases expression ISO PRDX1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PRDX1 mRNA; Cadmium Chloride results in increased expression more ... CTD PMID:16440303|PMID:26525392|PMID:38568856 Prdx1 Rat cadmium dichloride multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PRDX1 more ... CTD PMID:33040242|PMID:35301059|PMID:37325564 Prdx1 Rat cadmium dichloride increases expression ISO Prdx1 (Mus musculus) 6480464 Cadmium Chloride results in increased expression of PRDX1 mRNA CTD PMID:20061341|PMID:22677785 Prdx1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of PRDX1 mRNA; Cadmium Chloride results in increased expression more ... CTD PMID:17327700|PMID:21699967 Prdx1 Rat calcitriol decreases expression ISO PRDX1 (Homo sapiens) 6480464 Calcitriol results in decreased expression of PRDX1 mRNA CTD PMID:12875902 Prdx1 Rat calycosin increases expression ISO PRDX1 (Homo sapiens) 6480464 7,3'-dihydroxy-4'-methoxyisoflavone results in increased expression of PRDX1 protein CTD PMID:24455688 Prdx1 Rat capsaicin multiple interactions EXP 6480464 Capsaicin inhibits the reaction [Dietary Fats results in increased expression of PRDX1 protein] CTD PMID:20359164 Prdx1 Rat captan increases expression ISO Prdx1 (Mus musculus) 6480464 Captan results in increased expression of PRDX1 mRNA CTD PMID:31558096 Prdx1 Rat carbon nanotube increases expression ISO PRDX1 (Homo sapiens) 6480464 Nanotubes, Carbon results in increased expression of PRDX1 protein CTD PMID:22157353 Prdx1 Rat ceric oxide multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of [Benzo(a)pyrene co-treated with ceric oxide]] which results in more ... CTD PMID:36982514 Prdx1 Rat cerium trichloride multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [cerous chloride co-treated with lanthanum chloride] results in decreased expression of PRDX1 mRNA CTD PMID:28954213 Prdx1 Rat cerium trichloride decreases expression ISO PRDX1 (Homo sapiens) 6480464 cerous chloride results in decreased expression of PRDX1 mRNA CTD PMID:28954213 Prdx1 Rat chloramine T increases expression EXP 6480464 chloramine-T results in increased expression of PRDX1 protein CTD PMID:24213014 Prdx1 Rat chlordecone decreases expression ISO Prdx1 (Mus musculus) 6480464 Chlordecone results in decreased expression of PRDX1 protein CTD PMID:19666090 Prdx1 Rat chloropicrin increases expression ISO PRDX1 (Homo sapiens) 6480464 chloropicrin results in increased expression of PRDX1 mRNA CTD PMID:26352163 Prdx1 Rat chromium(6+) increases oxidation ISO PRDX1 (Homo sapiens) 6480464 chromium hexavalent ion results in increased oxidation of PRDX1 protein CTD PMID:19703554 Prdx1 Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of PRDX1 protein CTD PMID:22023808 Prdx1 Rat cisplatin decreases expression ISO Prdx1 (Mus musculus) 6480464 Cisplatin results in decreased expression of PRDX1 protein CTD PMID:29733421 Prdx1 Rat cisplatin multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of PRDX1 mRNA CTD PMID:27392435 Prdx1 Rat cisplatin increases expression ISO PRDX1 (Homo sapiens) 6480464 Cisplatin results in increased expression of PRDX1 mRNA; Cisplatin results in increased expression of PRDX1 more ... CTD PMID:25450742|PMID:27392435 Prdx1 Rat clobetasol increases expression ISO Prdx1 (Mus musculus) 6480464 Clobetasol results in increased expression of PRDX1 mRNA CTD PMID:27462272 Prdx1 Rat clozapine multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [Cuprizone co-treated with Clozapine] results in increased expression of PRDX1 protein CTD PMID:34122009 Prdx1 Rat cobalt dichloride decreases expression ISO PRDX1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PRDX1 protein CTD PMID:22339908 Prdx1 Rat copper atom increases expression ISO Prdx1 (Mus musculus) 6480464 Copper analog results in increased expression of PRDX1 protein; Copper results in increased expression of more ... CTD PMID:23882024 Prdx1 Rat copper atom affects binding ISO PRDX1 (Homo sapiens) 6480464 PRDX1 protein binds to Copper CTD PMID:14534351|PMID:15359738 Prdx1 Rat copper(0) increases expression ISO Prdx1 (Mus musculus) 6480464 Copper analog results in increased expression of PRDX1 protein; Copper results in increased expression of more ... CTD PMID:23882024 Prdx1 Rat copper(0) affects binding ISO PRDX1 (Homo sapiens) 6480464 PRDX1 protein binds to Copper CTD PMID:14534351|PMID:15359738 Prdx1 Rat copper(II) chloride increases expression ISO PRDX1 (Homo sapiens) 6480464 cupric chloride results in increased expression of PRDX1 mRNA CTD PMID:17211630 Prdx1 Rat CU-O LINKAGE increases expression ISO Prdx1 (Mus musculus) 6480464 cupric oxide analog results in increased expression of PRDX1 protein CTD PMID:23882024 Prdx1 Rat cumene hydroperoxide increases expression ISO PRDX1 (Homo sapiens) 6480464 cumene hydroperoxide results in increased expression of PRDX1 protein CTD PMID:11295360 Prdx1 Rat Cuprizon multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [Cuprizone co-treated with Clozapine] results in increased expression of PRDX1 protein CTD PMID:34122009 Prdx1 Rat cylindrospermopsin increases expression ISO Prdx1 (Mus musculus) 6480464 cylindrospermopsin results in increased expression of PRDX1 mRNA CTD PMID:20936652 Prdx1 Rat D-glucose increases expression ISO PRDX1 (Homo sapiens) 6480464 Glucose results in increased expression of PRDX1 mRNA CTD PMID:32942007 Prdx1 Rat D-glucose multiple interactions EXP 6480464 [Glucose co-treated with gastrodin] affects the expression of PRDX1 mRNA CTD PMID:33764184 Prdx1 Rat D-glucose multiple interactions ISO Prdx1 (Mus musculus) 6480464 [Glucose co-treated with gastrodin] affects the expression of PRDX1 mRNA CTD PMID:33764184 Prdx1 Rat dexamethasone increases expression ISO Prdx1 (Mus musculus) 6480464 Dexamethasone results in increased expression of PRDX1 protein CTD PMID:33567340 Prdx1 Rat dextran sulfate decreases expression ISO Prdx1 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of PRDX1 protein CTD PMID:35999755 Prdx1 Rat diarsenic trioxide increases expression ISO PRDX1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PRDX1 mRNA CTD PMID:20458559 Prdx1 Rat dibenzo[a,l]pyrene decreases expression ISO Prdx1 (Mus musculus) 6480464 dibenzo(a,l)pyrene results in decreased expression of PRDX1 mRNA CTD PMID:25908611 Prdx1 Rat dibenzo[a,l]pyrene decreases expression ISO PRDX1 (Homo sapiens) 6480464 dibenzo(a,l)pyrene results in decreased expression of PRDX1 mRNA CTD PMID:31255691 Prdx1 Rat dicrotophos decreases expression ISO PRDX1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of PRDX1 mRNA CTD PMID:28302478 Prdx1 Rat diethyl maleate increases expression EXP 6480464 diethyl maleate results in increased expression of PRDX1 mRNA CTD PMID:9506838 Prdx1 Rat diethyl maleate increases expression ISO Prdx1 (Mus musculus) 6480464 diethyl maleate results in increased expression of PRDX1 mRNA CTD PMID:9506838 Prdx1 Rat diethyl maleate increases expression ISO PRDX1 (Homo sapiens) 6480464 diethyl maleate results in increased expression of PRDX1 mRNA CTD PMID:9506838 Prdx1 Rat dihydroartemisinin affects binding ISO PRDX1 (Homo sapiens) 6480464 artenimol analog binds to PRDX1 protein CTD PMID:26340163 Prdx1 Rat dioscin multiple interactions ISO Prdx1 (Mus musculus) 6480464 dioscin inhibits the reaction [Acetaminophen results in decreased expression of PRDX1 protein] CTD PMID:22939915 Prdx1 Rat dioxygen increases expression EXP 6480464 Oxygen results in increased expression of PRDX1 mRNA CTD PMID:22911455 Prdx1 Rat dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [Antimony Potassium Tartrate results in increased abundance of antimonite] which results in increased expression of more ... CTD PMID:32076005 Prdx1 Rat diquat increases expression ISO Prdx1 (Mus musculus) 6480464 Diquat results in increased expression of PRDX1 mRNA CTD PMID:16962985 Prdx1 Rat disodium selenite increases expression ISO PRDX1 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of PRDX1 mRNA CTD PMID:18175754 Prdx1 Rat disulfiram increases expression ISO PRDX1 (Homo sapiens) 6480464 Disulfiram results in increased expression of PRDX1 mRNA; Disulfiram results in increased expression of PRDX1 more ... CTD PMID:34182011 Prdx1 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of PRDX1 mRNA CTD PMID:21551480 Prdx1 Rat dorsomorphin multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Prdx1 Rat doxorubicin increases expression ISO Prdx1 (Mus musculus) 6480464 Doxorubicin results in increased expression of PRDX1 mRNA; Doxorubicin results in increased expression of PRDX1 more ... CTD PMID:21463615|PMID:22016648 Prdx1 Rat doxorubicin decreases expression ISO Prdx1 (Mus musculus) 6480464 Doxorubicin results in decreased expression of PRDX1 mRNA CTD PMID:34713381 Prdx1 Rat doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of PRDX1 mRNA CTD PMID:34713381 Prdx1 Rat doxorubicin increases expression ISO PRDX1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of PRDX1 mRNA CTD PMID:29803840 Prdx1 Rat doxorubicin multiple interactions ISO Prdx1 (Mus musculus) 6480464 MT1 affects the reaction [Doxorubicin results in increased expression of PRDX1 mRNA]; MT1 affects the more ... CTD PMID:21463615 Prdx1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of PRDX1 mRNA CTD PMID:29391264 Prdx1 Rat enzyme inhibitor multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Prdx1 Rat ethanol increases expression ISO PRDX1 (Homo sapiens) 6480464 Ethanol results in increased expression of PRDX1 protein CTD PMID:20621659 Prdx1 Rat ethanol affects expression ISO Prdx1 (Mus musculus) 6480464 Ethanol affects the expression of PRDX1 mRNA CTD PMID:30319688 Prdx1 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of PRDX1 protein CTD PMID:23200777 Prdx1 Rat ethoxyquin multiple interactions ISO Prdx1 (Mus musculus) 6480464 [Ethoxyquin results in increased expression of PRDX1 protein] which results in increased phosphorylation of MAPK14 more ... CTD PMID:16880205 Prdx1 Rat ethoxyquin increases expression ISO Prdx1 (Mus musculus) 6480464 Ethoxyquin results in increased expression of PRDX1 protein CTD PMID:16880205 Prdx1 Rat etoposide decreases expression ISO Prdx1 (Mus musculus) 6480464 Etoposide results in decreased expression of PRDX1 protein CTD PMID:29733421 Prdx1 Rat fenthion decreases expression ISO Prdx1 (Mus musculus) 6480464 Fenthion results in decreased expression of PRDX1 mRNA CTD PMID:34813904 Prdx1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of PRDX1 mRNA CTD PMID:24136188 Prdx1 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of PRDX1 mRNA CTD PMID:23962444 Prdx1 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of PRDX1 mRNA CTD PMID:34044035 Prdx1 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of PRDX1 mRNA CTD PMID:18035473 Prdx1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PRDX1 mRNA CTD PMID:24136188 Prdx1 Rat folic acid multiple interactions ISO Prdx1 (Mus musculus) 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PRDX1 mRNA CTD PMID:22206623 Prdx1 Rat folpet increases expression ISO Prdx1 (Mus musculus) 6480464 folpet results in increased expression of PRDX1 mRNA CTD PMID:31558096 Prdx1 Rat frenolicin B multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [frenolicin B results in decreased activity of PRDX1 protein] which results in decreased abundance of more ... CTD PMID:30661989 Prdx1 Rat furan increases expression EXP 6480464 furan results in increased expression of PRDX1 mRNA CTD PMID:15120968 Prdx1 Rat furan increases methylation EXP 6480464 furan results in increased methylation of PRDX1 gene CTD PMID:22079235 Prdx1 Rat furan affects binding EXP 6480464 furan binds to PRDX1 protein CTD PMID:22240984 Prdx1 Rat furfural multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ... CTD PMID:38598786 Prdx1 Rat Gastrodin multiple interactions ISO Prdx1 (Mus musculus) 6480464 [Glucose co-treated with gastrodin] affects the expression of PRDX1 mRNA CTD PMID:33764184 Prdx1 Rat Gastrodin multiple interactions EXP 6480464 [Glucose co-treated with gastrodin] affects the expression of PRDX1 mRNA CTD PMID:33764184 Prdx1 Rat genistein decreases expression ISO Prdx1 (Mus musculus) 6480464 Genistein results in decreased expression of PRDX1 mRNA CTD PMID:24967385 Prdx1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PRDX1 protein CTD PMID:22061828 Prdx1 Rat geraniol multiple interactions EXP 6480464 geraniol inhibits the reaction [Isoproterenol results in decreased expression of PRDX1 mRNA]; geraniol inhibits the more ... CTD PMID:35608392 Prdx1 Rat glucose increases expression ISO PRDX1 (Homo sapiens) 6480464 Glucose results in increased expression of PRDX1 mRNA CTD PMID:32942007 Prdx1 Rat glucose multiple interactions ISO Prdx1 (Mus musculus) 6480464 [Glucose co-treated with gastrodin] affects the expression of PRDX1 mRNA CTD PMID:33764184 Prdx1 Rat glucose multiple interactions EXP 6480464 [Glucose co-treated with gastrodin] affects the expression of PRDX1 mRNA CTD PMID:33764184 Prdx1 Rat glutathione multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [frenolicin B results in decreased activity of PRDX1 protein] which results in decreased abundance of more ... CTD PMID:30661989 Prdx1 Rat gold atom decreases expression ISO Prdx1 (Mus musculus) 6480464 Gold analog results in decreased expression of PRDX1 protein CTD PMID:24780912 Prdx1 Rat gold atom increases expression ISO PRDX1 (Homo sapiens) 6480464 Gold analog results in increased expression of PRDX1 mRNA CTD PMID:36057382 Prdx1 Rat gold(0) decreases expression ISO Prdx1 (Mus musculus) 6480464 Gold analog results in decreased expression of PRDX1 protein CTD PMID:24780912 Prdx1 Rat gold(0) increases expression ISO PRDX1 (Homo sapiens) 6480464 Gold analog results in increased expression of PRDX1 mRNA CTD PMID:36057382 Prdx1 Rat herbicide multiple interactions ISO Prdx1 (Mus musculus) 6480464 arginyl-2,'6'-dimethyltyrosyl-lysyl-phenylalaninamide inhibits the reaction [Herbicides results in decreased expression of PRDX1 mRNA] CTD PMID:21318024 Prdx1 Rat herbicide decreases expression ISO Prdx1 (Mus musculus) 6480464 Herbicides results in decreased expression of PRDX1 mRNA CTD PMID:21318024 Prdx1 Rat herbicide increases expression ISO Prdx1 (Mus musculus) 6480464 Herbicides results in increased expression of PRDX1 mRNA CTD PMID:21318024 Prdx1 Rat hexadecanoic acid multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [Palmitic Acid co-treated with Arsenic] results in increased expression of PRDX1 mRNA CTD PMID:33736254 Prdx1 Rat hyaluronic acid affects expression EXP 6480464 Hyaluronic Acid analog affects the expression of PRDX1 protein CTD PMID:23178681 Prdx1 Rat hydrogen peroxide affects expression ISO PRDX1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of PRDX1 mRNA CTD PMID:20044591 Prdx1 Rat hydrogen peroxide increases expression ISO Prdx1 (Mus musculus) 6480464 Hydrogen Peroxide results in increased expression of PRDX1 mRNA CTD PMID:9506838 Prdx1 Rat hydrogen peroxide affects expression EXP 6480464 Hydrogen Peroxide affects the expression of PRDX1 protein CTD PMID:23178681 Prdx1 Rat hydrogen peroxide multiple interactions ISO PRDX1 (Homo sapiens) 6480464 (N-propargyl-(3R) aminoindan-5-yl)-ethyl methyl carbamate inhibits the reaction [Hydrogen Peroxide results in decreased expression of PRDX1 more ... CTD PMID:18598687|PMID:30661989 Prdx1 Rat hydrogen peroxide decreases expression ISO PRDX1 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of PRDX1 mRNA; Hydrogen Peroxide results in decreased expression more ... CTD PMID:18598687 Prdx1 Rat hydrogen peroxide multiple interactions ISO Prdx1 (Mus musculus) 6480464 PRDX1 protein promotes the reaction [Hydrogen Peroxide results in increased phosphorylation of MAPK14 protein] CTD PMID:16880205 Prdx1 Rat hydrogen peroxide increases expression ISO PRDX1 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of PRDX1 protein CTD PMID:11295360 Prdx1 Rat hydrogen peroxide decreases response to substance ISO PRDX1 (Homo sapiens) 6480464 PRDX1 protein results in decreased susceptibility to Hydrogen Peroxide CTD PMID:11469800 Prdx1 Rat hydroquinone increases expression ISO PRDX1 (Homo sapiens) 6480464 hydroquinone results in increased expression of PRDX1 mRNA CTD PMID:15452088 Prdx1 Rat hypochlorous acid increases expression ISO Prdx1 (Mus musculus) 6480464 Hypochlorous Acid results in increased expression of PRDX1 mRNA CTD PMID:19376150 Prdx1 Rat indole-3-methanol multiple interactions ISO PRDX1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [indole-3-carbinol results in decreased expression of PRDX1 protein] CTD PMID:33118390 Prdx1 Rat indole-3-methanol decreases expression ISO PRDX1 (Homo sapiens) 6480464 indole-3-carbinol results in decreased expression of PRDX1 protein CTD PMID:29992829|PMID:33118390 Prdx1 Rat inulin multiple interactions ISO Prdx1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of PRDX1 mRNA CTD PMID:36331819 Prdx1 Rat isoprenaline multiple interactions EXP 6480464 geraniol inhibits the reaction [Isoproterenol results in decreased expression of PRDX1 mRNA]; geraniol inhibits the more ... CTD PMID:35608392 Prdx1 Rat isoprenaline decreases expression EXP 6480464 Isoproterenol results in decreased expression of PRDX1 mRNA; Isoproterenol results in decreased expression of PRDX1 more ... CTD PMID:35608392 Prdx1 Rat ivermectin decreases expression ISO PRDX1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PRDX1 protein CTD PMID:32959892 Prdx1 Rat kojic acid multiple interactions EXP 6480464 [Ascorbic Acid co-treated with kojic acid co-treated with Diethylnitrosamine] results in decreased expression of PRDX1 more ... CTD PMID:18544905 Prdx1 Rat L-ascorbic acid multiple interactions EXP 6480464 [Ascorbic Acid co-treated with kojic acid co-treated with Diethylnitrosamine] results in decreased expression of PRDX1 more ... CTD PMID:18544905 Prdx1 Rat lanthanum trichloride multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [cerous chloride co-treated with lanthanum chloride] results in decreased expression of PRDX1 mRNA CTD PMID:28954213 Prdx1 Rat lead diacetate decreases expression ISO Prdx1 (Mus musculus) 6480464 lead acetate results in decreased expression of PRDX1 mRNA CTD PMID:21829687 Prdx1 Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of PRDX1 mRNA CTD PMID:33862172 Prdx1 Rat lead(0) affects expression ISO PRDX1 (Homo sapiens) 6480464 Lead affects the expression of PRDX1 mRNA CTD PMID:28903495 Prdx1 Rat lipopolysaccharide increases expression ISO Prdx1 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of PRDX1 mRNA CTD PMID:19339665 Prdx1 Rat lipopolysaccharide multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in increased expression of PRDX1 mRNA CTD PMID:31059760 Prdx1 Rat lipopolysaccharide multiple interactions ISO Prdx1 (Mus musculus) 6480464 methyldithiocarbamate promotes the reaction [Lipopolysaccharides results in increased expression of PRDX1 mRNA] CTD PMID:19339665 Prdx1 Rat lycopene multiple interactions ISO Prdx1 (Mus musculus) 6480464 Lycopene inhibits the reaction [Atrazine results in increased expression of PRDX1 mRNA] CTD PMID:36216167 Prdx1 Rat maneb increases expression ISO PRDX1 (Homo sapiens) 6480464 [Maneb results in increased expression of NFE2L2 protein] which results in increased expression of PRDX1 more ... CTD PMID:21402726 Prdx1 Rat manganese atom multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Prdx1 Rat manganese(0) multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Prdx1 Rat manganese(II) chloride multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Prdx1 Rat menadione increases expression ISO Prdx1 (Mus musculus) 6480464 Vitamin K 3 results in increased expression of PRDX1 mRNA CTD PMID:9506838 Prdx1 Rat mercury dibromide increases expression ISO PRDX1 (Homo sapiens) 6480464 mercuric bromide results in increased expression of PRDX1 mRNA CTD PMID:26272509 Prdx1 Rat mercury dibromide multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Prdx1 Rat metam multiple interactions ISO Prdx1 (Mus musculus) 6480464 methyldithiocarbamate promotes the reaction [Lipopolysaccharides results in increased expression of PRDX1 mRNA] CTD PMID:19339665 Prdx1 Rat methidathion decreases expression ISO Prdx1 (Mus musculus) 6480464 methidathion results in decreased expression of PRDX1 mRNA CTD PMID:34813904 Prdx1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of PRDX1 mRNA CTD PMID:20144635|PMID:30047161 Prdx1 Rat methotrexate increases expression ISO PRDX1 (Homo sapiens) 6480464 Methotrexate results in increased expression of PRDX1 mRNA CTD PMID:21678067 Prdx1 Rat methylmercury chloride increases expression ISO Prdx1 (Mus musculus) 6480464 methylmercuric chloride results in increased expression of PRDX1 mRNA CTD PMID:20061341 Prdx1 Rat methylmercury chloride increases expression ISO PRDX1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of PRDX1 mRNA CTD PMID:28001369 Prdx1 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of PRDX1 mRNA CTD PMID:28659758 Prdx1 Rat N-acetyl-L-cysteine multiple interactions ISO PRDX1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [[frenolicin B results in decreased activity of PRDX1 protein] which results more ... CTD PMID:30661989|PMID:33118390 Prdx1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO Prdx1 (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of PRDX1 mRNA CTD PMID:20061341 Prdx1 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of PRDX1 protein CTD PMID:20600802 Prdx1 Rat N-methyl-4-phenylpyridinium decreases expression ISO Prdx1 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of PRDX1 protein CTD PMID:26558463 Prdx1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Ascorbic Acid co-treated with kojic acid co-treated with Diethylnitrosamine] results in decreased expression of PRDX1 more ... CTD PMID:18544905 Prdx1 Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of PRDX1 protein CTD PMID:19716841 Prdx1 Rat naphthalene increases reduction ISO Prdx1 (Mus musculus) 6480464 naphthalene results in increased reduction of PRDX1 protein CTD PMID:19843705 Prdx1 Rat NCX-4040 increases expression ISO PRDX1 (Homo sapiens) 6480464 NCX 4040 results in increased expression of PRDX1 mRNA CTD PMID:20188076 Prdx1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of PRDX1 mRNA CTD PMID:24136188 Prdx1 Rat nickel atom decreases expression ISO PRDX1 (Homo sapiens) 6480464 Nickel results in decreased expression of PRDX1 mRNA CTD PMID:23195993 Prdx1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of PRDX1 mRNA CTD PMID:24136188 Prdx1 Rat Nonylphenol increases expression ISO PRDX1 (Homo sapiens) 6480464 nonylphenol results in increased expression of PRDX1 protein CTD PMID:16054331 Prdx1 Rat obeticholic acid decreases expression ISO PRDX1 (Homo sapiens) 6480464 obeticholic acid results in decreased expression of PRDX1 mRNA CTD PMID:27939613 Prdx1 Rat oleanolic acid multiple interactions ISO PRDX1 (Homo sapiens) 6480464 Oleanolic Acid inhibits the reaction [tert-Butylhydroperoxide results in decreased expression of PRDX1 protein] CTD PMID:20100471 Prdx1 Rat ozone multiple interactions ISO Prdx1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of PRDX1 more ... CTD PMID:23019345 Prdx1 Rat p-chloromercuribenzoic acid increases expression ISO PRDX1 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of PRDX1 mRNA CTD PMID:26272509 Prdx1 Rat p-chloromercuribenzoic acid multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Prdx1 Rat p-menthan-3-ol increases expression ISO PRDX1 (Homo sapiens) 6480464 Menthol results in increased expression of PRDX1 protein CTD PMID:26760959 Prdx1 Rat paracetamol affects expression ISO Prdx1 (Mus musculus) 6480464 Acetaminophen affects the expression of PRDX1 mRNA CTD PMID:17562736 Prdx1 Rat paracetamol multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in increased expression of PRDX1 mRNA CTD PMID:31059760 Prdx1 Rat paracetamol increases expression ISO PRDX1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of PRDX1 mRNA CTD PMID:25704631|PMID:31059760 Prdx1 Rat paracetamol multiple interactions ISO Prdx1 (Mus musculus) 6480464 [CTH gene mutant form results in increased susceptibility to Acetaminophen] which results in increased expression more ... CTD PMID:22939915|PMID:25499718 Prdx1 Rat paracetamol decreases expression ISO Prdx1 (Mus musculus) 6480464 Acetaminophen results in decreased expression of PRDX1 protein CTD PMID:22939915 Prdx1 Rat paraquat increases expression ISO PRDX1 (Homo sapiens) 6480464 Paraquat results in increased expression of PRDX1 mRNA; Paraquat results in increased expression of PRDX1 more ... CTD PMID:11697128|PMID:22996356 Prdx1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of PRDX1 mRNA CTD PMID:32680482 Prdx1 Rat paraquat multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [Quercetin co-treated with Paraquat] results in increased expression of PRDX1 mRNA CTD PMID:22996356 Prdx1 Rat paraquat decreases expression ISO Prdx1 (Mus musculus) 6480464 Paraquat results in decreased expression of PRDX1 mRNA CTD PMID:17215068 Prdx1 Rat paraquat increases oxidation ISO PRDX1 (Homo sapiens) 6480464 Paraquat results in increased oxidation of PRDX1 protein CTD PMID:21402726 Prdx1 Rat pentachlorophenol increases expression ISO Prdx1 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of PRDX1 mRNA CTD PMID:23892564 Prdx1 Rat perfluorohexanesulfonic acid increases expression ISO Prdx1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of PRDX1 mRNA CTD PMID:37995155 Prdx1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Prdx1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PRDX1 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Prdx1 Rat permethrin multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of PRDX1 mRNA CTD PMID:28659758 Prdx1 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of PRDX1 mRNA CTD PMID:16510358 Prdx1 Rat phenylmercury acetate increases expression ISO PRDX1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of PRDX1 mRNA CTD PMID:26272509 Prdx1 Rat phenylmercury acetate multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Prdx1 Rat phlorizin increases expression ISO Prdx1 (Mus musculus) 6480464 Phlorhizin results in increased expression of PRDX1 mRNA CTD PMID:22538082 Prdx1 Rat picloram decreases expression ISO Prdx1 (Mus musculus) 6480464 Picloram results in decreased expression of PRDX1 mRNA CTD PMID:21318024 Prdx1 Rat picloram multiple interactions ISO Prdx1 (Mus musculus) 6480464 arginyl-2,'6'-dimethyltyrosyl-lysyl-phenylalaninamide inhibits the reaction [Picloram results in decreased expression of PRDX1 mRNA] CTD PMID:21318024 Prdx1 Rat picoxystrobin increases expression ISO PRDX1 (Homo sapiens) 6480464 picoxystrobin results in increased expression of PRDX1 mRNA CTD PMID:33512557 Prdx1 Rat potassium dichromate increases expression ISO PRDX1 (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of PRDX1 mRNA CTD PMID:11678601|PMID:18332044 Prdx1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of PRDX1 mRNA CTD PMID:19162173 Prdx1 Rat procymidone decreases expression EXP 6480464 procymidone results in decreased expression of PRDX1 mRNA CTD PMID:15686871 Prdx1 Rat Propiverine affects binding EXP 6480464 propiverine binds to PRDX1 protein CTD PMID:29273565 Prdx1 Rat Pyridostigmine bromide multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of PRDX1 mRNA CTD PMID:28659758 Prdx1 Rat pyrogallol increases expression ISO Prdx1 (Mus musculus) 6480464 Pyrogallol results in increased expression of PRDX1 mRNA CTD PMID:20362636 Prdx1 Rat quartz increases expression ISO PRDX1 (Homo sapiens) 6480464 Quartz results in increased expression of PRDX1 mRNA CTD PMID:27917503 Prdx1 Rat quercetin multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [Quercetin co-treated with Paraquat] results in increased expression of PRDX1 mRNA; Quercetin inhibits the reaction more ... CTD PMID:17292933|PMID:22996356 Prdx1 Rat quercetin multiple interactions ISO Prdx1 (Mus musculus) 6480464 Quercetin inhibits the reaction [Carbon Tetrachloride results in decreased expression of PRDX1 mRNA] CTD PMID:25471833 Prdx1 Rat rac-lactic acid decreases expression ISO PRDX1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PRDX1 mRNA CTD PMID:30851411 Prdx1 Rat reactive oxygen species decreases abundance ISO PRDX1 (Homo sapiens) 6480464 PRDX1 protein results in decreased abundance of Reactive Oxygen Species CTD PMID:27517622 Prdx1 Rat reactive oxygen species multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [frenolicin B results in decreased activity of PRDX1 protein] which results in increased abundance of more ... CTD PMID:30661989 Prdx1 Rat reactive oxygen species decreases abundance ISO Prdx1 (Mus musculus) 6480464 PRDX1 protein results in decreased abundance of Reactive Oxygen Species CTD PMID:27517622 Prdx1 Rat reactive oxygen species multiple interactions ISO Prdx1 (Mus musculus) 6480464 PRDX1 protein inhibits the reaction [HRAS protein mutant form results in increased abundance of Reactive more ... CTD PMID:27517622 Prdx1 Rat resveratrol affects secretion ISO PRDX1 (Homo sapiens) 6480464 resveratrol affects the secretion of PRDX1 protein CTD PMID:24802182 Prdx1 Rat rotenone decreases expression ISO Prdx1 (Mus musculus) 6480464 Rotenone results in decreased expression of PRDX1 mRNA CTD PMID:22016648 Prdx1 Rat rotenone increases expression ISO PRDX1 (Homo sapiens) 6480464 Rotenone results in increased expression of PRDX1 mRNA CTD PMID:33512557 Prdx1 Rat rottlerin multiple interactions ISO Prdx1 (Mus musculus) 6480464 rottlerin inhibits the reaction [sodium arsenate results in increased expression of PRDX1 mRNA]; rottlerin inhibits more ... CTD PMID:11796722 Prdx1 Rat S-butyl-DL-homocysteine (S,R)-sulfoximine increases expression ISO Prdx1 (Mus musculus) 6480464 Buthionine Sulfoximine results in increased expression of PRDX1 mRNA CTD PMID:15707499 Prdx1 Rat S-butyl-DL-homocysteine (S,R)-sulfoximine affects expression ISO Prdx1 (Mus musculus) 6480464 Buthionine Sulfoximine affects the expression of PRDX1 mRNA CTD PMID:9506838 Prdx1 Rat SB 203580 multiple interactions ISO Prdx1 (Mus musculus) 6480464 SB 203580 inhibits the reaction [sodium arsenate results in increased expression of PRDX1 protein] CTD PMID:11796722 Prdx1 Rat SB 431542 multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of PRDX1 more ... CTD PMID:27188386|PMID:37664457 Prdx1 Rat silicon dioxide increases secretion ISO PRDX1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased secretion of PRDX1 protein CTD PMID:25895662 Prdx1 Rat Siomycin A multiple interactions ISO PRDX1 (Homo sapiens) 6480464 siomycin A inhibits the reaction [HRAS protein mutant form results in increased expression of PRDX1 more ... CTD PMID:27517622 Prdx1 Rat sodium arsenate increases expression ISO Prdx1 (Mus musculus) 6480464 sodium arsenate results in increased expression of PRDX1 mRNA; sodium arsenate results in increased expression more ... CTD PMID:11796722|PMID:12745069|PMID:9506838 Prdx1 Rat sodium arsenate increases expression EXP 6480464 sodium arsenate results in increased expression of PRDX1 mRNA CTD PMID:9506838 Prdx1 Rat sodium arsenate increases expression ISO PRDX1 (Homo sapiens) 6480464 sodium arsenate results in increased expression of PRDX1 mRNA CTD PMID:9506838 Prdx1 Rat sodium arsenate multiple interactions ISO Prdx1 (Mus musculus) 6480464 2-(1-(3-dimethylaminopropyl)-5-methoxyindol-3-yl)-3-(1H-indol-3-yl)maleimide inhibits the reaction [sodium arsenate results in increased expression of PRDX1 protein]; 4-(4-fluorophenyl)-2-(4-hydroxyphenyl)-5-(4-pyridyl)imidazole affects more ... CTD PMID:11796722 Prdx1 Rat sodium arsenite increases expression ISO PRDX1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PRDX1 mRNA; sodium arsenite results in increased expression more ... CTD PMID:15899475|PMID:28229933|PMID:34032870|PMID:38568856 Prdx1 Rat sodium arsenite decreases expression ISO PRDX1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PRDX1 mRNA CTD PMID:28336213 Prdx1 Rat sodium arsenite increases methylation ISO PRDX1 (Homo sapiens) 6480464 sodium arsenite results in increased methylation of PRDX1 promoter CTD PMID:28336213 Prdx1 Rat sodium arsenite multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:28336213|PMID:32076005|PMID:39836092 Prdx1 Rat sodium arsenite increases expression ISO Prdx1 (Mus musculus) 6480464 sodium arsenite results in increased expression of PRDX1 mRNA CTD PMID:16322246 Prdx1 Rat sodium chloride multiple interactions ISO PRDX1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ... CTD PMID:38598786 Prdx1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of PRDX1 mRNA CTD PMID:22561333 Prdx1 Rat sodium dichromate increases expression ISO Prdx1 (Mus musculus) 6480464 sodium bichromate results in increased expression of PRDX1 mRNA CTD PMID:22155349|PMID:31558096 Prdx1 Rat sodium fluoride increases expression ISO Prdx1 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of PRDX1 mRNA CTD PMID:21340527 Prdx1 Rat sodium fluoride decreases expression ISO Prdx1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of PRDX1 protein CTD PMID:28918527 Prdx1 Rat staurosporine multiple interactions ISO Prdx1 (Mus musculus) 6480464 Staurosporine inhibits the reaction [sodium arsenate results in increased expression of PRDX1 protein] CTD PMID:11796722 Prdx1 Rat streptozocin multiple interactions ISO PRDX1 (Homo sapiens) 6480464 PRDX4 protein inhibits the reaction [Streptozocin results in decreased expression of PRDX1 mRNA] CTD PMID:20446767 Prdx1 Rat streptozocin decreases expression ISO Prdx1 (Mus musculus) 6480464 Streptozocin results in decreased expression of PRDX1 mRNA CTD PMID:20446767 Prdx1 Rat styrene increases expression EXP 6480464 Styrene results in increased expression of PRDX1 mRNA CTD PMID:17654243 Prdx1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of PRDX1 mRNA CTD PMID:30047161 Prdx1 Rat sulfasalazine increases expression EXP 6480464 Sulfasalazine results in increased expression of PRDX1 mRNA CTD PMID:16141653 Prdx1 Rat sulfasalazine increases expression ISO Prdx1 (Mus musculus) 6480464 Sulfasalazine results in increased expression of PRDX1 mRNA CTD PMID:22016648 Prdx1 Rat sulforaphane decreases methylation ISO PRDX1 (Homo sapiens) 6480464 sulforaphane results in decreased methylation of PRDX1 gene CTD PMID:31838189 Prdx1 Rat sulforaphane increases expression ISO PRDX1 (Homo sapiens) 6480464 sulforaphane results in increased expression of PRDX1 mRNA CTD PMID:31838189 Prdx1 Rat sulindac increases expression EXP 6480464 Sulindac results in increased expression of PRDX1 mRNA CTD PMID:24136188 Prdx1 Rat tert-butyl hydroperoxide increases expression ISO PRDX1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of PRDX1 protein CTD PMID:11295360 Prdx1 Rat tert-butyl hydroperoxide decreases expression ISO PRDX1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of PRDX1 protein CTD PMID:20100471 Prdx1 Rat tert-butyl hydroperoxide multiple interactions ISO PRDX1 (Homo sapiens) 6480464 Oleanolic Acid inhibits the reaction [tert-Butylhydroperoxide results in decreased expression of PRDX1 protein] CTD PMID:20100471 Prdx1 Rat tert-butyl hydroperoxide increases activity ISO Prdx1 (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased activity of PRDX1 protein CTD PMID:16880205 Prdx1 Rat tetrachloromethane multiple interactions ISO Prdx1 (Mus musculus) 6480464 Quercetin inhibits the reaction [Carbon Tetrachloride results in decreased expression of PRDX1 mRNA] CTD PMID:25471833 Prdx1 Rat tetrachloromethane multiple interactions EXP 6480464 [Olive Oil analog co-treated with Carbon Tetrachloride] results in increased expression of PRDX1 protein CTD PMID:25303780 Prdx1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PRDX1 mRNA CTD PMID:16309569 Prdx1 Rat tetrachloromethane decreases expression ISO Prdx1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of PRDX1 mRNA CTD PMID:25471833 Prdx1 Rat thapsigargin decreases expression ISO Prdx1 (Mus musculus) 6480464 Thapsigargin results in decreased expression of PRDX1 protein CTD PMID:24648495 Prdx1 Rat titanium dioxide decreases phosphorylation ISO PRDX1 (Homo sapiens) 6480464 titanium dioxide results in decreased phosphorylation of PRDX1 protein CTD PMID:21439344 Prdx1 Rat titanium dioxide decreases methylation ISO Prdx1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PRDX1 promoter CTD PMID:35295148 Prdx1 Rat Tomentosin increases expression ISO PRDX1 (Homo sapiens) 6480464 tomentosin results in increased expression of PRDX1 protein CTD PMID:30917517 Prdx1 Rat Tributyltin oxide decreases phosphorylation ISO Prdx1 (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in decreased phosphorylation of PRDX1 protein CTD PMID:22174045 Prdx1 Rat trichlopyr increases expression ISO Prdx1 (Mus musculus) 6480464 triclopyr results in increased expression of PRDX1 mRNA CTD PMID:21318024 Prdx1 Rat trichlopyr multiple interactions ISO Prdx1 (Mus musculus) 6480464 arginyl-2,'6'-dimethyltyrosyl-lysyl-phenylalaninamide promotes the reaction [triclopyr results in increased expression of PRDX1 mRNA] CTD PMID:21318024 Prdx1 Rat trichloroethene increases expression ISO Prdx1 (Mus musculus) 6480464 Trichloroethylene results in increased expression of PRDX1 mRNA CTD PMID:19254012 Prdx1 Rat trichostatin A increases expression ISO PRDX1 (Homo sapiens) 6480464 trichostatin A results in increased expression of PRDX1 protein CTD PMID:19294695 Prdx1 Rat triclosan decreases expression ISO PRDX1 (Homo sapiens) 6480464 Triclosan results in decreased expression of PRDX1 mRNA CTD PMID:30510588 Prdx1 Rat triphenylstannane decreases expression ISO PRDX1 (Homo sapiens) 6480464 triphenyltin analog results in decreased expression of PRDX1 protein CTD PMID:31634547 Prdx1 Rat triptonide increases expression ISO Prdx1 (Mus musculus) 6480464 triptonide results in increased expression of PRDX1 mRNA CTD PMID:33045310 Prdx1 Rat troglitazone decreases expression ISO PRDX1 (Homo sapiens) 6480464 troglitazone results in decreased expression of PRDX1 mRNA CTD PMID:19631733 Prdx1 Rat tungsten increases expression ISO Prdx1 (Mus musculus) 6480464 Tungsten results in increased expression of PRDX1 mRNA CTD PMID:30912803 Prdx1 Rat tunicamycin decreases expression ISO PRDX1 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of PRDX1 mRNA CTD PMID:29453283 Prdx1 Rat ursodeoxycholic acid increases expression ISO Prdx1 (Mus musculus) 6480464 Ursodeoxycholic Acid results in increased expression of PRDX1 mRNA; Ursodeoxycholic Acid results in increased expression more ... CTD PMID:18687751 Prdx1 Rat valproic acid affects expression ISO Prdx1 (Mus musculus) 6480464 Valproic Acid affects the expression of PRDX1 mRNA CTD PMID:17292431 Prdx1 Rat valproic acid increases expression ISO PRDX1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PRDX1 mRNA CTD PMID:23179753|PMID:28001369 Prdx1 Rat venlafaxine hydrochloride decreases expression EXP 6480464 Venlafaxine Hydrochloride results in decreased expression of PRDX1 mRNA CTD PMID:25423262 Prdx1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PRDX1 mRNA CTD PMID:15686871 Prdx1 Rat vorinostat increases expression ISO PRDX1 (Homo sapiens) 6480464 vorinostat results in increased expression of PRDX1 protein CTD PMID:17593366|PMID:20543569 Prdx1 Rat zinc atom affects binding ISO PRDX1 (Homo sapiens) 6480464 PRDX1 protein binds to Zinc CTD PMID:14534351 Prdx1 Rat zinc pyrithione increases expression ISO PRDX1 (Homo sapiens) 6480464 pyrithione zinc results in increased expression of PRDX1 mRNA CTD PMID:21424779 Prdx1 Rat zinc(0) affects binding ISO PRDX1 (Homo sapiens) 6480464 PRDX1 protein binds to Zinc CTD PMID:14534351
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Prdx1 Rat antioxidant activity enables IEA UniProtKB-KW:KW-0049 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Prdx1 Rat antioxidant activity enables IEA InterPro:IPR000866 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Prdx1 Rat heme binding IPI heme 729570 RGD Prdx1 Rat identical protein binding IPI Prdx1 (Rattus norvegicus) 2291799 homodimerization RGD Prdx1 Rat identical protein binding enables ISO Prdx1 (Mus musculus) 1624291 UniProtKB:P35700 PMID:21516123 RGD PMID:21516123 Prdx1 Rat oxidoreductase activity enables IEA InterPro:IPR000866 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Prdx1 Rat oxidoreductase activity enables IEA UniProtKB-KW:KW-0560 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Prdx1 Rat peroxidase activity enables ISO PRDX1 (Homo sapiens) 1624291 PMID:11986303 RGD PMID:11986303 Prdx1 Rat peroxidase activity enables IEA UniProtKB-KW:KW-0575 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Prdx1 Rat peroxiredoxin activity IDA 2291801 RGD Prdx1 Rat peroxiredoxin activity enables IEA InterPro:IPR019479 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Prdx1 Rat peroxiredoxin activity enables IEA ARBA:ARBA00089952 1600115 GO_REF:0000117 UniProt GO_REF:0000117 Prdx1 Rat peroxiredoxin activity IDA 2291832 RGD Prdx1 Rat protein binding enables ISO PRDX1 (Homo sapiens) 1624291 UniProtKB:P04156|UniProtKB:P10275|UniProtKB:P13693|UniProtKB:P54274|UniProtKB:P58004|UniProtKB:P60484|UniProtKB:Q13043|UniProtKB:Q13162|UniProtKB:Q78TU8|UniProtKB:Q86TI2-2|UniProtKB:Q8N7X4|UniProtKB:Q9BYN0|UniProtKB:Q9Y6P5 PMID:15105503, PMID:17909037, PMID:18172504, PMID:19369943, PMID:21044950, PMID:21969592, PMID:21988832, PMID:23386615, PMID:27607350, PMID:28671123, PMID:32814053, PMID:33961781 RGD PMID:15105503|PMID:17909037|PMID:18172504|PMID:19369943|PMID:21044950|PMID:21969592|PMID:21988832|PMID:23386615|PMID:27607350|PMID:28671123|PMID:32814053|PMID:33961781 Prdx1 Rat protein binding enables ISO Prdx1 (Mus musculus) 1624291 UniProtKB:Q13043 PMID:21516123 RGD PMID:21516123 Prdx1 Rat thioredoxin peroxidase activity enables ISO PRDX1 (Homo sapiens) 1624291 PMID:18606987 RGD PMID:18606987 Prdx1 Rat thioredoxin peroxidase activity enables IBA CGD:CAL0000174369|PANTHER:PTN000073874|PomBase:SPCC576.03c|SGD:S000002861|SGD:S000004490|UniProtKB:P0CU34|UniProtKB:P30048|UniProtKB:P32119|UniProtKB:Q06830|UniProtKB:Q8I5Q6|UniProtKB:Q8IL80|WB:WBGene00006434 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Prdx1 Rat thioredoxin-dependent peroxiredoxin activity enables IEA RHEA:62620 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Prdx1 Rat thioredoxin-dependent peroxiredoxin activity enables IEA EC:1.11.1.24 1600115 GO_REF:0000003 UniProt GO_REF:0000003
(+)-catechin (ISO) (1->4)-beta-D-glucan (ISO) (S)-naringenin (ISO) 1,2,4-trimethylbenzene (EXP) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrabromodibenzodioxine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-diaminotoluene (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-amino-14,16-dimethyloctadecan-3-ol (ISO) 2-butoxyethanol (ISO) 2-hydroxypropanoic acid (ISO) 2-tert-butylhydroquinone (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-dihydrocoumarin (ISO) 3-chloropropane-1,2-diol (EXP) 3H-1,2-dithiole-3-thione (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 6-propyl-2-thiouracil (EXP) 7,9-dihydro-1H-purine-2,6,8(3H)-trione (ISO) 8-hydroxy-2'-deoxyguanosine (ISO) 9,10-phenanthroquinone (ISO) acetamide (EXP) acrolein (ISO) acrylamide (ISO) actinomycin D (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (EXP,ISO) all-trans-retinoic acid (ISO) amiodarone (ISO) ammonium chloride (EXP) amphibole asbestos (ISO) antimonite (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenite ion (ISO) arsenite(3-) (ISO) arsenous acid (ISO) asbestos (ISO) astaxanthin (ISO) atrazine (ISO) azoxystrobin (ISO) benzo[a]pyrene (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) butyric acid (ISO) cadmium atom (EXP,ISO) cadmium dichloride (EXP,ISO) calcitriol (ISO) calycosin (ISO) capsaicin (EXP) captan (ISO) carbon nanotube (ISO) ceric oxide (ISO) cerium trichloride (ISO) chloramine T (EXP) chlordecone (ISO) chloropicrin (ISO) chromium(6+) (ISO) cisplatin (EXP,ISO) clobetasol (ISO) clozapine (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) CU-O LINKAGE (ISO) cumene hydroperoxide (ISO) Cuprizon (ISO) cylindrospermopsin (ISO) D-glucose (EXP,ISO) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dibenzo[a,l]pyrene (ISO) dicrotophos (ISO) diethyl maleate (EXP,ISO) dihydroartemisinin (ISO) dioscin (ISO) dioxygen (EXP) dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO) diquat (ISO) disodium selenite (ISO) disulfiram (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (EXP,ISO) endosulfan (EXP) enzyme inhibitor (ISO) ethanol (EXP,ISO) ethoxyquin (ISO) etoposide (ISO) fenthion (ISO) finasteride (EXP) fipronil (EXP) flavonoids (EXP) flutamide (EXP) folic acid (ISO) folpet (ISO) frenolicin B (ISO) furan (EXP) furfural (ISO) Gastrodin (EXP,ISO) genistein (ISO) gentamycin (EXP) geraniol (EXP) glucose (EXP,ISO) glutathione (ISO) gold atom (ISO) gold(0) (ISO) herbicide (ISO) hexadecanoic acid (ISO) hyaluronic acid (EXP) hydrogen peroxide (EXP,ISO) hydroquinone (ISO) hypochlorous acid (ISO) indole-3-methanol (ISO) inulin (ISO) isoprenaline (EXP) ivermectin (ISO) kojic acid (EXP) L-ascorbic acid (EXP) lanthanum trichloride (ISO) lead diacetate (EXP,ISO) lead(0) (ISO) lipopolysaccharide (ISO) lycopene (ISO) maneb (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) menadione (ISO) mercury dibromide (ISO) metam (ISO) methidathion (ISO) methimazole (EXP) methotrexate (ISO) methylmercury chloride (ISO) N,N-diethyl-m-toluamide (EXP) N-acetyl-L-cysteine (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-methyl-4-phenylpyridinium (EXP,ISO) N-nitrosodiethylamine (EXP) N-nitrosomorpholine (EXP) naphthalene (ISO) NCX-4040 (ISO) nefazodone (EXP) nickel atom (ISO) nimesulide (EXP) Nonylphenol (ISO) obeticholic acid (ISO) oleanolic acid (ISO) ozone (ISO) p-chloromercuribenzoic acid (ISO) p-menthan-3-ol (ISO) paracetamol (ISO) paraquat (EXP,ISO) pentachlorophenol (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) permethrin (EXP) phenobarbital (EXP) phenylmercury acetate (ISO) phlorizin (ISO) picloram (ISO) picoxystrobin (ISO) potassium dichromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) procymidone (EXP) Propiverine (EXP) Pyridostigmine bromide (EXP) pyrogallol (ISO) quartz (ISO) quercetin (ISO) rac-lactic acid (ISO) reactive oxygen species (ISO) resveratrol (ISO) rotenone (ISO) rottlerin (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO) SB 203580 (ISO) SB 431542 (ISO) silicon dioxide (ISO) Siomycin A (ISO) sodium arsenate (EXP,ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium dichromate (EXP,ISO) sodium fluoride (ISO) staurosporine (ISO) streptozocin (ISO) styrene (EXP) sulfadimethoxine (EXP) sulfasalazine (EXP,ISO) sulforaphane (ISO) sulindac (EXP) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP,ISO) thapsigargin (ISO) titanium dioxide (ISO) Tomentosin (ISO) Tributyltin oxide (ISO) trichlopyr (ISO) trichloroethene (ISO) trichostatin A (ISO) triclosan (ISO) triphenylstannane (ISO) triptonide (ISO) troglitazone (ISO) tungsten (ISO) tunicamycin (ISO) ursodeoxycholic acid (ISO) valproic acid (ISO) venlafaxine hydrochloride (EXP) vinclozolin (EXP) vorinostat (ISO) zinc atom (ISO) zinc pyrithione (ISO) zinc(0) (ISO)
1.
In-depth identification of pathways related to cisplatin-induced hepatotoxicity through an integrative method based on an informatics-assisted label-free protein quantitation and microarray gene expression approach.
Cho YE, etal., Mol Cell Proteomics. 2012 Jan;11(1):M111.010884. doi: 10.1074/mcp.M111.010884. Epub 2011 Oct 24.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Crystal structure of a multifunctional 2-Cys peroxiredoxin heme-binding protein 23 kDa/proliferation-associated gene product.
Hirotsu S, etal., Proc Natl Acad Sci U S A. 1999 Oct 26;96(22):12333-8.
5.
Expression of the mRNA of heme-binding protein 23 is coordinated with that of heme oxygenase-1 by heme and heavy metals in primary rat hepatocytes and hepatoma cells.
Immenschuh S, etal., Biochemistry 1995 Oct 17;34(41):13407-11.
6.
Differential cellular and subcellular localization of heme-binding protein 23/peroxiredoxin I and heme oxygenase-1 in rat liver.
Immenschuh S, etal., J Histochem Cytochem. 2003 Dec;51(12):1621-31.
7.
Inhibition of the thiol-specific antioxidant activity of rat liver MSP23 protein by hemin.
Ishii T, etal., Biochem Biophys Res Commun. 1995 Nov 22;216(3):970-5.
8.
Purification, characterization, and cloning of a heme-binding protein (23 kDa) in rat liver cytosol.
Iwahara S, etal., Biochemistry 1995 Oct 17;34(41):13398-406.
9.
Rat lung peroxiredoxins I and II are differentially regulated during development and by hyperoxia.
Kim HS, etal., Am J Physiol Lung Cell Mol Physiol. 2001 Jun;280(6):L1212-7.
10.
Analysis of peroxiredoxin decreasing oxidative stress in hypertensive aortic smooth muscle.
Lee CK, etal., Biochim Biophys Acta. 2007 Jul;1774(7):848-55. Epub 2007 May 10.
11.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
12.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.
GOA pipeline
RGD automated data pipeline
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Cold acclimation reduces hepatic protein Kinase B and AMP-activated protein kinase phosphorylation and increases gluconeogenesis in Rats.
Sepa-Kishi DM, etal., Physiol Rep. 2018 Mar;6(5). doi: 10.14814/phy2.13592.
16.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Prdx1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 135,383,906 - 135,399,504 (+) NCBI GRCr8 GRCr8 Ensembl 5 135,383,906 - 135,399,504 (+) Ensembl GRCr8 Ensembl mRatBN7.2 5 130,147,258 - 130,162,856 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 130,147,204 - 130,162,856 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 132,772,005 - 132,788,840 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 134,526,605 - 134,543,441 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 134,549,011 - 134,565,848 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 135,536,413 - 135,551,986 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 135,536,413 - 135,551,990 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 139,332,556 - 139,348,210 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 136,975,780 - 136,991,630 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 128,674,439 - 128,690,018 (+) NCBI Celera RGSC_v3.1 5 136,981,005 - 136,996,856 (+) NCBI Cytogenetic Map 5 q35 NCBI
PRDX1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 45,511,051 - 45,522,890 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 45,510,914 - 45,542,732 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 45,976,723 - 45,988,562 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 45,749,294 - 45,760,196 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 45,645,800 - 45,656,702 NCBI Celera 1 44,260,797 - 44,271,582 (-) NCBI Celera Cytogenetic Map 1 p34.1 NCBI HuRef 1 44,088,373 - 44,099,940 (-) NCBI HuRef CHM1_1 1 46,093,972 - 46,105,688 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 45,383,419 - 45,395,258 (-) NCBI T2T-CHM13v2.0
Prdx1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 116,542,796 - 116,557,196 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 116,542,741 - 116,558,019 (+) Ensembl GRCm39 Ensembl GRCm38 4 116,685,599 - 116,700,000 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 116,685,544 - 116,700,822 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 116,358,204 - 116,372,605 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 116,183,531 - 116,197,932 (+) NCBI MGSCv36 mm8 Celera 4 115,419,593 - 115,433,994 (+) NCBI Celera Cytogenetic Map 4 D1 NCBI cM Map 4 53.28 NCBI
Prdx1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955464 12,761,401 - 12,773,146 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955464 12,761,390 - 12,773,413 (+) NCBI ChiLan1.0 ChiLan1.0
PRDX1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 181,286,968 - 181,297,925 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 180,428,500 - 180,439,413 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 44,813,508 - 44,824,430 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 46,171,453 - 46,182,018 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 46,171,453 - 46,182,018 (-) Ensembl panpan1.1 panPan2
PRDX1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 14,834,009 - 14,855,665 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 14,838,652 - 14,862,971 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 14,959,792 - 14,976,803 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 14,988,879 - 15,010,844 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 14,993,508 - 15,018,355 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 14,790,828 - 14,808,277 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 14,858,579 - 14,875,829 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 14,930,831 - 14,947,857 (+) NCBI UU_Cfam_GSD_1.0
Prdx1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 60,816,994 - 60,828,561 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 26,639,259 - 26,653,328 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 26,641,776 - 26,653,291 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRDX1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 165,824,395 - 165,861,442 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 165,847,390 - 165,859,918 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 153,253,841 - 153,265,947 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRDX1 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 87,267,026 - 87,277,634 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 87,267,044 - 87,279,978 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 29,683,931 - 29,694,719 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prdx1 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 164 Count of miRNA genes: 120 Interacting mature miRNAs: 130 Transcripts: ENSRNOT00000023132 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 1300122 Wbc1 White blood cell count QTL 1 2.75 leukocyte quantity (VT:0000217) total white blood cell count (CMO:0000365) 5 125392826 139989768 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 7411582 Foco3 Food consumption QTL 3 7.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 7411564 Bw135 Body weight QTL 135 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 87468046 132468046 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 7365049 Bp359 Blood pressure QTL 359 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128071929 134724733 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 1331803 Rf32 Renal function QTL 32 2.798 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 129132428 143070159 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 1581505 Rf54 Renal function QTL 54 kidney physiology trait (VT:0002136) kidney 20-HETE level (CMO:0001854) 5 128033842 133011550 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 7411601 Foco12 Food consumption QTL 12 19.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 7394710 Emca12 Estrogen-induced mammary cancer QTL 12 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 124160767 133749643 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 6903316 Bw113 Body weight QTL 113 2 0.0103 body mass (VT:0001259) body weight (CMO:0000012) 5 87765973 132765973 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
RH127925
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 5 q36 UniSTS
Prdx1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 193,602,573 - 193,602,643 (+) MAPPER mRatBN7.2 mRatBN7.2 5 130,154,646 - 130,156,228 (+) MAPPER mRatBN7.2 mRatBN7.2 5 130,156,177 - 130,156,228 (+) MAPPER mRatBN7.2 Rnor_6.0 2 208,738,546 - 208,738,615 NCBI Rnor6.0 Rnor_6.0 5 135,543,785 - 135,545,366 NCBI Rnor6.0 Rnor_5.0 2 228,162,502 - 228,162,571 UniSTS Rnor5.0 Rnor_5.0 5 139,340,009 - 139,341,590 UniSTS Rnor5.0 RGSC_v3.4 5 136,983,429 - 136,985,010 UniSTS RGSC3.4 RGSC_v3.4 2 201,373,781 - 201,373,850 UniSTS RGSC3.4 Celera 2 186,293,818 - 186,293,887 UniSTS Celera 5 128,681,817 - 128,683,398 UniSTS Cytogenetic Map 2 q34 UniSTS Cytogenetic Map 5 q36 UniSTS
UniSTS:470676
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 193,602,443 - 193,602,900 (+) MAPPER mRatBN7.2 mRatBN7.2 6 47,072,314 - 47,072,784 (+) MAPPER mRatBN7.2 Rnor_6.0 6 49,393,315 - 49,393,784 NCBI Rnor6.0 Rnor_6.0 2 208,738,416 - 208,738,872 NCBI Rnor6.0 Rnor_5.0 6 58,073,558 - 58,074,027 UniSTS Rnor5.0 Rnor_5.0 2 228,162,372 - 228,162,828 UniSTS Rnor5.0 RGSC_v3.4 2 201,373,651 - 201,374,107 UniSTS RGSC3.4 RGSC_v3.4 6 48,332,780 - 48,333,249 UniSTS RGSC3.4 Celera 6 46,276,343 - 46,276,812 UniSTS Celera 2 186,293,688 - 186,294,144 UniSTS Cytogenetic Map 2 q34 UniSTS Cytogenetic Map 6 q16 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000023132 ⟹ ENSRNOP00000023132
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 Ensembl 5 135,383,906 - 135,399,504 (+) Ensembl mRatBN7.2 Ensembl 5 130,147,204 - 130,162,856 (+) Ensembl Rnor_6.0 Ensembl 5 135,536,413 - 135,551,990 (+) Ensembl
RefSeq Acc Id:
NM_057114 ⟹ NP_476455
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 135,383,906 - 135,399,504 (+) NCBI mRatBN7.2 5 130,147,258 - 130,162,856 (+) NCBI Rnor_6.0 5 135,536,413 - 135,551,986 (+) NCBI Rnor_5.0 5 139,332,556 - 139,348,210 (+) NCBI RGSC_v3.4 5 136,975,780 - 136,991,630 (+) RGD Celera 5 128,674,439 - 128,690,018 (+) RGD
Sequence:
GGCTCACGGTTGGTTCTGTTTGTGAGACCTGTAGCTCGACTCTGCTGATAGCAAGATGTCTTCAGGAAATGCAAAAATTGGGCATCCTGCTCCCAGCTTCAAAGCCACGGCTGTTATGCCGGATGGAC AATTCAAAGATATCAGCCTAAGTGATTACAAAGGAAAATATGTTGTATTCTTTTTTTACCCTCTTGACTTTACTTTTGTGTGTCCCACGGAGATCATTGCTTTCAGTGATAGAGCAGAAGAATTTAAG AAACTCAACTGCCAAGTGATTGGAGCTTCTGTGGATTCTCACTTCTGTCATCTGGCATGGATTAACACACCCAAGAAACAAGGAGGATTGGGACCCATGAACATTCCCTTGGTATCAGATCCCAAGCG CACCATTGCTCAGGATTATGGAGTCTTAAAAGCTGATGAAGGTATCTCTTTCAGGGGCCTCTTTATTATTGATGATAAAGGTATCCTTCGCCAGATAACAATAAATGATCTTCCTGTTGGCCGCTCTG TGGATGAGATTCTGAGACTAGTCCAGGCCTTCCAGTTCACTGACAAACATGGTGAAGTGTGCCCAGCTGGCTGGAAACCTGGCAGTGATACCATCAAGCCTGATGTCAATAAGAGTAAAGAGTATTTC TCTAAGCAGAAGTGAGCACTGGACCAGTTTTCTGGCAGACAGCTTTGAGCAGCCAGAAGAAATTTGTACTCTACACATGACGTGGTGTGATTCCAGATAAGCCTTTCCTACAAGGGCTAGGGGTGGTT AGCCTTTCTTCCACTATTGGTAAGGGGCAGACCATCTTATATCAGTCACAGAAACCAACCTGTTAATTCTCTCTCTCTCTTTTTTTTTTTTAAGTATCTATTAAACGTGAATTC
hide sequence
RefSeq Acc Id:
NP_476455 ⟸ NM_057114
- UniProtKB:
Q63716 (UniProtKB/Swiss-Prot), A6JZ89 (UniProtKB/TrEMBL)
- Sequence:
MSSGNAKIGHPAPSFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFR GLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQK
hide sequence
Ensembl Acc Id:
ENSRNOP00000023132 ⟸ ENSRNOT00000023132
RGD ID: 13693938
Promoter ID: EPDNEW_R4463
Type: multiple initiation site
Name: Prdx1_1
Description: peroxiredoxin 1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 135,536,393 - 135,536,453 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Prdx1
peroxiredoxin 1
Symbol and Name status set to approved
1299863
APPROVED
2002-08-07
Prdx1
peroxiredoxin 1
Symbol and Name status set to provisional
70820
PROVISIONAL
Note Type
Note
Reference
gene_regulation
mRNA expression is induced by heavy metals CdCl2 and CoCl2
729465