Symbol:
Mafg
Name:
MAF bZIP transcription factor G
RGD ID:
619953
Description:
Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and identical protein binding activity. Involved in regulation of cellular pH. Predicted to be part of RNA polymerase II transcription regulator complex. Predicted to be active in nucleus. Orthologous to human MAFG (MAF bZIP transcription factor G); PARTICIPATES IN nuclear factor, erythroid 2 like 2 signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
transcription factor MafG; v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog G; v-maf musculoaponeurotic fibrosarcoma (avian) oncogene family, protein G; v-maf musculoaponeurotic fibrosarcoma oncogene family, protein G; v-maf musculoaponeurotic fibrosarcoma oncogene family, protein G (avian); v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MAFG (MAF bZIP transcription factor G) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Mafg (v-maf musculoaponeurotic fibrosarcoma oncogene family, protein G (avian)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mafg (MAF bZIP transcription factor G) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MAFG (MAF bZIP transcription factor G) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MAFG (MAF bZIP transcription factor G) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mafg (MAF bZIP transcription factor G) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MAFG (MAF bZIP transcription factor G) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MAFG (MAF bZIP transcription factor G) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mafg (MAF bZIP transcription factor G) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
MAFK (MAF bZIP transcription factor K) HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
MAFG (MAF bZIP transcription factor G)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Mafg (v-maf musculoaponeurotic fibrosarcoma oncogene family, protein G (avian))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mafga (v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog Ga)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mafgb (v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog Gb)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
maf-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
maf-S
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mafg
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 106,401,633 - 106,410,159 (-) NCBI GRCr8 mRatBN7.2 10 105,903,307 - 105,911,808 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 105,903,237 - 105,912,026 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 111,007,074 - 111,015,576 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 110,470,111 - 110,478,613 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 105,823,759 - 105,832,258 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 109,802,877 - 109,811,476 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 109,806,159 - 109,811,323 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 109,395,929 - 109,404,465 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 110,019,741 - 110,024,927 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 110,034,252 - 110,039,431 (-) NCBI Celera 10 104,449,965 - 104,455,151 (-) NCBI Celera Cytogenetic Map 10 q32.3 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mafg Rat (-)-epigallocatechin 3-gallate multiple interactions ISO MAFG (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of MAFG mRNA CTD PMID:22079256 Mafg Rat (E)-cinnamyl alcohol increases expression ISO MAFG (Homo sapiens) 6480464 cinnamyl alcohol results in increased expression of MAFG mRNA CTD PMID:20566472 Mafg Rat 1,2-dimethylhydrazine increases expression ISO Mafg (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of MAFG mRNA CTD PMID:22206623 Mafg Rat 1-chloro-2,4-dinitrobenzene increases expression ISO MAFG (Homo sapiens) 6480464 Dinitrochlorobenzene results in increased expression of MAFG mRNA CTD PMID:20566472 Mafg Rat 17alpha-ethynylestradiol increases expression ISO Mafg (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of MAFG mRNA CTD PMID:17942748 Mafg Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of MAFG mRNA CTD PMID:29097150 Mafg Rat 17alpha-ethynylestradiol multiple interactions ISO Mafg (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MAFG mRNA CTD PMID:17942748 Mafg Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mafg (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MAFG mRNA CTD PMID:21570461 and PMID:24058054 Mafg Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MAFG mRNA CTD PMID:33387578 Mafg Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Mafg (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MAFG mRNA CTD PMID:37172768 Mafg Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MAFG mRNA CTD PMID:34747641 Mafg Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO MAFG (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of MAFG mRNA CTD PMID:26238291 Mafg Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Mafg (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MAFG mRNA CTD PMID:17942748 Mafg Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of MAFG mRNA CTD PMID:21346803 Mafg Rat 2-hydroxypropanoic acid increases expression ISO MAFG (Homo sapiens) 6480464 Lactic Acid results in increased expression of MAFG mRNA CTD PMID:20566472 Mafg Rat 2-tert-butylhydroquinone decreases expression ISO MAFG (Homo sapiens) 6480464 2-tert-butylhydroquinone results in decreased expression of MAFG mRNA CTD PMID:35724838 Mafg Rat 3,4-methylenedioxymethamphetamine affects expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine affects the expression of MAFG mRNA CTD PMID:30071829 Mafg Rat 4,4'-sulfonyldiphenol decreases expression ISO Mafg (Mus musculus) 6480464 bisphenol S results in decreased expression of MAFG mRNA CTD PMID:39298647 Mafg Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of MAFG mRNA CTD PMID:21346803 Mafg Rat 4-hydroxynon-2-enal increases expression ISO Mafg (Mus musculus) 6480464 4-hydroxy-2-nonenal results in increased expression of MAFG mRNA CTD PMID:19191707 Mafg Rat acrolein multiple interactions ISO MAFG (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of MAFG mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of MAFG mRNA CTD PMID:32699268 Mafg Rat acrolein affects expression EXP 6480464 Acrolein affects the expression of MAFG mRNA CTD PMID:38090360 Mafg Rat acrylamide increases expression ISO MAFG (Homo sapiens) 6480464 Acrylamide results in increased expression of MAFG mRNA CTD PMID:32763439 Mafg Rat all-trans-retinoic acid increases expression ISO MAFG (Homo sapiens) 6480464 Tretinoin results in increased expression of MAFG mRNA CTD PMID:23724009 Mafg Rat alpha-hexylcinnamaldehyde increases expression ISO MAFG (Homo sapiens) 6480464 hexyl cinnamic aldehyde results in increased expression of MAFG mRNA CTD PMID:20566472 Mafg Rat alpha-pinene multiple interactions ISO MAFG (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of MAFG mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of MAFG mRNA CTD PMID:32699268 Mafg Rat amiodarone increases expression ISO MAFG (Homo sapiens) 6480464 Amiodarone results in increased expression of MAFG mRNA CTD PMID:19774075 and PMID:36586010 Mafg Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MAFG mRNA CTD PMID:16483693 Mafg Rat andrographolide decreases expression ISO MAFG (Homo sapiens) 6480464 andrographolide results in decreased expression of MAFG mRNA CTD PMID:35724838 Mafg Rat aristolochic acid A increases expression ISO MAFG (Homo sapiens) 6480464 aristolochic acid I results in increased expression of MAFG mRNA CTD PMID:33212167 Mafg Rat arotinoid acid multiple interactions ISO MAFG (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:34480604 Mafg Rat azoxystrobin decreases expression ISO MAFG (Homo sapiens) 6480464 azoxystrobin results in decreased expression of MAFG mRNA CTD PMID:33512557 Mafg Rat Bandrowski's base increases expression ISO MAFG (Homo sapiens) 6480464 Bandrowski's base results in increased expression of MAFG mRNA CTD PMID:20566472 Mafg Rat Bardoxolone methyl affects expression ISO MAFG (Homo sapiens) 6480464 bardoxolone methyl affects the expression of MAFG mRNA CTD PMID:34480604 Mafg Rat Bardoxolone methyl decreases expression ISO MAFG (Homo sapiens) 6480464 bardoxolone methyl results in decreased expression of MAFG mRNA CTD PMID:35724838 Mafg Rat benzene decreases expression ISO MAFG (Homo sapiens) 6480464 Benzene results in decreased expression of MAFG mRNA CTD PMID:33064461 Mafg Rat benzo[a]pyrene increases expression ISO Mafg (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MAFG mRNA CTD PMID:21569818 and PMID:21715664 Mafg Rat benzo[a]pyrene increases methylation ISO MAFG (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of MAFG 3' UTR more ... CTD PMID:27901495 Mafg Rat benzo[a]pyrene increases expression ISO MAFG (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of MAFG mRNA CTD PMID:22316170 and PMID:26238291 Mafg Rat benzoic acid increases expression ISO MAFG (Homo sapiens) 6480464 Benzoic Acid results in increased expression of MAFG mRNA CTD PMID:20566472 Mafg Rat beta-naphthoflavone increases expression ISO MAFG (Homo sapiens) 6480464 beta-Naphthoflavone results in increased expression of MAFG mRNA CTD PMID:32151702 and PMID:32858204 Mafg Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MAFG mRNA CTD PMID:25181051 Mafg Rat bisphenol A decreases expression ISO Mafg (Mus musculus) 6480464 bisphenol A results in decreased expression of MAFG mRNA CTD PMID:32156529 Mafg Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MAFG mRNA CTD PMID:34947998 Mafg Rat bisphenol A decreases expression ISO MAFG (Homo sapiens) 6480464 bisphenol A results in decreased expression of MAFG protein CTD PMID:33376534 Mafg Rat bisphenol A multiple interactions ISO MAFG (Homo sapiens) 6480464 [[ginger extract results in increased abundance of Oils and Volatile] which co-treated with bisphenol A] affects the expression of MAFG protein CTD PMID:33376534 Mafg Rat bisphenol A affects expression ISO MAFG (Homo sapiens) 6480464 bisphenol A affects the expression of MAFG mRNA CTD PMID:30903817 Mafg Rat bisphenol A increases expression ISO MAFG (Homo sapiens) 6480464 bisphenol A results in increased expression of MAFG mRNA CTD PMID:29275510 Mafg Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of MAFG gene CTD PMID:28505145 Mafg Rat bisphenol A affects methylation ISO Mafg (Mus musculus) 6480464 bisphenol A affects the methylation of MAFG promoter CTD PMID:27334623 Mafg Rat bortezomib increases expression ISO MAFG (Homo sapiens) 6480464 Bortezomib results in increased expression of MAFG mRNA CTD PMID:20977926 Mafg Rat butan-1-ol multiple interactions ISO MAFG (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of MAFG mRNA CTD PMID:29432896 Mafg Rat cadmium atom multiple interactions ISO Mafg (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of MAFG mRNA CTD PMID:37325564 Mafg Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of MAFG mRNA CTD PMID:19010381 more ... Mafg Rat cadmium dichloride multiple interactions ISO Mafg (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of MAFG mRNA CTD PMID:37325564 Mafg Rat cadmium dichloride increases expression ISO MAFG (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of MAFG mRNA CTD PMID:11162468 more ... Mafg Rat cadmium sulfate increases expression ISO MAFG (Homo sapiens) 6480464 cadmium sulfate results in increased expression of MAFG mRNA CTD PMID:12064557 and PMID:21783983 Mafg Rat cannabidiol increases expression ISO MAFG (Homo sapiens) 6480464 Cannabidiol results in increased expression of MAFG mRNA CTD PMID:31518892 Mafg Rat CGP 52608 multiple interactions ISO MAFG (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to MAFG gene] CTD PMID:28238834 Mafg Rat chenodeoxycholic acid multiple interactions ISO MAFG (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA CTD PMID:32152650 Mafg Rat CHIR 99021 multiple interactions ISO MAFG (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:34480604 Mafg Rat chloroacetaldehyde increases expression ISO MAFG (Homo sapiens) 6480464 chloroacetaldehyde results in increased expression of MAFG mRNA CTD PMID:25596134 Mafg Rat chloroprene increases expression ISO Mafg (Mus musculus) 6480464 Chloroprene results in increased expression of MAFG mRNA CTD PMID:23125180 Mafg Rat chlorpyrifos decreases expression ISO Mafg (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of MAFG mRNA CTD PMID:37019170 Mafg Rat cinnamyl alcohol increases expression ISO MAFG (Homo sapiens) 6480464 cinnamyl alcohol results in increased expression of MAFG mRNA CTD PMID:20566472 Mafg Rat cisplatin increases expression ISO MAFG (Homo sapiens) 6480464 Cisplatin results in increased expression of MAFG mRNA CTD PMID:33545341 Mafg Rat clodronic acid increases expression ISO MAFG (Homo sapiens) 6480464 Clodronic Acid results in increased expression of MAFG mRNA CTD PMID:25596134 Mafg Rat clofibrate decreases expression ISO Mafg (Mus musculus) 6480464 Clofibrate results in decreased expression of MAFG mRNA CTD PMID:17585979 Mafg Rat cobalt dichloride increases expression ISO MAFG (Homo sapiens) 6480464 cobaltous chloride results in increased expression of MAFG mRNA CTD PMID:19320972 Mafg Rat copper atom multiple interactions ISO MAFG (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of MAFG mRNA and [Organoselenium Compounds binds to Copper] which results in increased expression of MAFG mRNA CTD PMID:20971185 and PMID:25167922 Mafg Rat copper(0) multiple interactions ISO MAFG (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of MAFG mRNA and [Organoselenium Compounds binds to Copper] which results in increased expression of MAFG mRNA CTD PMID:20971185 and PMID:25167922 Mafg Rat copper(II) chloride increases expression ISO MAFG (Homo sapiens) 6480464 cupric chloride results in increased expression of MAFG mRNA CTD PMID:17211630 and PMID:38568856 Mafg Rat copper(II) sulfate increases expression ISO MAFG (Homo sapiens) 6480464 Copper Sulfate results in increased expression of MAFG mRNA CTD PMID:19549813 Mafg Rat cortisol multiple interactions ISO MAFG (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:34480604 Mafg Rat CU-O LINKAGE increases expression ISO MAFG (Homo sapiens) 6480464 cupric oxide results in increased expression of MAFG mRNA CTD PMID:22077320 Mafg Rat cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of MAFG mRNA CTD PMID:25596134 Mafg Rat cyclosporin A multiple interactions ISO MAFG (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA CTD PMID:32152650 Mafg Rat cyclosporin A increases expression ISO MAFG (Homo sapiens) 6480464 Cyclosporine results in increased expression of MAFG mRNA CTD PMID:20106945 more ... Mafg Rat DDE decreases expression ISO MAFG (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of MAFG mRNA CTD PMID:38568856 Mafg Rat deoxycholic acid multiple interactions ISO MAFG (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA CTD PMID:32152650 Mafg Rat dibutyl phthalate increases expression ISO Mafg (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of MAFG mRNA CTD PMID:21266533 Mafg Rat dicrotophos increases expression ISO MAFG (Homo sapiens) 6480464 dicrotophos results in increased expression of MAFG mRNA CTD PMID:28302478 Mafg Rat diethyl malate increases expression ISO MAFG (Homo sapiens) 6480464 diethyl malate results in increased expression of MAFG mRNA CTD PMID:38498338 Mafg Rat diethyl maleate increases expression ISO MAFG (Homo sapiens) 6480464 diethyl maleate results in increased expression of MAFG mRNA CTD PMID:33545341 and PMID:34480604 Mafg Rat dioxygen increases expression ISO MAFG (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of MAFG mRNA CTD PMID:25596134 Mafg Rat disodium selenite decreases expression ISO MAFG (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of MAFG mRNA CTD PMID:18175754 Mafg Rat disulfiram increases expression ISO MAFG (Homo sapiens) 6480464 Disulfiram results in increased expression of MAFG mRNA CTD PMID:20566472 Mafg Rat dorsomorphin multiple interactions ISO MAFG (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Mafg Rat doxorubicin decreases expression ISO Mafg (Mus musculus) 6480464 Doxorubicin results in decreased expression of MAFG mRNA CTD PMID:19277126 Mafg Rat doxorubicin decreases expression ISO MAFG (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MAFG mRNA CTD PMID:29803840 Mafg Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of MAFG mRNA CTD PMID:29391264 Mafg Rat eugenol increases expression ISO MAFG (Homo sapiens) 6480464 Eugenol results in increased expression of MAFG mRNA CTD PMID:20566472 Mafg Rat fenofibrate decreases expression EXP 6480464 Fenofibrate results in decreased expression of MAFG mRNA CTD PMID:25596134 Mafg Rat fenofibrate increases expression ISO MAFG (Homo sapiens) 6480464 Fenofibrate results in increased expression of MAFG mRNA CTD PMID:25596134 Mafg Rat fenthion decreases expression ISO Mafg (Mus musculus) 6480464 Fenthion results in decreased expression of MAFG mRNA CTD PMID:34813904 Mafg Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of MAFG mRNA CTD PMID:24136188 Mafg Rat folic acid decreases expression ISO Mafg (Mus musculus) 6480464 Folic Acid results in decreased expression of MAFG mRNA CTD PMID:25629700 Mafg Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of MAFG mRNA CTD PMID:33387578 Mafg Rat geraniol increases expression ISO MAFG (Homo sapiens) 6480464 geraniol results in increased expression of MAFG mRNA CTD PMID:27683099 Mafg Rat glycochenodeoxycholic acid multiple interactions ISO MAFG (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA CTD PMID:32152650 Mafg Rat glycocholic acid multiple interactions ISO MAFG (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA CTD PMID:32152650 Mafg Rat glycodeoxycholic acid multiple interactions ISO MAFG (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA CTD PMID:32152650 Mafg Rat hexane increases expression ISO MAFG (Homo sapiens) 6480464 n-hexane results in increased expression of MAFG mRNA CTD PMID:20566472 Mafg Rat hydrogen peroxide affects expression ISO MAFG (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of MAFG mRNA CTD PMID:20044591 Mafg Rat hydrogen peroxide increases expression ISO MAFG (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of MAFG mRNA CTD PMID:12414654 Mafg Rat hypochlorous acid increases expression ISO MAFG (Homo sapiens) 6480464 Hypochlorous Acid results in increased expression of MAFG mRNA CTD PMID:18156441 Mafg Rat ibuprofen decreases expression EXP 6480464 Ibuprofen results in decreased expression of MAFG mRNA CTD PMID:25596134 Mafg Rat ifosfamide increases expression ISO MAFG (Homo sapiens) 6480464 Ifosfamide results in increased expression of MAFG mRNA CTD PMID:25596134 Mafg Rat iron dichloride increases expression ISO MAFG (Homo sapiens) 6480464 ferrous chloride results in increased expression of MAFG mRNA CTD PMID:35984750 Mafg Rat isoeugenol increases expression ISO MAFG (Homo sapiens) 6480464 isoeugenol results in increased expression of MAFG mRNA CTD PMID:20566472 Mafg Rat L-ascorbic acid multiple interactions ISO MAFG (Homo sapiens) 6480464 [[Ascorbic Acid co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein co-treated with FGF1 protein co-treated with WNT3A protein co-treated with HGF protein] co-treated with [INHBA protein binds to INHBA protein]] results in decreased expression of MAFG mRNA CTD PMID:34480604 Mafg Rat L-ascorbic acid 2-phosphate multiple interactions ISO MAFG (Homo sapiens) 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of MAFG mRNA CTD PMID:34480604 Mafg Rat lead diacetate increases expression ISO MAFG (Homo sapiens) 6480464 lead acetate results in increased expression of MAFG mRNA CTD PMID:38568856 Mafg Rat lead(0) decreases expression ISO MAFG (Homo sapiens) 6480464 Lead results in decreased expression of MAFG mRNA CTD PMID:19921347 Mafg Rat lead(0) increases expression ISO MAFG (Homo sapiens) 6480464 Lead results in increased expression of MAFG mRNA CTD PMID:37386098 Mafg Rat leflunomide increases expression ISO MAFG (Homo sapiens) 6480464 leflunomide results in increased expression of MAFG mRNA CTD PMID:28988120 Mafg Rat lithocholic acid multiple interactions ISO MAFG (Homo sapiens) 6480464 Lithocholic Acid results in increased expression of and results in increased activity of MAFG protein more ... CTD PMID:20146260 Mafg Rat menadione increases expression ISO MAFG (Homo sapiens) 6480464 Vitamin K 3 results in increased expression of MAFG mRNA CTD PMID:12414654 Mafg Rat menadione affects expression ISO MAFG (Homo sapiens) 6480464 Vitamin K 3 affects the expression of MAFG mRNA CTD PMID:20044591 Mafg Rat mercury dibromide increases expression ISO MAFG (Homo sapiens) 6480464 mercuric bromide results in increased expression of MAFG mRNA CTD PMID:26272509 Mafg Rat mercury dibromide multiple interactions ISO MAFG (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAFG mRNA CTD PMID:27188386 Mafg Rat metformin increases expression EXP 6480464 Metformin results in increased expression of MAFG mRNA CTD PMID:25596134 Mafg Rat methidathion decreases expression ISO Mafg (Mus musculus) 6480464 methidathion results in decreased expression of MAFG mRNA CTD PMID:34813904 Mafg Rat methyl methanesulfonate increases expression ISO MAFG (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of MAFG mRNA CTD PMID:23649840 Mafg Rat methyl salicylate increases expression ISO MAFG (Homo sapiens) 6480464 methyl salicylate results in increased expression of MAFG mRNA CTD PMID:20566472 Mafg Rat methylmercury chloride increases expression ISO Mafg (Mus musculus) 6480464 methylmercuric chloride results in increased expression of MAFG mRNA CTD PMID:20061341 Mafg Rat methylmercury chloride increases expression ISO MAFG (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of MAFG mRNA CTD PMID:23179753 and PMID:28001369 Mafg Rat methylparaben increases expression ISO MAFG (Homo sapiens) 6480464 methylparaben results in increased expression of MAFG mRNA CTD PMID:31745603 Mafg Rat nefazodone multiple interactions ISO MAFG (Homo sapiens) 6480464 [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA CTD PMID:32152650 Mafg Rat nefazodone increases expression ISO MAFG (Homo sapiens) 6480464 nefazodone results in increased expression of MAFG mRNA CTD PMID:32152650 Mafg Rat nickel sulfate increases expression ISO MAFG (Homo sapiens) 6480464 nickel sulfate results in increased expression of MAFG mRNA CTD PMID:20566472 Mafg Rat ochratoxin A increases expression ISO MAFG (Homo sapiens) 6480464 ochratoxin A results in increased expression of MAFG mRNA CTD PMID:32905824 Mafg Rat organoselenium compound multiple interactions ISO MAFG (Homo sapiens) 6480464 [Organoselenium Compounds binds to Copper] which results in increased expression of MAFG mRNA CTD PMID:25167922 Mafg Rat ozone multiple interactions ISO MAFG (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of MAFG mRNA more ... CTD PMID:32699268 and PMID:35430440 Mafg Rat p-chloromercuribenzoic acid increases expression ISO MAFG (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of MAFG mRNA CTD PMID:26272509 Mafg Rat p-chloromercuribenzoic acid multiple interactions ISO MAFG (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAFG mRNA CTD PMID:27188386 Mafg Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of MAFG mRNA CTD PMID:33387578 Mafg Rat paraquat increases expression ISO MAFG (Homo sapiens) 6480464 Paraquat results in increased expression of MAFG mRNA CTD PMID:35182771 Mafg Rat pentachlorophenol increases expression ISO Mafg (Mus musculus) 6480464 Pentachlorophenol results in increased expression of MAFG mRNA CTD PMID:23892564 Mafg Rat phenobarbital affects expression ISO MAFG (Homo sapiens) 6480464 Phenobarbital affects the expression of MAFG mRNA CTD PMID:19159669 Mafg Rat phenylmercury acetate increases expression ISO MAFG (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of MAFG mRNA CTD PMID:26272509 Mafg Rat phenylmercury acetate multiple interactions ISO MAFG (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAFG mRNA CTD PMID:27188386 Mafg Rat phlorizin decreases expression ISO Mafg (Mus musculus) 6480464 Phlorhizin results in decreased expression of MAFG mRNA CTD PMID:22538082 Mafg Rat phorone affects expression EXP 6480464 phorone affects the expression of MAFG mRNA CTD PMID:18198479 Mafg Rat picoxystrobin decreases expression ISO MAFG (Homo sapiens) 6480464 picoxystrobin results in decreased expression of MAFG mRNA CTD PMID:33512557 Mafg Rat potassium chromate multiple interactions ISO MAFG (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of MAFG mRNA CTD PMID:22079256 Mafg Rat potassium chromate increases expression ISO MAFG (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of MAFG mRNA CTD PMID:22079256 Mafg Rat propan-2-ol increases expression ISO MAFG (Homo sapiens) 6480464 2-Propanol results in increased expression of MAFG mRNA CTD PMID:20566472 Mafg Rat propiconazole decreases expression ISO Mafg (Mus musculus) 6480464 propiconazole results in decreased expression of MAFG mRNA CTD PMID:21278054 Mafg Rat quercetin increases expression ISO MAFG (Homo sapiens) 6480464 Quercetin results in increased expression of MAFG mRNA CTD PMID:21632981 Mafg Rat rac-lactic acid increases expression ISO MAFG (Homo sapiens) 6480464 Lactic Acid results in increased expression of MAFG mRNA CTD PMID:20566472 Mafg Rat reactive oxygen species affects expression ISO MAFG (Homo sapiens) 6480464 Reactive Oxygen Species affects the expression of MAFG mRNA CTD PMID:25800948 Mafg Rat rotenone decreases expression ISO MAFG (Homo sapiens) 6480464 Rotenone results in decreased expression of MAFG mRNA CTD PMID:33512557 Mafg Rat rotenone increases expression ISO MAFG (Homo sapiens) 6480464 Rotenone results in increased expression of MAFG mRNA CTD PMID:36586010 Mafg Rat S-(1,2-dichlorovinyl)-L-cysteine increases expression ISO MAFG (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in increased expression of MAFG mRNA CTD PMID:33725128 Mafg Rat S-adenosyl-L-methioninate multiple interactions ISO MAFG (Homo sapiens) 6480464 S-Adenosylmethionine inhibits the reaction [Lithocholic Acid results in increased expression of MAFG protein] and S-Adenosylmethionine promotes the reaction [Ursodeoxycholic Acid inhibits the reaction [Lithocholic Acid results in increased expression of MAFG protein]] CTD PMID:20146260 Mafg Rat S-adenosyl-L-methionine multiple interactions ISO MAFG (Homo sapiens) 6480464 S-Adenosylmethionine inhibits the reaction [Lithocholic Acid results in increased expression of MAFG protein] and S-Adenosylmethionine promotes the reaction [Ursodeoxycholic Acid inhibits the reaction [Lithocholic Acid results in increased expression of MAFG protein]] CTD PMID:20146260 Mafg Rat SB 431542 multiple interactions ISO MAFG (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:34480604 Mafg Rat silver atom increases expression ISO MAFG (Homo sapiens) 6480464 Silver results in increased expression of MAFG mRNA CTD PMID:26014281 Mafg Rat silver(0) increases expression ISO MAFG (Homo sapiens) 6480464 Silver results in increased expression of MAFG mRNA CTD PMID:26014281 Mafg Rat sodium arsenite increases activity ISO MAFG (Homo sapiens) 6480464 sodium arsenite results in increased activity of MAFG protein CTD PMID:12220541 Mafg Rat sodium arsenite multiple interactions ISO MAFG (Homo sapiens) 6480464 sodium arsenite promotes the reaction [MAFG protein binds to HSF1 promoter] and sodium arsenite promotes the reaction [MAFG protein binds to HSF1 protein] CTD PMID:30309986 Mafg Rat sodium arsenite decreases expression ISO Mafg (Mus musculus) 6480464 sodium arsenite results in decreased expression of MAFG mRNA CTD PMID:19822182 Mafg Rat sodium arsenite multiple interactions ISO Mafg (Mus musculus) 6480464 sodium arsenite promotes the reaction [[NFE2L2 protein binds to MAFG protein] which binds to NQO1 promoter] CTD PMID:16785233 Mafg Rat sodium arsenite increases expression ISO MAFG (Homo sapiens) 6480464 sodium arsenite results in increased expression of MAFG mRNA CTD PMID:11162468 more ... Mafg Rat sodium dodecyl sulfate increases expression ISO MAFG (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in increased expression of MAFG mRNA CTD PMID:20566472 Mafg Rat sulforaphane increases expression ISO MAFG (Homo sapiens) 6480464 sulforaphane results in increased expression of MAFG mRNA CTD PMID:31838189 Mafg Rat sulforaphane affects expression ISO MAFG (Homo sapiens) 6480464 sulforaphane affects the expression of MAFG mRNA CTD PMID:35724838 Mafg Rat sunitinib increases expression ISO MAFG (Homo sapiens) 6480464 Sunitinib results in increased expression of MAFG mRNA CTD PMID:31533062 Mafg Rat tert-butyl hydroperoxide increases methylation ISO MAFG (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased methylation of MAFG gene CTD PMID:27509014 Mafg Rat tert-butyl hydroperoxide increases expression ISO MAFG (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of MAFG mRNA CTD PMID:12414654 and PMID:27509014 Mafg Rat thiram increases expression ISO MAFG (Homo sapiens) 6480464 Thiram results in increased expression of MAFG mRNA CTD PMID:38568856 Mafg Rat titanium dioxide increases expression ISO Mafg (Mus musculus) 6480464 titanium dioxide results in increased expression of MAFG mRNA CTD PMID:23131501 Mafg Rat trans-isoeugenol increases expression ISO MAFG (Homo sapiens) 6480464 isoeugenol results in increased expression of MAFG mRNA CTD PMID:20566472 Mafg Rat Tributyltin oxide increases expression ISO MAFG (Homo sapiens) 6480464 bis(tri-n-butyltin)oxide results in increased expression of MAFG mRNA CTD PMID:21601586 Mafg Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of MAFG mRNA CTD PMID:33387578 Mafg Rat triclosan increases methylation ISO MAFG (Homo sapiens) 6480464 Triclosan results in increased methylation of MAFG gene CTD PMID:34523531 Mafg Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of MAFG mRNA CTD PMID:25596134 Mafg Rat tunicamycin increases expression ISO MAFG (Homo sapiens) 6480464 Tunicamycin results in increased expression of MAFG mRNA CTD PMID:36586010 Mafg Rat urethane increases expression ISO MAFG (Homo sapiens) 6480464 Urethane results in increased expression of MAFG mRNA CTD PMID:28818685 Mafg Rat ursodeoxycholic acid multiple interactions ISO MAFG (Homo sapiens) 6480464 S-Adenosylmethionine promotes the reaction [Ursodeoxycholic Acid inhibits the reaction [Lithocholic Acid results in increased expression of MAFG protein]] and Ursodeoxycholic Acid inhibits the reaction [Lithocholic Acid results in increased expression of MAFG protein] CTD PMID:20146260 Mafg Rat valproic acid affects expression ISO Mafg (Mus musculus) 6480464 Valproic Acid affects the expression of MAFG mRNA CTD PMID:17292431 Mafg Rat valproic acid increases expression ISO MAFG (Homo sapiens) 6480464 Valproic Acid results in increased expression of MAFG mRNA CTD PMID:28001369 Mafg Rat valproic acid affects expression ISO MAFG (Homo sapiens) 6480464 Valproic Acid affects the expression of MAFG mRNA CTD PMID:25979313 Mafg Rat valproic acid increases methylation ISO MAFG (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MAFG gene CTD PMID:29154799 Mafg Rat XAV939 multiple interactions ISO MAFG (Homo sapiens) 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of MAFG mRNA and [[Ascorbic Acid co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein co-treated with FGF1 protein co-treated with WNT3A protein co-treated with HGF protein] co-treated with [INHBA protein binds to INHBA protein]] results in decreased expression of MAFG mRNA CTD PMID:34480604 Mafg Rat zinc atom multiple interactions ISO MAFG (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of MAFG mRNA CTD PMID:18593933 Mafg Rat zinc dichloride increases expression ISO MAFG (Homo sapiens) 6480464 zinc chloride results in increased expression of MAFG mRNA CTD PMID:11162468 Mafg Rat zinc(0) multiple interactions ISO MAFG (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of MAFG mRNA CTD PMID:18593933
(-)-epigallocatechin 3-gallate (ISO) (E)-cinnamyl alcohol (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 2-tert-butylhydroquinone (ISO) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxynon-2-enal (ISO) acrolein (EXP,ISO) acrylamide (ISO) all-trans-retinoic acid (ISO) alpha-hexylcinnamaldehyde (ISO) alpha-pinene (ISO) amiodarone (ISO) ammonium chloride (EXP) andrographolide (ISO) aristolochic acid A (ISO) arotinoid acid (ISO) azoxystrobin (ISO) Bandrowski's base (ISO) Bardoxolone methyl (ISO) benzene (ISO) benzo[a]pyrene (ISO) benzoic acid (ISO) beta-naphthoflavone (ISO) bisphenol A (EXP,ISO) bortezomib (ISO) butan-1-ol (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) cadmium sulfate (ISO) cannabidiol (ISO) CGP 52608 (ISO) chenodeoxycholic acid (ISO) CHIR 99021 (ISO) chloroacetaldehyde (ISO) chloroprene (ISO) chlorpyrifos (ISO) cinnamyl alcohol (ISO) cisplatin (ISO) clodronic acid (ISO) clofibrate (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) cortisol (ISO) CU-O LINKAGE (ISO) cyclosporin A (EXP,ISO) DDE (ISO) deoxycholic acid (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) diethyl malate (ISO) diethyl maleate (ISO) dioxygen (ISO) disodium selenite (ISO) disulfiram (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) eugenol (ISO) fenofibrate (EXP,ISO) fenthion (ISO) flutamide (EXP) folic acid (ISO) gentamycin (EXP) geraniol (ISO) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) hexane (ISO) hydrogen peroxide (ISO) hypochlorous acid (ISO) ibuprofen (EXP) ifosfamide (ISO) iron dichloride (ISO) isoeugenol (ISO) L-ascorbic acid (ISO) L-ascorbic acid 2-phosphate (ISO) lead diacetate (ISO) lead(0) (ISO) leflunomide (ISO) lithocholic acid (ISO) menadione (ISO) mercury dibromide (ISO) metformin (EXP) methidathion (ISO) methyl methanesulfonate (ISO) methyl salicylate (ISO) methylmercury chloride (ISO) methylparaben (ISO) nefazodone (ISO) nickel sulfate (ISO) ochratoxin A (ISO) organoselenium compound (ISO) ozone (ISO) p-chloromercuribenzoic acid (ISO) paracetamol (EXP) paraquat (ISO) pentachlorophenol (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) phlorizin (ISO) phorone (EXP) picoxystrobin (ISO) potassium chromate (ISO) propan-2-ol (ISO) propiconazole (ISO) quercetin (ISO) rac-lactic acid (ISO) reactive oxygen species (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) S-adenosyl-L-methioninate (ISO) S-adenosyl-L-methionine (ISO) SB 431542 (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium dodecyl sulfate (ISO) sulforaphane (ISO) sunitinib (ISO) tert-butyl hydroperoxide (ISO) thiram (ISO) titanium dioxide (ISO) trans-isoeugenol (ISO) Tributyltin oxide (ISO) trichloroethene (EXP) triclosan (ISO) troglitazone (EXP) tunicamycin (ISO) urethane (ISO) ursodeoxycholic acid (ISO) valproic acid (ISO) XAV939 (ISO) zinc atom (ISO) zinc dichloride (ISO) zinc(0) (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
The Nrf2 regulatory network provides an interface between redox and intermediary metabolism.
Hayes JD and Dinkova-Kostova AT, Trends Biochem Sci. 2014 Apr;39(4):199-218. doi: 10.1016/j.tibs.2014.02.002. Epub 2014 Mar 16.
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.
GOA pipeline
RGD automated data pipeline
6.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
7.
MafG-2 is a novel Maf protein that is expressed by stimulation of extracellular H(+).
Shimokawa N, etal., Cell Signal 2001 Nov;13(11):835-9.
8.
Cloning of MafG homologue from the rat brain by differential display and its expression after hypercapnic stimulation.
Shimokawa N, etal., Mol Cell Biochem 2000 Jan;203(1-2):135-41.
9.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Mafg Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 106,401,633 - 106,410,159 (-) NCBI GRCr8 mRatBN7.2 10 105,903,307 - 105,911,808 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 105,903,237 - 105,912,026 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 111,007,074 - 111,015,576 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 110,470,111 - 110,478,613 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 105,823,759 - 105,832,258 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 109,802,877 - 109,811,476 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 109,806,159 - 109,811,323 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 109,395,929 - 109,404,465 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 110,019,741 - 110,024,927 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 110,034,252 - 110,039,431 (-) NCBI Celera 10 104,449,965 - 104,455,151 (-) NCBI Celera Cytogenetic Map 10 q32.3 NCBI
MAFG Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 81,918,270 - 81,931,244 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 81,918,270 - 81,927,735 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 79,876,146 - 79,885,611 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 77,469,438 - 77,478,879 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 17 76,480,214 - 76,489,629 (-) NCBI Celera Cytogenetic Map 17 q25.3 NCBI HuRef 17 75,277,766 - 75,297,553 (-) NCBI HuRef CHM1_1 17 79,962,349 - 79,971,791 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 82,785,430 - 82,798,403 (-) NCBI T2T-CHM13v2.0
Mafg Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 120,515,943 - 120,525,771 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 120,515,943 - 120,524,426 (-) Ensembl GRCm39 Ensembl GRCm38 11 120,625,117 - 120,634,955 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 120,625,117 - 120,633,600 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 120,489,662 - 120,494,861 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 120,444,438 - 120,449,637 (-) NCBI MGSCv36 mm8 Celera 11 132,363,642 - 132,365,175 (-) NCBI Celera Cytogenetic Map 11 E2 NCBI cM Map 11 84.35 NCBI
Mafg Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955506 1,247,293 - 1,252,167 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955506 1,247,294 - 1,252,167 (+) NCBI ChiLan1.0 ChiLan1.0
MAFG Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 98,454,393 - 98,463,741 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 103,355,168 - 103,364,469 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 76,323,874 - 76,333,300 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 82,026,365 - 82,035,036 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 82,030,699 - 82,031,278 (-) Ensembl panpan1.1 panPan2
MAFG Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 368,102 - 373,825 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 372,216 - 372,797 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 970,324 - 975,925 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 961,543 - 967,144 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 965,535 - 966,116 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 986,697 - 992,297 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 1,113,317 - 1,118,910 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 1,191,956 - 1,200,828 (+) NCBI UU_Cfam_GSD_1.0
Mafg Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 978,486 - 986,842 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936594 5,424,940 - 5,430,097 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936594 5,425,117 - 5,430,057 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MAFG
MAFG Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 73,793,362 - 73,801,185 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 73,796,453 - 73,797,034 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 45,244,171 - 45,253,347 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mafg
.
Predicted Target Of
Count of predictions: 591 Count of miRNA genes: 288 Interacting mature miRNAs: 364 Transcripts: ENSRNOT00000054970 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 12880384 Cm107 Cardiac mass QTL 107 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 90404397 107211142 Rat 12880385 Cm108 Cardiac mass QTL 108 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 90404397 107211142 Rat 1354641 Bvd2 Brain ventricular dilatation QTL 2 6.36 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 10 93223816 107057807 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 2303589 Bw87 Body weight QTL 87 2 body mass (VT:0001259) body weight (CMO:0000012) 10 81285008 107211142 Rat 12880396 Am13 Aortic mass QTL 13 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 90404397 107211142 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 12880398 Kidm67 Kidney mass QTL 67 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 90404397 107211142 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 12880395 Cm109 Cardiac mass QTL 109 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 10 90404397 107211142 Rat 1579915 Bp280 Blood pressure QTL 280 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90404397 107211142 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 2317754 Glom25 Glomerulus QTL 25 3.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 82685200 107211142 Rat 634320 Niddm49 Non-insulin dependent diabetes mellitus QTL 49 4.41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 10 88539139 107211142 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 10450493 Bp382 Blood pressure QTL 382 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 94759759 107211142 Rat 1578672 Bmd16 Bone mineral density QTL 16 6.2 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 96703043 107057807 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 61363 Oia3 Oil induced arthritis QTL 3 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87307617 107211142 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2292436 Bp310 Blood pressure QTL 310 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 94759759 107211142 Rat 724530 Bp149 Blood pressure QTL 149 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90627439 107211142 Rat 1300137 Bp186 Blood pressure QTL 186 3.57 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 10 90627439 107057807 Rat 631538 Oia5 Oil induced arthritis QTL 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87055121 107211142 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 1578663 Bss18 Bone structure and strength QTL 18 3.6 femur width (VT:1000666) femoral neck width (CMO:0001695) 10 96703043 107057807 Rat
Mafg
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 106,406,219 - 106,406,396 (+) Marker Load Pipeline mRatBN7.2 10 105,907,895 - 105,908,072 (+) MAPPER mRatBN7.2 Rnor_6.0 10 109,807,464 - 109,807,640 NCBI Rnor6.0 Rnor_5.0 10 109,400,516 - 109,400,692 UniSTS Rnor5.0 RGSC_v3.4 10 110,021,068 - 110,021,244 UniSTS RGSC3.4 Celera 10 104,451,292 - 104,451,468 UniSTS Cytogenetic Map 10 q32.3 UniSTS
Mafg
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 105,906,636 - 105,907,531 (+) MAPPER mRatBN7.2 Rnor_6.0 10 109,806,205 - 109,807,099 NCBI Rnor6.0 Rnor_5.0 10 109,399,257 - 109,400,151 UniSTS Rnor5.0 Celera 10 104,450,033 - 104,450,927 UniSTS Cytogenetic Map 10 q32.3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000054970 ⟹ ENSRNOP00000051853
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 105,906,591 - 105,912,026 (-) Ensembl Rnor_6.0 Ensembl 10 109,806,159 - 109,811,323 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000104193 ⟹ ENSRNOP00000091294
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 105,903,237 - 105,911,010 (-) Ensembl
RefSeq Acc Id:
NM_022386 ⟹ NP_071781
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 106,401,633 - 106,410,132 (-) NCBI mRatBN7.2 10 105,903,307 - 105,911,808 (-) NCBI Rnor_6.0 10 109,806,137 - 109,811,323 (-) NCBI Rnor_5.0 10 109,395,929 - 109,404,465 (-) NCBI RGSC_v3.4 10 110,019,741 - 110,024,927 (-) RGD Celera 10 104,449,965 - 104,455,151 (-) RGD
Sequence:
CCCGGCCTTCCTAGCGCGCTTGGCCCGGCCCGCGCAAGCGGCCAGTACTCCTAAGCCCCCGGCCCGGACCCTTCGCGCCCGACCCAGCCCCGCGCAGCCCCGGAGCGCGCGCGCGCGGCCCCGCCCCA
hide sequence
RefSeq Acc Id:
XM_006247913 ⟹ XP_006247975
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 106,401,633 - 106,409,912 (-) NCBI mRatBN7.2 10 105,903,307 - 105,911,588 (-) NCBI Rnor_6.0 10 109,802,877 - 109,811,156 (-) NCBI Rnor_5.0 10 109,395,929 - 109,404,465 (-) NCBI
Sequence:
GCGCGGGGCTGGGGCGGGCGACGGGGCCTGGCCTCGGGGTTGCGGCACACCCGACGGCGGCGCGTGCCTCGGTTTCCCCGCTAGTCAAAAGAGGGCTGTTCGCCGGTGCCACCCCAGTGTCGGTGGAC
hide sequence
RefSeq Acc Id:
XM_006247921 ⟹ XP_006247983
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 106,401,633 - 106,409,912 (-) NCBI mRatBN7.2 10 105,903,307 - 105,911,588 (-) NCBI Rnor_6.0 10 109,802,877 - 109,811,156 (-) NCBI Rnor_5.0 10 109,395,929 - 109,404,465 (-) NCBI
Sequence:
GCGCGGGGCTGGGGCGGGCGACGGGGCCTGGCCTCGGGGTTGCGGCACACCCGACGGCGGCGCGTGCCTCGGTTTCCCCGCTAGTCAAAAGAGGGCTGTTCGCCGGTGCCACCCCAGTGTCGGTGGAC
hide sequence
RefSeq Acc Id:
XM_006247922 ⟹ XP_006247984
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 106,401,633 - 106,409,912 (-) NCBI mRatBN7.2 10 105,903,307 - 105,911,588 (-) NCBI Rnor_6.0 10 109,802,877 - 109,811,156 (-) NCBI Rnor_5.0 10 109,395,929 - 109,404,465 (-) NCBI
Sequence:
GCGCGGGGCTGGGGCGGGCGACGGGGCCTGGCCTCGGGGTTGCGGCACACCCGACGGCGGCGCGTGCCTCGGTTTCCCCGCTAGTCAAAAGAGGGCTGTTCGCCGGTGCCACCCCAGTGTCGGTGGAC
hide sequence
RefSeq Acc Id:
XM_008768482 ⟹ XP_008766704
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 106,401,633 - 106,407,008 (-) NCBI mRatBN7.2 10 105,903,307 - 105,908,680 (-) NCBI Rnor_6.0 10 109,802,877 - 109,811,156 (-) NCBI
Sequence:
GCGCGGGGCTGGGGCGGGCGACGGGGCCTGGCCTCGGGGTTGCGGCACACCCGACGGCGGCGCG
hide sequence
RefSeq Acc Id:
XM_039086787 ⟹ XP_038942715
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 106,401,633 - 106,409,912 (-) NCBI mRatBN7.2 10 105,903,307 - 105,911,588 (-) NCBI
RefSeq Acc Id:
XM_039086788 ⟹ XP_038942716
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 106,401,633 - 106,409,912 (-) NCBI mRatBN7.2 10 105,903,307 - 105,911,588 (-) NCBI
RefSeq Acc Id:
XM_063269807 ⟹ XP_063125877
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 106,401,633 - 106,409,912 (-) NCBI
RefSeq Acc Id:
XM_063269808 ⟹ XP_063125878
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 106,401,633 - 106,410,159 (-) NCBI
RefSeq Acc Id:
XM_063269809 ⟹ XP_063125879
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 106,401,633 - 106,409,912 (-) NCBI
RefSeq Acc Id:
XM_063269810 ⟹ XP_063125880
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 106,401,633 - 106,409,912 (-) NCBI
RefSeq Acc Id:
XM_063269811 ⟹ XP_063125881
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 106,401,633 - 106,410,152 (-) NCBI
RefSeq Acc Id:
NP_071781 ⟸ NM_022386
- Sequence:
MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIIQLKQRRRTLKNRGYAASCRVKRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQNFARTVARSPVAP
hide sequence
RefSeq Acc Id:
XP_006247983 ⟸ XM_006247921
- Peptide Label:
isoform X3
- Sequence:
MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIIQLKQRRRTLKNRGY
hide sequence
RefSeq Acc Id:
XP_006247975 ⟸ XM_006247913
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2QQP9 (UniProtKB/TrEMBL)
- Sequence:
MLQPSHRMVTPSVKEMHREDWRGLGSAPPSRIACYLEGKGPSEAAKLRVPAHCVPRVMTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIIQLKQRRRTLKNRGYAASCRVK
hide sequence
RefSeq Acc Id:
XP_006247984 ⟸ XM_006247922
- Peptide Label:
isoform X3
- Sequence:
MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIIQLKQRRRTLKNRGYAASCRVKRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQNFARTVARSPVAP
hide sequence
RefSeq Acc Id:
XP_008766704 ⟸ XM_008768482
- Peptide Label:
isoform X3
- Sequence:
MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIIQLKQRRRTLKNRGY
hide sequence
Ensembl Acc Id:
ENSRNOP00000051853 ⟸ ENSRNOT00000054970
RefSeq Acc Id:
XP_038942716 ⟸ XM_039086788
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038942715 ⟸ XM_039086787
- Peptide Label:
isoform X3
Ensembl Acc Id:
ENSRNOP00000091294 ⟸ ENSRNOT00000104193
RefSeq Acc Id:
XP_063125878 ⟸ XM_063269808
- Peptide Label:
isoform X2
- UniProtKB:
Q99N83 (UniProtKB/Swiss-Prot), Q76MX4 (UniProtKB/Swiss-Prot), A6HLH1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125881 ⟸ XM_063269811
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063125880 ⟸ XM_063269810
- Peptide Label:
isoform X2
- UniProtKB:
Q99N83 (UniProtKB/Swiss-Prot), Q76MX4 (UniProtKB/Swiss-Prot), A6HLH1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125879 ⟸ XM_063269809
- Peptide Label:
isoform X2
- UniProtKB:
Q99N83 (UniProtKB/Swiss-Prot), Q76MX4 (UniProtKB/Swiss-Prot), A6HLH1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125877 ⟸ XM_063269807
- Peptide Label:
isoform X2
- UniProtKB:
Q99N83 (UniProtKB/Swiss-Prot), Q76MX4 (UniProtKB/Swiss-Prot), A6HLH1 (UniProtKB/TrEMBL)
RGD ID: 13697971 Promoter ID: EPDNEW_R8495 Type: multiple initiation site Name: Mafg_1 Description: MAF bZIP transcription factor G SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 109,811,376 - 109,811,436 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-18
Mafg
MAF bZIP transcription factor G
Mafg
v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog G
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-07-18
Mafg
v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog G
Mafg
v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-10-30
Mafg
v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian)
Mafg
v-maf musculoaponeurotic fibrosarcoma oncogene family, protein G (avian)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Mafg
v-maf musculoaponeurotic fibrosarcoma oncogene family, protein G (avian)
v-maf musculoaponeurotic fibrosarcoma (avian) oncogene family, protein G
Name updated
1299863 APPROVED
2002-08-07
Mafg
v-maf musculoaponeurotic fibrosarcoma (avian) oncogene family, protein G
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_transcript
splice variant MafG-2 contains an insertion of 27 amino acids
633304
