Symbol:
Stambp
Name:
Stam binding protein
RGD ID:
619963
Description:
Predicted to enable K63-linked deubiquitinase activity and protein domain specific binding activity. Predicted to be involved in negative regulation of Ras protein signal transduction and negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction. Predicted to act upstream of or within mitotic cytokinesis; negative regulation of hippocampal neuron apoptotic process; and protein deubiquitination. Predicted to be located in cytosol; nucleoplasm; and plasma membrane. Predicted to be active in cleavage furrow and endosome. Orthologous to human STAMBP (STAM binding protein); PARTICIPATES IN Bone morphogenetic proteins signaling pathway; endocytosis pathway; INTERACTS WITH 1,3-dinitrobenzene; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Amsh; associated molecule with the SH3 domain of STAM; STAM-binding protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
STAMBP (STAM binding protein) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Stambp (STAM binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Stambp (STAM binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
STAMBP (STAM binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
STAMBP (STAM binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Stambp (STAM binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
STAMBP (STAM binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
STAMBP (STAM binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Stambp (STAM binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
DBNDD1 (dysbindin domain containing 1) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Stambp (STAM binding protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
STAMBP (STAM binding protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
stambpa (STAM binding protein a)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
stambpb (STAM binding protein b)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG2224
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
stambp
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 117,613,730 - 117,642,163 (-) NCBI GRCr8 mRatBN7.2 4 116,055,563 - 116,083,563 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 116,056,057 - 116,080,543 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 121,534,816 - 121,559,301 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 117,309,987 - 117,334,471 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 115,923,556 - 115,948,037 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 115,249,343 - 115,277,340 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 115,249,351 - 115,275,068 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 179,839,851 - 179,867,468 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 117,766,905 - 117,791,399 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 118,011,387 - 118,035,880 (-) NCBI Celera 4 105,049,309 - 105,073,789 (-) NCBI Celera Cytogenetic Map 4 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Stambp Rat 1,2-dimethylhydrazine decreases expression ISO Stambp (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of STAMBP mRNA CTD PMID:22206623 Stambp Rat 1,3-dinitrobenzene decreases expression EXP 6480464 3-dinitrobenzene results in decreased expression of STAMBP mRNA CTD PMID:21983209 Stambp Rat 17alpha-ethynylestradiol increases expression ISO Stambp (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of STAMBP mRNA CTD PMID:17942748 Stambp Rat 17alpha-ethynylestradiol multiple interactions ISO Stambp (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of STAMBP mRNA CTD PMID:17942748 Stambp Rat 17alpha-ethynylestradiol affects expression ISO Stambp (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of STAMBP mRNA CTD PMID:17555576 Stambp Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Stambp (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of STAMBP mRNA CTD PMID:17942748 Stambp Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of STAMBP mRNA CTD PMID:32109520 and PMID:33387578 Stambp Rat 2-hydroxypropanoic acid decreases expression ISO STAMBP (Homo sapiens) 6480464 Lactic Acid results in decreased expression of STAMBP mRNA CTD PMID:30851411 Stambp Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of STAMBP protein CTD PMID:34915118 Stambp Rat 4,4'-diaminodiphenylmethane decreases expression ISO Stambp (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of STAMBP mRNA CTD PMID:18648102 Stambp Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of STAMBP mRNA CTD PMID:36041667 Stambp Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of STAMBP mRNA CTD PMID:24780913 Stambp Rat acetylsalicylic acid increases expression ISO STAMBP (Homo sapiens) 6480464 Aspirin results in increased expression of STAMBP mRNA CTD PMID:15928584 Stambp Rat acrolein multiple interactions ISO STAMBP (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased oxidation of STAMBP mRNA CTD PMID:32845096 Stambp Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of STAMBP mRNA CTD PMID:28959563 Stambp Rat aflatoxin B1 increases expression ISO STAMBP (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of STAMBP mRNA CTD PMID:22100608 Stambp Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of STAMBP mRNA CTD PMID:30047161 Stambp Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of STAMBP mRNA CTD PMID:16483693 Stambp Rat arsenite(3-) multiple interactions ISO STAMBP (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to STAMBP mRNA] CTD PMID:32406909 Stambp Rat beta-lapachone increases expression ISO STAMBP (Homo sapiens) 6480464 beta-lapachone results in increased expression of STAMBP mRNA CTD PMID:38218311 Stambp Rat bis(2-ethylhexyl) phthalate increases expression ISO Stambp (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of STAMBP mRNA CTD PMID:34319233 Stambp Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of STAMBP mRNA CTD PMID:25181051 Stambp Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of STAMBP mRNA CTD PMID:36041667 Stambp Rat bisphenol A decreases expression ISO STAMBP (Homo sapiens) 6480464 bisphenol A results in decreased expression of STAMBP protein CTD PMID:33376534 Stambp Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of STAMBP gene CTD PMID:28505145 Stambp Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of STAMBP mRNA CTD PMID:36041667 Stambp Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of STAMBP mRNA CTD PMID:33453195 Stambp Rat CGP 52608 multiple interactions ISO STAMBP (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to STAMBP gene] CTD PMID:28238834 Stambp Rat chlorpyrifos increases expression ISO Stambp (Mus musculus) 6480464 Chlorpyrifos results in increased expression of STAMBP mRNA CTD PMID:37019170 Stambp Rat cyclosporin A increases expression ISO STAMBP (Homo sapiens) 6480464 Cyclosporine results in increased expression of STAMBP mRNA CTD PMID:25562108 Stambp Rat dibutyl phthalate decreases expression ISO Stambp (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of STAMBP mRNA CTD PMID:17361019 Stambp Rat diethylstilbestrol decreases expression ISO STAMBP (Homo sapiens) 6480464 Diethylstilbestrol results in decreased expression of STAMBP mRNA CTD PMID:36621641 Stambp Rat dorsomorphin multiple interactions ISO STAMBP (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of STAMBP mRNA CTD PMID:27188386 Stambp Rat fenthion decreases expression ISO Stambp (Mus musculus) 6480464 Fenthion results in decreased expression of STAMBP mRNA CTD PMID:34813904 Stambp Rat FR900359 increases phosphorylation ISO STAMBP (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of STAMBP protein CTD PMID:37730182 Stambp Rat isotretinoin decreases expression ISO STAMBP (Homo sapiens) 6480464 Isotretinoin results in decreased expression of STAMBP mRNA CTD PMID:20436886 Stambp Rat ivermectin decreases expression ISO STAMBP (Homo sapiens) 6480464 Ivermectin results in decreased expression of STAMBP protein CTD PMID:32959892 Stambp Rat methidathion decreases expression ISO Stambp (Mus musculus) 6480464 methidathion results in decreased expression of STAMBP mRNA CTD PMID:34813904 Stambp Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of STAMBP mRNA CTD PMID:30047161 Stambp Rat methyl methanesulfonate increases expression ISO STAMBP (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of STAMBP mRNA CTD PMID:23649840 Stambp Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of STAMBP mRNA CTD PMID:26720608 Stambp Rat ozone multiple interactions ISO STAMBP (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased oxidation of STAMBP mRNA CTD PMID:32845096 Stambp Rat p-chloromercuribenzoic acid decreases expression ISO STAMBP (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of STAMBP mRNA CTD PMID:26272509 Stambp Rat p-chloromercuribenzoic acid multiple interactions ISO STAMBP (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of STAMBP mRNA CTD PMID:27188386 Stambp Rat PF-3758309 decreases expression ISO STAMBP (Homo sapiens) 6480464 PF 3758309 results in decreased expression of STAMBP mRNA CTD PMID:29048629 Stambp Rat phenobarbital increases expression ISO Stambp (Mus musculus) 6480464 Phenobarbital results in increased expression of STAMBP mRNA CTD PMID:19270015 Stambp Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of STAMBP mRNA CTD PMID:30047161 Stambp Rat rac-lactic acid decreases expression ISO STAMBP (Homo sapiens) 6480464 Lactic Acid results in decreased expression of STAMBP mRNA CTD PMID:30851411 Stambp Rat SB 431542 multiple interactions ISO STAMBP (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of STAMBP mRNA CTD PMID:27188386 Stambp Rat serpentine asbestos increases expression ISO STAMBP (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of STAMBP mRNA CTD PMID:21148743 Stambp Rat silicon dioxide decreases expression ISO Stambp (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of STAMBP mRNA CTD PMID:19073995 Stambp Rat sodium arsenite decreases expression ISO STAMBP (Homo sapiens) 6480464 sodium arsenite results in decreased expression of STAMBP protein CTD PMID:30528433 Stambp Rat sodium fluoride decreases expression ISO Stambp (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of STAMBP protein CTD PMID:28918527 Stambp Rat sodium fluoride increases expression ISO Stambp (Mus musculus) 6480464 Sodium Fluoride results in increased expression of STAMBP mRNA CTD PMID:27862939 Stambp Rat tamoxifen affects expression ISO Stambp (Mus musculus) 6480464 Tamoxifen affects the expression of STAMBP mRNA CTD PMID:17555576 Stambp Rat triphenyl phosphate affects expression ISO STAMBP (Homo sapiens) 6480464 triphenyl phosphate affects the expression of STAMBP mRNA CTD PMID:37042841 Stambp Rat valproic acid decreases methylation ISO STAMBP (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of STAMBP gene CTD PMID:29154799 Stambp Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of STAMBP mRNA CTD PMID:23034163
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 1,3-dinitrobenzene (EXP) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP) 6-propyl-2-thiouracil (EXP) acetylsalicylic acid (ISO) acrolein (ISO) acrylamide (EXP) aflatoxin B1 (ISO) amitrole (EXP) ammonium chloride (EXP) arsenite(3-) (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) cadmium dichloride (EXP) CGP 52608 (ISO) chlorpyrifos (ISO) cyclosporin A (ISO) dibutyl phthalate (ISO) diethylstilbestrol (ISO) dorsomorphin (ISO) fenthion (ISO) FR900359 (ISO) isotretinoin (ISO) ivermectin (ISO) methidathion (ISO) methimazole (EXP) methyl methanesulfonate (ISO) nitrofen (EXP) ozone (ISO) p-chloromercuribenzoic acid (ISO) PF-3758309 (ISO) phenobarbital (EXP,ISO) rac-lactic acid (ISO) SB 431542 (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium fluoride (ISO) tamoxifen (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vinclozolin (EXP)
Stambp Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 117,613,730 - 117,642,163 (-) NCBI GRCr8 mRatBN7.2 4 116,055,563 - 116,083,563 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 116,056,057 - 116,080,543 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 121,534,816 - 121,559,301 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 117,309,987 - 117,334,471 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 115,923,556 - 115,948,037 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 115,249,343 - 115,277,340 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 115,249,351 - 115,275,068 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 179,839,851 - 179,867,468 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 117,766,905 - 117,791,399 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 118,011,387 - 118,035,880 (-) NCBI Celera 4 105,049,309 - 105,073,789 (-) NCBI Celera Cytogenetic Map 4 q34 NCBI
STAMBP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 73,828,961 - 73,873,656 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 73,828,916 - 73,873,659 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 74,056,088 - 74,100,783 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 73,909,594 - 73,943,519 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 2 73,887,352 - 73,921,265 (+) NCBI Celera Cytogenetic Map 2 p13.1 NCBI HuRef 2 73,791,345 - 73,829,114 (+) NCBI HuRef CHM1_1 2 73,985,403 - 74,023,636 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 73,837,148 - 73,881,820 (+) NCBI T2T-CHM13v2.0
Stambp Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 83,520,188 - 83,552,781 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 83,520,193 - 83,549,711 (-) Ensembl GRCm39 Ensembl GRCm38 6 83,543,206 - 83,575,826 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 83,543,211 - 83,572,729 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 83,493,200 - 83,522,498 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 83,508,864 - 83,538,093 (-) NCBI MGSCv36 mm8 Celera 6 85,524,336 - 85,552,555 (-) NCBI Celera Cytogenetic Map 6 C3 NCBI cM Map 6 35.94 NCBI
Stambp Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955424 11,831,361 - 11,879,577 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955424 11,831,910 - 11,879,577 (-) NCBI ChiLan1.0 ChiLan1.0
STAMBP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 52,521,347 - 52,557,736 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 52,524,101 - 52,570,824 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 73,900,128 - 73,936,571 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 75,410,352 - 75,451,082 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 75,410,434 - 75,451,086 (+) Ensembl panpan1.1 panPan2
STAMBP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 49,194,810 - 49,221,017 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 49,195,101 - 49,221,013 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 48,838,657 - 48,864,889 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 50,056,958 - 50,083,265 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 50,056,958 - 50,083,190 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 49,073,147 - 49,099,470 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 49,140,501 - 49,166,821 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 49,699,497 - 49,725,831 (-) NCBI UU_Cfam_GSD_1.0
Stambp
STAMBP Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 69,133,978 - 69,188,192 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 69,156,012 - 69,188,256 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 72,359,731 - 72,389,751 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
STAMBP Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 33,417,342 - 33,453,507 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 33,416,821 - 33,451,593 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 78,714,497 - 78,750,436 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Stambp
.
Predicted Target Of
Count of predictions: 38 Count of miRNA genes: 36 Interacting mature miRNAs: 38 Transcripts: ENSRNOT00000014708 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582232 Gluco25 Glucose level QTL 25 3.6 0.0023 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 85253748 148090731 Rat 631689 Scl4 Serum cholesterol level QTL 4 1.9 0.008 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 95174120 140174120 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1578655 Bmd11 Bone mineral density QTL 11 11 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 4 90850165 135850165 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1357342 Bw40 Body weight QTL 40 0.001 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 631556 Bp135 Blood pressure QTL 135 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 78881294 117676292 Rat 61330 Eau1 Experimental allergic uveoretinitis QTL 1 0.0003 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 4 70362013 132642728 Rat 70167 Bw22 Body weight QTL 22 3.1 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 731165 Uae21 Urinary albumin excretion QTL 21 2.4 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 106649412 151649412 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 724522 Bp146 Blood pressure QTL 146 2.2 0.0021 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 73630210 118630210 Rat 61476 Aia3 Adjuvant induced arthritis QTL 3 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 86730991 131730991 Rat 1641919 Alc22 Alcohol consumption QTL 22 0.0005 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 81192555 126192555 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 1578670 Bss14 Bone structure and strength QTL 14 16.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 4 87327165 132327165 Rat 1300139 Hrtrt6 Heart rate QTL 6 2.85 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 39524264 116179656 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 1578662 Bss15 Bone structure and strength QTL 15 19.6 femur width (VT:1000666) femoral neck width (CMO:0001695) 4 87327165 132327165 Rat 2302051 Pia28 Pristane induced arthritis QTL 28 5.3 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 73630210 118630210 Rat 2302049 Pia32 Pristane induced arthritis QTL 32 5.1 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 105789505 150789505 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 738015 Pia9 Pristane induced arthritis QTL 9 4.5 0.048 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 80694870 125694870 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 631646 Stl4 Serum triglyceride level QTL 4 6.5 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 4 73169846 132642728 Rat 634334 Xhs3 X-ray hypersensitivity QTL 3 10 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 84728680 129854654 Rat 61406 Scwia1 Streptococcal cell wall induced arthritis QTL 1 2.3 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 4 106805662 151805662 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 631662 Hcar2 Hepatocarcinoma resistance QTL 2 3.1 0.0003 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 78878504 123878504 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 61418 Pia5 Pristane induced arthritis QTL 5 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 62277855 128289560 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 2306899 Bp338 Blood pressure QTL 338 0.071 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 81006124 120102625 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 61434 Cia3 Collagen induced arthritis QTL 3 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 103194656 148194656 Rat
AW107289
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 116,055,715 - 116,055,833 (+) MAPPER mRatBN7.2 Rnor_6.0 4 115,249,005 - 115,249,122 NCBI Rnor6.0 Rnor_5.0 4 179,839,513 - 179,839,630 UniSTS Rnor5.0 RGSC_v3.4 4 117,766,567 - 117,766,684 UniSTS RGSC3.4 Celera 4 105,048,971 - 105,049,088 UniSTS Cytogenetic Map 4 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014708 ⟹ ENSRNOP00000014708
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 116,056,057 - 116,080,543 (-) Ensembl Rnor_6.0 Ensembl 4 115,249,351 - 115,273,836 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000086968 ⟹ ENSRNOP00000069824
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 4 115,249,352 - 115,275,068 (-) Ensembl
RefSeq Acc Id:
NM_138531 ⟹ NP_612540
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 117,613,730 - 117,638,220 (-) NCBI mRatBN7.2 4 116,056,054 - 116,080,548 (-) NCBI Rnor_6.0 4 115,249,343 - 115,273,836 (-) NCBI Rnor_5.0 4 179,839,851 - 179,867,468 (-) NCBI RGSC_v3.4 4 117,766,905 - 117,791,399 (-) RGD Celera 4 105,049,309 - 105,073,789 (-) RGD
Sequence:
GTGACGTTTCCGGAAGCTCCGACTGTCATCCTTCAGGAAAGGTCAGAAGAGGGCACCAGACCTGATTATAGATGGTTGTGAGCCACCATGTGGTTGCTGGGAATTGAACTCAGGACCTCTGGAAGAGC
hide sequence
RefSeq Acc Id:
XM_006236726 ⟹ XP_006236788
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 117,613,730 - 117,642,163 (-) NCBI mRatBN7.2 4 116,055,563 - 116,083,563 (-) NCBI Rnor_6.0 4 115,249,346 - 115,277,340 (-) NCBI Rnor_5.0 4 179,839,851 - 179,867,468 (-) NCBI
Sequence:
TCAACTTGACACACAAAACCAGACAGTACAATAATTAAGTGCGTACAGTTAAGACAAGGCAGTATCTTTGTTGTTGCTCTTGTTGTTTTAGGCTGCTAAATATGAACTGTGTATAAATGCCTTTGTGA
hide sequence
RefSeq Acc Id:
XM_006236727 ⟹ XP_006236789
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 117,613,730 - 117,642,163 (-) NCBI mRatBN7.2 4 116,055,563 - 116,083,563 (-) NCBI Rnor_6.0 4 115,249,346 - 115,277,340 (-) NCBI Rnor_5.0 4 179,839,851 - 179,867,468 (-) NCBI
Sequence:
TCAACTTGACACACAAAACCAGACAGTACAATAATTAAGTGCGTACAGTTAAGACAAGGCAGTATCTTTGTTGTTGCTCTTGTTGTTTTAGGCTGCTAAATATGAACTGTGTATAAATGCCTTTGTGA
hide sequence
RefSeq Acc Id:
XM_039106986 ⟹ XP_038962914
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 117,613,730 - 117,642,163 (-) NCBI mRatBN7.2 4 116,055,563 - 116,083,563 (-) NCBI
RefSeq Acc Id:
XM_039106987 ⟹ XP_038962915
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 117,613,730 - 117,642,163 (-) NCBI mRatBN7.2 4 116,055,563 - 116,080,468 (-) NCBI
RefSeq Acc Id:
XM_063285460 ⟹ XP_063141530
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 117,613,730 - 117,641,244 (-) NCBI
RefSeq Acc Id:
NP_612540 ⟸ NM_138531
- UniProtKB:
Q8R424 (UniProtKB/Swiss-Prot), A6IAN4 (UniProtKB/TrEMBL), A6IAN6 (UniProtKB/TrEMBL)
- Sequence:
MSDHADVSLPPQDRVRILSQLGSAVELNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAIIPEKKDAVKKLKNVAFPKAEELKTELLKRYTKEYEQYKERKKKE
hide sequence
RefSeq Acc Id:
XP_006236788 ⟸ XM_006236726
- Peptide Label:
isoform X1
- UniProtKB:
Q8R424 (UniProtKB/Swiss-Prot), A6IAN4 (UniProtKB/TrEMBL), A6IAN6 (UniProtKB/TrEMBL)
- Sequence:
MSDHADVSLPPQDRVRILSQLGSAVELNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYN
hide sequence
RefSeq Acc Id:
XP_006236789 ⟸ XM_006236727
- Peptide Label:
isoform X1
- UniProtKB:
Q8R424 (UniProtKB/Swiss-Prot), A6IAN4 (UniProtKB/TrEMBL), A6IAN6 (UniProtKB/TrEMBL)
- Sequence:
MSDHADVSLPPQDRVRILSQLGSAVELNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAIIPEKKDAVKKLKNVAFPKAEELKTELLKRYTKEYEQYKERKKKE
hide sequence
Ensembl Acc Id:
ENSRNOP00000014708 ⟸ ENSRNOT00000014708
Ensembl Acc Id:
ENSRNOP00000069824 ⟸ ENSRNOT00000086968
RefSeq Acc Id:
XP_038962914 ⟸ XM_039106986
- Peptide Label:
isoform X1
- UniProtKB:
Q8R424 (UniProtKB/Swiss-Prot), A6IAN4 (UniProtKB/TrEMBL), A6IAN6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038962915 ⟸ XM_039106987
- Peptide Label:
isoform X1
- UniProtKB:
Q8R424 (UniProtKB/Swiss-Prot), A6IAN4 (UniProtKB/TrEMBL), A6IAN6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063141530 ⟸ XM_063285460
- Peptide Label:
isoform X1
- UniProtKB:
Q8R424 (UniProtKB/Swiss-Prot), A6IAN4 (UniProtKB/TrEMBL), A6IAN6 (UniProtKB/TrEMBL)
RGD ID: 13693182 Promoter ID: EPDNEW_R3706 Type: multiple initiation site Name: Stambp_1 Description: Stam binding protein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 115,273,843 - 115,273,903 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Stambp
Stam binding protein
associated molecule with the SH3 domain of STAM
Name updated
1299863 APPROVED
2004-09-10
Stambp
associated molecule with the SH3 domain of STAM
Amsh
Symbol and Name updated
1299863 APPROVED
2002-08-07
Amsh
associated molecule with the SH3 domain of STAM
Symbol and Name status set to provisional
70820 PROVISIONAL
