Symbol:
Rac1
Name:
Rac family small GTPase 1
RGD ID:
619755
Description:
Enables several functions, including GTP binding activity; Rho GDP-dissociation inhibitor binding activity; and enzyme binding activity. Involved in several processes, including actin cytoskeleton organization; bone resorption; and positive regulation of plasma membrane bounded cell projection assembly. Located in Golgi membrane and cytosol. Is active in GABA-ergic synapse. Used to study congestive heart failure. Human ortholog(s) of this gene implicated in autosomal dominant intellectual developmental disorder 48; colorectal cancer (multiple); lung cancer; and pancreatic adenocarcinoma. Orthologous to human RAC1 (Rac family small GTPase 1); PARTICIPATES IN Rho/Rac/Cdc42 mediated signaling pathway; Arf family mediated signaling pathway; azathioprine pharmacodynamics pathway; INTERACTS WITH 11-deoxycorticosterone; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
p21-Rac1; ras-related C3 botulinum toxin substrate 1; ras-related C3 botulinum toxin substrate 1 (rho family small GTP binding protein Rac1); ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1); rho family, small GTP binding protein Rac1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 16,150,411 - 16,170,864 (+) NCBI GRCr8 mRatBN7.2 12 11,037,028 - 11,057,251 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 11,036,698 - 11,057,251 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 11,844,100 - 11,864,510 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 12,467,387 - 12,487,799 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 11,492,647 - 11,513,133 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 13,090,316 - 13,111,841 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 13,090,172 - 13,111,873 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 15,133,521 - 15,153,741 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 11,380,314 - 11,400,531 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 11,419,965 - 11,428,962 (+) NCBI Celera 12 12,831,091 - 12,851,324 (+) NCBI Celera Cytogenetic Map 12 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rac1 Rat (+)-catechin decreases expression ISO RGD:1605432 6480464 Catechin results in decreased expression of RAC1 mRNA CTD PMID:15465739 Rac1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1605432 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of RAC1 mRNA CTD PMID:22079256 Rac1 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1553531 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RAC1 mRNA CTD PMID:36331819 Rac1 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1553531 6480464 1,2-Dimethylhydrazine results in decreased expression of RAC1 mRNA CTD PMID:22206623 Rac1 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1553531 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RAC1 mRNA CTD PMID:22206623 Rac1 Rat 1,8-cineole multiple interactions ISO RGD:1553531 6480464 Eucalyptol inhibits the reaction [Glucose results in increased expression of RAC1 protein]; Eucalyptol inhibits the more ... CTD PMID:31483951 Rac1 Rat 11-deoxycorticosterone multiple interactions EXP 6480464 [Desoxycorticosterone co-treated with Sodium Chloride] results in increased expression of RAC1 protein CTD PMID:22431579 Rac1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of RAC1 protein CTD PMID:24231043 Rac1 Rat 17beta-estradiol increases expression ISO RGD:1605432 6480464 Estradiol results in increased expression of RAC1 mRNA CTD PMID:23094148 Rac1 Rat 17beta-estradiol multiple interactions ISO RGD:1605432 6480464 IGF1R mutant form inhibits the reaction [Estradiol results in increased expression of RAC1 mRNA] CTD PMID:23094148 Rac1 Rat 17beta-estradiol multiple interactions EXP 6480464 Dizocilpine Maleate inhibits the reaction [Estradiol results in increased expression of RAC1 protein]; U 0126 more ... CTD PMID:24231043 Rac1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases phosphorylation ISO RGD:1605432 6480464 2,4,5,2',4',5'-hexachlorobiphenyl results in increased phosphorylation of RAC1 protein CTD PMID:19632255 Rac1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1553531 6480464 Tetrachlorodibenzodioxin affects the expression of RAC1 mRNA CTD PMID:21570461|PMID:24680724 Rac1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of RAC1 mRNA CTD PMID:34747641 Rac1 Rat 2,4,6-tribromophenol decreases expression ISO RGD:1605432 6480464 2,4,6-tribromophenol results in decreased expression of RAC1 mRNA CTD PMID:31675489 Rac1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of RAC1 mRNA CTD PMID:21346803 Rac1 Rat 2-acetamidofluorene increases activity ISO RGD:1605432 6480464 2-Acetylaminofluorene results in increased activity of RAC1 protein CTD PMID:11960367 Rac1 Rat 2-acetamidofluorene multiple interactions ISO RGD:1605432 6480464 [2-Acetylaminofluorene results in increased activity of RAC1 protein] which results in increased expression of ABCB1 more ... CTD PMID:11960367 Rac1 Rat 2-trans,6-trans,10-trans-geranylgeranyl diphosphate multiple interactions ISO RGD:1605432 6480464 geranylgeranyl pyrophosphate inhibits the reaction [Atorvastatin inhibits the reaction [Glucose results in increased localization of more ... CTD PMID:17279352|PMID:18625914 Rac1 Rat 2-trans,6-trans-farnesyl diphosphate multiple interactions ISO RGD:1605432 6480464 farnesyl pyrophosphate inhibits the reaction [Simvastatin inhibits the reaction [Lipopolysaccharides results in increased activity of more ... CTD PMID:18625914 Rac1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:1605432 6480464 tetrabromobisphenol A results in decreased expression of RAC1 protein CTD PMID:31675489 Rac1 Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO RGD:1605432 6480464 bisindolylmaleimide I inhibits the reaction [Glucose affects the localization of RAC1 protein] CTD PMID:17916771 Rac1 Rat 3-methylcholanthrene increases expression ISO RGD:1553531 6480464 Methylcholanthrene results in increased expression of RAC1 mRNA CTD PMID:29554273 Rac1 Rat 3-phenylprop-2-enal decreases expression EXP 6480464 cinnamaldehyde results in decreased expression of RAC1 protein CTD PMID:17486422 Rac1 Rat 4,5,4'-trihydroxy-3,3'-dimethoxybibenzyl decreases activity ISO RGD:1605432 155791640 TDB decreases activity of RAC1 protein in lung cancer cells RGD Rac1 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2,6-dinitrotoluene affects the expression of RAC1 mRNA CTD PMID:21346803 Rac1 Rat 4-hydroxycoumarin decreases expression ISO RGD:1553531 6480464 4-hydroxycoumarin results in decreased expression of RAC1 protein CTD PMID:18492274 Rac1 Rat 4-tert-Octylphenol increases expression EXP 6480464 4-tert-octylphenol results in increased expression of RAC1 mRNA CTD PMID:17011747 Rac1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of RAC1 mRNA CTD PMID:30047161 Rac1 Rat 7,8-diacetoxy-4-methylcoumarin decreases expression ISO RGD:1605432 155791641 DAMTC decreases expression of RAC1 protein in non-small cell lung cancer cells RGD Rac1 Rat acetylsalicylic acid increases expression ISO RGD:1605432 6480464 Aspirin results in increased expression of RAC1 mRNA; Aspirin results in increased expression of RAC1 more ... CTD PMID:14976132 Rac1 Rat acteoside decreases expression ISO RGD:1605432 153298971 Verbascoside decreases expression of RAC1 mRNA in colon cancer cells RGD Rac1 Rat actinomycin D multiple interactions ISO RGD:1605432 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of RAC1 protein CTD PMID:38460933 Rac1 Rat Aflatoxin B2 alpha increases methylation ISO RGD:1605432 6480464 aflatoxin B2 results in increased methylation of RAC1 intron CTD PMID:30157460 Rac1 Rat AICA ribonucleotide multiple interactions EXP 6480464 AICA ribonucleotide inhibits the reaction [Cadmium Chloride results in increased expression of RAC1 protein] CTD PMID:21195169 Rac1 Rat aldehydo-D-glucose multiple interactions ISO RGD:1605432 6480464 Atorvastatin inhibits the reaction [Glucose results in increased localization of RAC1 protein]; bisindolylmaleimide I inhibits more ... CTD PMID:17279352|PMID:17916771 Rac1 Rat aldehydo-D-glucose increases expression ISO RGD:1553531 6480464 Glucose results in increased expression of RAC1 protein CTD PMID:31483951 Rac1 Rat aldehydo-D-glucose multiple interactions ISO RGD:1553531 6480464 [Resveratrol co-treated with Glucose] results in decreased expression of RAC1 mRNA; Eucalyptol inhibits the reaction more ... CTD PMID:24659233|PMID:31483951 Rac1 Rat aldehydo-D-glucose multiple interactions EXP 6480464 dorsomorphin inhibits the reaction [Resveratrol inhibits the reaction [Glucose results in increased activity of RAC1 more ... CTD PMID:19854265|PMID:26054749 Rac1 Rat aldehydo-D-glucose increases activity EXP 6480464 Glucose results in increased activity of RAC1 protein CTD PMID:26054749 Rac1 Rat aldehydo-D-glucose affects localization ISO RGD:1605432 6480464 Glucose affects the localization of RAC1 protein CTD PMID:17916771 Rac1 Rat aldehydo-D-glucose increases localization ISO RGD:1605432 6480464 Glucose results in increased localization of RAC1 protein CTD PMID:17279352 Rac1 Rat all-trans-retinoic acid increases activity EXP 6480464 Tretinoin results in increased activity of RAC1 protein CTD PMID:17130476 Rac1 Rat all-trans-retinoic acid increases expression ISO RGD:1605432 6480464 Tretinoin results in increased expression of RAC1 mRNA CTD PMID:23724009 Rac1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of RAC1 mRNA CTD PMID:30047161 Rac1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of RAC1 mRNA CTD PMID:16483693 Rac1 Rat antirheumatic drug decreases expression ISO RGD:1605432 6480464 Antirheumatic Agents results in decreased expression of RAC1 mRNA CTD PMID:24449571 Rac1 Rat apilimod multiple interactions ISO RGD:1553531 6480464 apilimod inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine results in increased activity of RAC1 protein] CTD PMID:28779020 Rac1 Rat aristolochic acid A multiple interactions ISO RGD:1605432 6480464 aristolochic acid I inhibits the reaction [SLIT2 protein results in increased activity of RAC1 protein]; more ... CTD PMID:30381256 Rac1 Rat arsane multiple interactions ISO RGD:1605432 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of RAC1 more ... CTD PMID:32525701 Rac1 Rat arsenic atom multiple interactions ISO RGD:1605432 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of RAC1 more ... CTD PMID:32525701 Rac1 Rat arsenite(3-) increases expression ISO RGD:1605432 6480464 arsenite results in increased expression of RAC1 protein CTD PMID:22011395 Rac1 Rat arsenous acid multiple interactions ISO RGD:1605432 6480464 [ruxolitinib co-treated with Arsenic Trioxide] results in increased expression of RAC1 mRNA; [Tetradecanoylphorbol Acetate co-treated more ... CTD PMID:12239215|PMID:18922899|PMID:30012499 Rac1 Rat arsenous acid affects localization ISO RGD:1605432 6480464 Arsenic Trioxide affects the localization of RAC1 protein CTD PMID:18424721 Rac1 Rat arsenous acid decreases expression ISO RGD:1605432 6480464 Arsenic Trioxide results in decreased expression of RAC1 mRNA; Arsenic Trioxide results in decreased expression more ... CTD PMID:25419056|PMID:26238599 Rac1 Rat arsenous acid multiple interactions ISO RGD:1553531 6480464 Arsenic Trioxide results in increased expression of and affects the localization of RAC1 protein; ATF4 more ... CTD PMID:27638049 Rac1 Rat arsenous acid increases activity ISO RGD:1605432 6480464 Arsenic Trioxide results in increased activity of RAC1 protein CTD PMID:12239215 Rac1 Rat atorvastatin calcium multiple interactions ISO RGD:1605432 6480464 [Poly I-C co-treated with Atorvastatin] results in decreased expression of RAC1 mRNA; Atorvastatin inhibits the more ... CTD PMID:17279352|PMID:34696514 Rac1 Rat atorvastatin calcium multiple interactions EXP 6480464 Atorvastatin inhibits the reaction [Streptozocin results in increased activity of RAC1 protein] CTD PMID:17589825 Rac1 Rat atorvastatin calcium multiple interactions ISO RGD:1553531 6480464 Atorvastatin inhibits the reaction [Streptozocin results in increased activity of and results in increased localization more ... CTD PMID:17279352 Rac1 Rat azathioprine multiple interactions ISO RGD:1605432 6480464 Azathioprine inhibits the reaction [RAC1 protein binds to STAT3 protein] CTD PMID:12697733 Rac1 Rat azathioprine affects response to substance ISO RGD:1605432 6480464 RAC1 gene polymorphism affects the susceptibility to Azathioprine CTD PMID:21372752 Rac1 Rat azathioprine affects binding ISO RGD:1605432 6480464 Azathioprine metabolite binds to RAC1 protein CTD PMID:12697733 Rac1 Rat azathioprine decreases activity ISO RGD:1605432 6480464 Azathioprine results in decreased activity of RAC1 protein CTD PMID:12697733 Rac1 Rat azithromycin multiple interactions ISO RGD:1605432 6480464 Azithromycin inhibits the reaction [Lipopolysaccharides results in increased activity of RAC1 protein] CTD PMID:21417583 Rac1 Rat belinostat decreases expression ISO RGD:1605432 6480464 belinostat results in decreased expression of RAC1 mRNA CTD PMID:19606018 Rac1 Rat benzo[a]pyrene decreases methylation ISO RGD:1605432 6480464 Benzo(a)pyrene results in decreased methylation of RAC1 5' UTR CTD PMID:27901495 Rac1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RAC1 mRNA; bisphenol A results in increased expression more ... CTD PMID:24231043|PMID:25181051 Rac1 Rat bisphenol A increases expression ISO RGD:1605432 6480464 bisphenol A results in increased expression of RAC1 protein CTD PMID:34186270 Rac1 Rat bisphenol A decreases expression ISO RGD:1605432 6480464 bisphenol A results in decreased expression of RAC1 protein CTD PMID:31675489 Rac1 Rat bisphenol A decreases expression ISO RGD:1553531 6480464 bisphenol A results in decreased expression of RAC1 mRNA CTD PMID:33221593 Rac1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of RAC1 mRNA; bisphenol A results in decreased expression more ... CTD PMID:32714078 Rac1 Rat bisphenol A multiple interactions EXP 6480464 Dizocilpine Maleate inhibits the reaction [bisphenol A results in increased expression of RAC1 protein]; U more ... CTD PMID:24231043 Rac1 Rat bisphenol AF increases expression ISO RGD:1605432 6480464 bisphenol AF results in increased expression of RAC1 protein CTD PMID:34186270 Rac1 Rat Bisphenol B increases expression ISO RGD:1605432 6480464 bisphenol B results in increased expression of RAC1 protein CTD PMID:34186270 Rac1 Rat bisphenol F increases expression ISO RGD:1605432 6480464 bisphenol F results in increased expression of RAC1 protein CTD PMID:34186270 Rac1 Rat C60 fullerene multiple interactions ISO RGD:1553531 6480464 [[fullerene C60 results in increased secretion of HMGB1 protein] which results in increased expression of more ... CTD PMID:31504961 Rac1 Rat cadmium atom increases oxidation ISO RGD:1553531 6480464 Cadmium results in increased oxidation of RAC1 protein CTD PMID:24077948 Rac1 Rat cadmium dichloride increases expression ISO RGD:1605432 6480464 Cadmium Chloride results in increased expression of RAC1 mRNA; Cadmium Chloride results in increased expression more ... CTD PMID:21195169|PMID:28527916|PMID:33129824 Rac1 Rat cadmium dichloride multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased expression of RAC1 protein]; AICA ribonucleotide more ... CTD PMID:21195169 Rac1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of RAC1 protein CTD PMID:21195169 Rac1 Rat cannabidiol decreases expression ISO RGD:1605432 6480464 Cannabidiol results in decreased expression of RAC1 protein CTD PMID:37625625 Rac1 Rat cannabidiol multiple interactions ISO RGD:1605432 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of RAC1 mRNA; Cannabidiol more ... CTD PMID:31250491|PMID:32992648 Rac1 Rat captan increases expression ISO RGD:1553531 6480464 Captan results in increased expression of RAC1 mRNA CTD PMID:31558096 Rac1 Rat carbon nanotube increases expression ISO RGD:1553531 6480464 Nanotubes, Carbon analog results in increased expression of RAC1 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Rac1 Rat carbon nanotube multiple interactions ISO RGD:1553531 6480464 [[Nanotubes, Carbon results in increased secretion of HMGB1 protein] which results in increased expression of more ... CTD PMID:31504961 Rac1 Rat carvedilol multiple interactions EXP 6480464 carvedilol inhibits the reaction [AGT protein affects the localization of RAC1 protein] CTD PMID:16940222 Rac1 Rat chloropicrin increases expression ISO RGD:1605432 6480464 chloropicrin results in increased expression of RAC1 mRNA CTD PMID:26352163 Rac1 Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of RAC1 mRNA CTD PMID:23125180 Rac1 Rat chlorpyrifos increases expression ISO RGD:1553531 6480464 Chlorpyrifos results in increased expression of RAC1 mRNA CTD PMID:37019170 Rac1 Rat cholesterol multiple interactions ISO RGD:1605432 6480464 Cholesterol inhibits the reaction [Simvastatin affects the localization of and results in decreased activity of more ... CTD PMID:21334995 Rac1 Rat cholesterol increases expression ISO RGD:1553531 6480464 Cholesterol results in increased expression of RAC1 mRNA; Cholesterol results in increased expression of RAC1 more ... CTD PMID:19028402 Rac1 Rat cholesterol multiple interactions ISO RGD:1553531 6480464 Cholesterol inhibits the reaction [irbesartan results in increased expression of RAC1 mRNA] CTD PMID:19028402 Rac1 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of RAC1 protein CTD PMID:23628706 Rac1 Rat cisplatin multiple interactions EXP 6480464 clemizole inhibits the reaction [Cisplatin results in increased expression of RAC1 protein] CTD PMID:37102204 Rac1 Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of RAC1 protein CTD PMID:37102204 Rac1 Rat cisplatin multiple interactions ISO RGD:1605432 6480464 [Cisplatin results in decreased susceptibility to Cisplatin] which results in increased expression of RAC1 mRNA CTD PMID:30871063 Rac1 Rat clemizole multiple interactions EXP 6480464 clemizole inhibits the reaction [Cisplatin results in increased expression of RAC1 protein] CTD PMID:37102204 Rac1 Rat clozapine multiple interactions ISO RGD:1605432 6480464 [Cuprizone co-treated with Clozapine] results in increased expression of RAC1 protein CTD PMID:34122009 Rac1 Rat cobalt dichloride increases expression ISO RGD:1605432 6480464 cobaltous chloride results in increased expression of RAC1 mRNA CTD PMID:19376846 Rac1 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of RAC1 mRNA CTD PMID:20187946 Rac1 Rat cocaine increases expression ISO RGD:1553531 6480464 Cocaine results in increased expression of RAC1 protein CTD PMID:18952886 Rac1 Rat copper atom multiple interactions ISO RGD:1605432 6480464 [Chelating Agents binds to Copper] which results in increased expression of RAC1 mRNA; [Disulfiram binds more ... CTD PMID:24690739|PMID:30911355 Rac1 Rat copper(0) multiple interactions ISO RGD:1605432 6480464 [Chelating Agents binds to Copper] which results in increased expression of RAC1 mRNA; [Disulfiram binds more ... CTD PMID:24690739|PMID:30911355 Rac1 Rat copper(II) sulfate increases expression ISO RGD:1605432 6480464 Copper Sulfate results in increased expression of RAC1 mRNA CTD PMID:19549813 Rac1 Rat corn oil increases expression ISO RGD:1553531 6480464 Corn Oil results in increased expression of RAC1 mRNA CTD PMID:33263755 Rac1 Rat Cuprizon multiple interactions ISO RGD:1605432 6480464 [Cuprizone co-treated with Clozapine] results in increased expression of RAC1 protein CTD PMID:34122009 Rac1 Rat curcumin multiple interactions EXP 6480464 Curcumin inhibits the reaction [Doxorubicin results in increased expression of RAC1 mRNA] CTD PMID:34047412 Rac1 Rat D-glucose multiple interactions ISO RGD:1605432 6480464 Atorvastatin inhibits the reaction [Glucose results in increased localization of RAC1 protein]; bisindolylmaleimide I inhibits more ... CTD PMID:17279352|PMID:17916771 Rac1 Rat D-glucose increases expression ISO RGD:1553531 6480464 Glucose results in increased expression of RAC1 protein CTD PMID:31483951 Rac1 Rat D-glucose multiple interactions ISO RGD:1553531 6480464 [Resveratrol co-treated with Glucose] results in decreased expression of RAC1 mRNA; Eucalyptol inhibits the reaction more ... CTD PMID:24659233|PMID:31483951 Rac1 Rat D-glucose increases activity EXP 6480464 Glucose results in increased activity of RAC1 protein CTD PMID:26054749 Rac1 Rat D-glucose multiple interactions EXP 6480464 dorsomorphin inhibits the reaction [Resveratrol inhibits the reaction [Glucose results in increased activity of RAC1 more ... CTD PMID:19854265|PMID:26054749 Rac1 Rat D-glucose increases localization ISO RGD:1605432 6480464 Glucose results in increased localization of RAC1 protein CTD PMID:17279352 Rac1 Rat D-glucose affects localization ISO RGD:1605432 6480464 Glucose affects the localization of RAC1 protein CTD PMID:17916771 Rac1 Rat daidzein increases activity ISO RGD:1553531 6480464 daidzein results in increased activity of RAC1 protein CTD PMID:24859791 Rac1 Rat decabromodiphenyl ether decreases expression ISO RGD:1605432 6480464 decabromobiphenyl ether results in decreased expression of RAC1 protein CTD PMID:31675489 Rac1 Rat deguelin decreases expression ISO RGD:1605432 6480464 deguelin results in decreased expression of RAC1 protein CTD PMID:26884827 Rac1 Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of RAC1 mRNA CTD PMID:29111458 Rac1 Rat diallyl disulfide multiple interactions ISO RGD:1605432 6480464 ARHGDIB protein inhibits the reaction [diallyl disulfide results in decreased expression of RAC1 protein] CTD PMID:36793247 Rac1 Rat diallyl disulfide decreases expression ISO RGD:1605432 6480464 diallyl disulfide results in decreased expression of RAC1 protein CTD PMID:36793247 Rac1 Rat diarsenic trioxide increases activity ISO RGD:1605432 6480464 Arsenic Trioxide results in increased activity of RAC1 protein CTD PMID:12239215 Rac1 Rat diarsenic trioxide multiple interactions ISO RGD:1605432 6480464 [ruxolitinib co-treated with Arsenic Trioxide] results in increased expression of RAC1 mRNA; [Tetradecanoylphorbol Acetate co-treated more ... CTD PMID:12239215|PMID:18922899|PMID:30012499 Rac1 Rat diarsenic trioxide decreases expression ISO RGD:1605432 6480464 Arsenic Trioxide results in decreased expression of RAC1 mRNA; Arsenic Trioxide results in decreased expression more ... CTD PMID:25419056|PMID:26238599 Rac1 Rat diarsenic trioxide affects localization ISO RGD:1605432 6480464 Arsenic Trioxide affects the localization of RAC1 protein CTD PMID:18424721 Rac1 Rat diarsenic trioxide multiple interactions ISO RGD:1553531 6480464 Arsenic Trioxide results in increased expression of and affects the localization of RAC1 protein; ATF4 more ... CTD PMID:27638049 Rac1 Rat dibenziodolium multiple interactions ISO RGD:1553531 6480464 diphenyleneiodonium inhibits the reaction [Fungal Polysaccharides results in increased activity of RAC1 protein] CTD PMID:24447977 Rac1 Rat dibutyl phthalate affects localization ISO RGD:1553531 6480464 Dibutyl Phthalate affects the localization of RAC1 protein CTD PMID:30350139 Rac1 Rat dibutyl phthalate multiple interactions ISO RGD:1553531 6480464 Dibutyl Phthalate results in decreased expression of and results in decreased activity of RAC1 protein; more ... CTD PMID:30350139 Rac1 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of RAC1 mRNA CTD PMID:17011747 Rac1 Rat Dimethyldithiophosphate increases activity ISO RGD:1553531 6480464 O,O-dimethyl phosphorodithioate results in increased activity of RAC1 protein CTD PMID:37270087 Rac1 Rat Dimethylphosphate increases activity ISO RGD:1553531 6480464 dimethyl phosphate results in increased activity of RAC1 protein CTD PMID:37270087 Rac1 Rat dioxygen multiple interactions ISO RGD:1605432 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of RAC1 mRNA; [Oxygen more ... CTD PMID:12719791|PMID:32992648 Rac1 Rat disodium selenite increases activity ISO RGD:1605432 6480464 Sodium Selenite results in increased activity of RAC1 protein CTD PMID:12896980 Rac1 Rat disulfiram multiple interactions ISO RGD:1605432 6480464 [Disulfiram binds to Copper] which results in decreased expression of RAC1 mRNA CTD PMID:24690739 Rac1 Rat diuron decreases expression ISO RGD:1605432 6480464 Diuron results in decreased expression of RAC1 mRNA CTD PMID:35967413 Rac1 Rat dizocilpine maleate multiple interactions EXP 6480464 Dizocilpine Maleate inhibits the reaction [bisphenol A results in increased expression of RAC1 protein]; Dizocilpine more ... CTD PMID:24231043 Rac1 Rat dorsomorphin multiple interactions EXP 6480464 dorsomorphin inhibits the reaction [Resveratrol inhibits the reaction [Glucose results in increased activity of RAC1 more ... CTD PMID:26054749 Rac1 Rat doxorubicin increases response to substance ISO RGD:1553531 6480464 RAC1 protein results in increased susceptibility to Doxorubicin CTD PMID:28710503 Rac1 Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of RAC1 mRNA CTD PMID:34047412 Rac1 Rat doxorubicin multiple interactions EXP 6480464 Curcumin inhibits the reaction [Doxorubicin results in increased expression of RAC1 mRNA] CTD PMID:34047412 Rac1 Rat doxorubicin decreases expression ISO RGD:1605432 6480464 Doxorubicin results in decreased expression of RAC1 mRNA CTD PMID:29803840 Rac1 Rat enzyme inhibitor multiple interactions ISO RGD:1605432 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Rac1 Rat ethanol multiple interactions ISO RGD:1605432 6480464 [Ethanol co-treated with sodium arsenite] results in increased localization of RAC1 protein CTD PMID:18182400 Rac1 Rat ethanol affects splicing ISO RGD:1553531 6480464 Ethanol affects the splicing of RAC1 mRNA CTD PMID:30319688 Rac1 Rat ethanol multiple interactions ISO RGD:1553531 6480464 CNR1 protein affects the reaction [Ethanol results in decreased expression of RAC1 protein]; Ethanol promotes more ... CTD PMID:30143782 Rac1 Rat ethanol decreases expression ISO RGD:1553531 6480464 Ethanol results in decreased expression of RAC1 mRNA; Ethanol results in decreased expression of RAC1 more ... CTD PMID:30143782 Rac1 Rat ethanol multiple interactions EXP 6480464 Ethanol results in decreased expression of [RAC1 protein binds to Guanosine Triphosphate] CTD PMID:20829428 Rac1 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of RAC1 protein CTD PMID:20829428 Rac1 Rat ethanol increases localization ISO RGD:1605432 6480464 Ethanol results in increased localization of RAC1 protein CTD PMID:18182400 Rac1 Rat farnesol multiple interactions ISO RGD:1605432 155230817 Farnasol inhibits the reaction [Ropivacaine decreases activity of RAC1 protein in esophageal carcinoma cells] RGD Rac1 Rat farnesyl diphosphate multiple interactions ISO RGD:1605432 6480464 farnesyl pyrophosphate inhibits the reaction [Simvastatin inhibits the reaction [Lipopolysaccharides results in increased activity of more ... CTD PMID:18625914 Rac1 Rat felodipine multiple interactions ISO RGD:1553531 6480464 Felodipine inhibits the reaction [[APOE gene mutant form affects the susceptibility to Cholesterol, Dietary] which more ... CTD PMID:18287887 Rac1 Rat flavonoids decreases expression ISO RGD:1605432 6480464 Flavonoids results in decreased expression of RAC1 mRNA CTD PMID:15465739 Rac1 Rat flubendazole decreases expression ISO RGD:1605432 6480464 flubendazole results in decreased expression of RAC1 protein CTD PMID:30075109 Rac1 Rat folic acid increases expression ISO RGD:1553531 6480464 Folic Acid results in increased expression of RAC1 mRNA CTD PMID:25629700 Rac1 Rat folic acid multiple interactions ISO RGD:1553531 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RAC1 mRNA CTD PMID:22206623 Rac1 Rat folpet increases expression ISO RGD:1553531 6480464 folpet results in increased expression of RAC1 mRNA CTD PMID:31558096 Rac1 Rat gallic acid decreases expression ISO RGD:1605432 6480464 Gallic Acid results in decreased expression of RAC1 protein CTD PMID:23153558 Rac1 Rat genistein decreases expression ISO RGD:1553531 6480464 Genistein results in decreased expression of RAC1 mRNA CTD PMID:24967385 Rac1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of RAC1 mRNA CTD PMID:22061828 Rac1 Rat geranylgeraniol multiple interactions ISO RGD:1605432 6480464 geranylgeraniol inhibits the reaction [Lovastatin affects the localization of RAC1 protein] CTD PMID:12933658 Rac1 Rat geranylgeraniol multiple interactions ISO RGD:1605432 155230817 Geranylgeraniol inhibits the reaction [Ropivacaine decreases activity of RAC1 protein in esophageal carcinoma cells] RGD Rac1 Rat glucose multiple interactions ISO RGD:1605432 6480464 Atorvastatin inhibits the reaction [Glucose results in increased localization of RAC1 protein]; bisindolylmaleimide I inhibits more ... CTD PMID:17279352|PMID:17916771 Rac1 Rat glucose increases expression ISO RGD:1553531 6480464 Glucose results in increased expression of RAC1 protein CTD PMID:31483951 Rac1 Rat glucose multiple interactions ISO RGD:1553531 6480464 [Resveratrol co-treated with Glucose] results in decreased expression of RAC1 mRNA; Eucalyptol inhibits the reaction more ... CTD PMID:24659233|PMID:31483951 Rac1 Rat glucose multiple interactions EXP 6480464 dorsomorphin inhibits the reaction [Resveratrol inhibits the reaction [Glucose results in increased activity of RAC1 more ... CTD PMID:19854265|PMID:26054749 Rac1 Rat glucose increases activity EXP 6480464 Glucose results in increased activity of RAC1 protein CTD PMID:26054749 Rac1 Rat glucose increases localization ISO RGD:1605432 6480464 Glucose results in increased localization of RAC1 protein CTD PMID:17279352 Rac1 Rat glucose affects localization ISO RGD:1605432 6480464 Glucose affects the localization of RAC1 protein CTD PMID:17916771 Rac1 Rat graphene oxide multiple interactions ISO RGD:1553531 6480464 [[graphene oxide results in increased secretion of HMGB1 protein] which results in increased expression of more ... CTD PMID:31504961 Rac1 Rat GTP multiple interactions ISO RGD:1605432 6480464 Risedronic Acid results in increased abundance of [Guanosine Triphosphate binds to RAC1 protein]; Zoledronic Acid more ... CTD PMID:16734383|PMID:28871336 Rac1 Rat GTP multiple interactions EXP 6480464 Ethanol results in decreased expression of [RAC1 protein binds to Guanosine Triphosphate] CTD PMID:20829428 Rac1 Rat GTP multiple interactions ISO RGD:1553531 6480464 CSF1 protein results in increased abundance of [Guanosine Triphosphate binds to RAC1 protein]; GGTI 298 more ... CTD PMID:16734383 Rac1 Rat guanosine 5'-[gamma-thio]triphosphate multiple interactions ISO RGD:1605432 6480464 Methohexital inhibits the reaction [Guanosine 5'-O-(3-Thiotriphosphate) results in increased activity of RAC1 protein]; Pentobarbital inhibits more ... CTD PMID:15263067 Rac1 Rat GYS32661 decreases expression ISO RGD:1605432 155230818 GYS32661 decreases expression of RAC1 and RAC1b proteins in colorectal carcinoma cells RGD Rac1 Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of RAC1 mRNA CTD PMID:15860345 Rac1 Rat heparin multiple interactions EXP 6480464 Heparin inhibits the reaction [[Lipopolysaccharides co-treated with Ranitidine] results in increased expression of RAC1 mRNA] CTD PMID:16401727 Rac1 Rat indometacin increases expression EXP 6480464 Indomethacin results in increased expression of RAC1 mRNA CTD PMID:36868495 Rac1 Rat irbesartan multiple interactions ISO RGD:1553531 6480464 Cholesterol inhibits the reaction [irbesartan results in increased expression of RAC1 mRNA] CTD PMID:19028402 Rac1 Rat ivermectin decreases expression ISO RGD:1605432 6480464 Ivermectin results in decreased expression of RAC1 protein CTD PMID:32959892 Rac1 Rat ivermectin multiple interactions ISO RGD:1605432 6480464 [Poly I-C co-treated with Ivermectin] results in decreased expression of RAC1 mRNA CTD PMID:34696514 Rac1 Rat kainic acid increases expression EXP 6480464 Kainic Acid results in increased expression of RAC1 mRNA CTD PMID:19700661 Rac1 Rat kanamycin A multiple interactions ISO RGD:1553531 6480464 Kanamycin promotes the reaction [RAC1 binds to NCF2] CTD PMID:16521128 Rac1 Rat L-ascorbic acid multiple interactions ISO RGD:1605432 6480464 Ascorbic Acid promotes the reaction [arsenic trioxide results in increased activity of RAC1 protein] CTD PMID:12239215 Rac1 Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of RAC1 mRNA CTD PMID:11578147 Rac1 Rat lipopolysaccharide multiple interactions ISO RGD:1605432 6480464 Azithromycin inhibits the reaction [Lipopolysaccharides results in increased activity of RAC1 protein]; farnesyl pyrophosphate inhibits more ... CTD PMID:18625914|PMID:21417583 Rac1 Rat lipopolysaccharide increases activity EXP 6480464 Lipopolysaccharides results in increased activity of RAC1 protein CTD PMID:17448908 Rac1 Rat lipopolysaccharide multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with Ranitidine] results in increased expression of RAC1 mRNA; Heparin inhibits the reaction more ... CTD PMID:16401727 Rac1 Rat lipopolysaccharide multiple interactions ISO RGD:1553531 6480464 NSC 23766 inhibits the reaction [Lipopolysaccharides results in increased activity of RAC1 protein] CTD PMID:21511011 Rac1 Rat lipopolysaccharide increases activity ISO RGD:1553531 6480464 Lipopolysaccharides results in increased activity of RAC1 protein CTD PMID:21511011 Rac1 Rat lipopolysaccharide increases prenylation ISO RGD:1605432 6480464 Lipopolysaccharides results in increased prenylation of RAC1 protein CTD PMID:18625914 Rac1 Rat lipopolysaccharide increases localization ISO RGD:1605432 6480464 Lipopolysaccharides results in increased localization of RAC1 protein CTD PMID:18625914 Rac1 Rat lipopolysaccharide increases activity ISO RGD:1605432 6480464 Lipopolysaccharides results in increased activity of RAC1 protein CTD PMID:18625914|PMID:21417583 Rac1 Rat lovastatin multiple interactions ISO RGD:1605432 6480464 geranylgeraniol inhibits the reaction [Lovastatin affects the localization of RAC1 protein]; Mevalonic Acid inhibits the more ... CTD PMID:12933658 Rac1 Rat lovastatin affects localization ISO RGD:1605432 6480464 Lovastatin affects the localization of RAC1 protein CTD PMID:12933658|PMID:21356574 Rac1 Rat lovastatin decreases activity ISO RGD:1605432 6480464 Lovastatin results in decreased activity of RAC1 protein CTD PMID:19360310 Rac1 Rat lovastatin increases expression ISO RGD:1605432 6480464 Lovastatin results in increased expression of RAC1 protein CTD PMID:18766339 Rac1 Rat luteolin decreases expression ISO RGD:1605432 153345548 luteolin decreases expression of RAC1 protein in lung cancer cells RGD Rac1 Rat Maduramicin increases expression EXP 6480464 maduramicin results in increased expression of RAC1 mRNA; maduramicin results in increased expression of RAC1 more ... CTD PMID:33890316 Rac1 Rat mebendazole decreases expression ISO RGD:1605432 6480464 Mebendazole results in decreased expression of RAC1 protein CTD PMID:30075109 Rac1 Rat melittin decreases activity ISO RGD:1605432 6480464 Melitten results in decreased activity of RAC1 protein CTD PMID:18506888 Rac1 Rat mercury atom increases expression ISO RGD:1605432 6480464 Mercury results in increased expression of RAC1 mRNA CTD PMID:16823088 Rac1 Rat mercury dichloride decreases expression EXP 6480464 Mercuric Chloride results in decreased expression of RAC1 protein CTD PMID:22223485 Rac1 Rat mercury(0) increases expression ISO RGD:1605432 6480464 Mercury results in increased expression of RAC1 mRNA CTD PMID:16823088 Rac1 Rat methidathion decreases expression ISO RGD:1553531 6480464 methidathion results in decreased expression of RAC1 mRNA CTD PMID:34813904 Rac1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of RAC1 mRNA CTD PMID:30047161 Rac1 Rat methohexital multiple interactions ISO RGD:1605432 6480464 Methohexital inhibits the reaction [Guanosine 5'-O-(3-Thiotriphosphate) results in increased activity of RAC1 protein] CTD PMID:15263067 Rac1 Rat methotrexate increases expression ISO RGD:1605432 6480464 Methotrexate results in increased expression of RAC1 mRNA CTD PMID:19100307 Rac1 Rat methylmercury chloride decreases expression EXP 6480464 methylmercuric chloride results in decreased expression of RAC1 protein CTD PMID:22223485 Rac1 Rat mevalonic acid multiple interactions ISO RGD:1605432 6480464 Mevalonic Acid inhibits the reaction [Lovastatin affects the localization of RAC1 protein] CTD PMID:12933658 Rac1 Rat mevalonic acid multiple interactions EXP 6480464 Mevalonic Acid inhibits the reaction [Simvastatin results in increased expression of RAC1 protein] CTD PMID:16698853 Rac1 Rat mevastatin multiple interactions ISO RGD:1553531 6480464 mevastatin results in increased abundance of [Guanosine Triphosphate binds to RAC1 protein] CTD PMID:16734383 Rac1 Rat ML-7 increases activity EXP 6480464 ML 7 results in increased activity of RAC1 protein CTD PMID:12105187 Rac1 Rat ML-7 decreases activity EXP 6480464 ML 7 results in decreased activity of RAC1 protein CTD PMID:12745062 Rac1 Rat mycophenolic acid multiple interactions EXP 6480464 Mycophenolic Acid inhibits the reaction [RAC1 protein results in increased abundance of Reactive Oxygen Species] CTD PMID:17950325 Rac1 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased expression of RAC1 protein] CTD PMID:21195169 Rac1 Rat N-acetyl-L-cysteine decreases expression EXP 6480464 Acetylcysteine results in decreased expression of RAC1 protein CTD PMID:21195169 Rac1 Rat N-formyl-L-methionyl-L-leucyl-L-phenylalanine increases activity ISO RGD:1553531 6480464 N-Formylmethionine Leucyl-Phenylalanine results in increased activity of RAC1 protein CTD PMID:16621998|PMID:28779020 Rac1 Rat N-formyl-L-methionyl-L-leucyl-L-phenylalanine multiple interactions EXP 6480464 2-benzyl-3-(4-hydroxymethylphenyl)indazole inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine results in increased activity of RAC1 protein] CTD PMID:19445920 Rac1 Rat N-formyl-L-methionyl-L-leucyl-L-phenylalanine increases activity EXP 6480464 N-Formylmethionine Leucyl-Phenylalanine results in increased activity of RAC1 protein CTD PMID:19445920 Rac1 Rat N-formyl-L-methionyl-L-leucyl-L-phenylalanine multiple interactions ISO RGD:1553531 6480464 6-amino-N-(3-(4-(4-morpholinyl)pyrido(3',2'-4,5)furo(3,2-d)pyrimidin-2-yl)phenyl)-3-pyridinecarboxamide inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine results in increased activity of RAC1 protein]; apilimod inhibits more ... CTD PMID:16621998|PMID:28779020 Rac1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of RAC1 protein CTD PMID:28804948 Rac1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 Plant Extracts inhibits the reaction [Diethylnitrosamine results in increased expression of RAC1 protein] CTD PMID:28804948 Rac1 Rat N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with Ranitidine] results in increased expression of RAC1 mRNA; Heparin inhibits the reaction more ... CTD PMID:16401727 Rac1 Rat nebivolol multiple interactions EXP 6480464 Nebivolol inhibits the reaction [AGT protein results in increased expression of RAC1 protein] CTD PMID:16940222 Rac1 Rat nitrates multiple interactions ISO RGD:1553531 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of RAC1 more ... CTD PMID:35964746 Rac1 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of RAC1 mRNA; nitrofen results in increased expression of RAC1 more ... CTD PMID:26543024 Rac1 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of RAC1 mRNA; nitrofen results in decreased expression of RAC1 more ... CTD PMID:28683507 Rac1 Rat NSC 23766 decreases activity ISO RGD:1553531 6480464 NSC 23766 results in decreased activity of RAC1 protein CTD PMID:21511011|PMID:28710503 Rac1 Rat NSC 23766 multiple interactions ISO RGD:1605432 6480464 NSC 23766 inhibits the reaction [sodium arsenite results in increased activity of RAC1 protein]; NSC more ... CTD PMID:19349368|PMID:22166487 Rac1 Rat NSC 23766 multiple interactions ISO RGD:1553531 6480464 NSC 23766 inhibits the reaction [Lipopolysaccharides results in increased activity of RAC1 protein]; NSC 23766 more ... CTD PMID:21511011|PMID:31018152 Rac1 Rat Nutlin-3 multiple interactions ISO RGD:1605432 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of RAC1 protein CTD PMID:38460933 Rac1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of RAC1 mRNA CTD PMID:25729387 Rac1 Rat ozone multiple interactions ISO RGD:1605432 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of RAC1 mRNA; [Oxygen more ... CTD PMID:32992648 Rac1 Rat p-tert-Amylphenol increases expression EXP 6480464 4-tert-octylphenol results in increased expression of RAC1 mRNA CTD PMID:17011747 Rac1 Rat paclitaxel decreases expression ISO RGD:1605432 6480464 Paclitaxel results in decreased expression of RAC1 mRNA CTD PMID:15000894 Rac1 Rat pamidronate multiple interactions ISO RGD:1605432 153345545 pamidronate increases expression of RAC1 mRNA in cholangiocarcinoma cells, pamidronate decreases expression of RAC1 protein more ... RGD Rac1 Rat PD 0325901 affects response to substance ISO RGD:1605432 6480464 RAC1 protein alternative form affects the susceptibility to mirdametinib CTD PMID:23033341 Rac1 Rat pentobarbital multiple interactions ISO RGD:1605432 6480464 Pentobarbital inhibits the reaction [Guanosine 5'-O-(3-Thiotriphosphate) results in increased activity of RAC1 protein] CTD PMID:15263067 Rac1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1553531 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RAC1 mRNA CTD PMID:36331819 Rac1 Rat phenylephrine increases activity EXP 6480464 Phenylephrine results in increased activity of RAC1 protein CTD PMID:11158304 Rac1 Rat phorbol 13-acetate 12-myristate multiple interactions ISO RGD:1605432 6480464 [Tetradecanoylphorbol Acetate co-treated with Arsenic Trioxide] results in increased expression of RAC1 mRNA; [Tetradecanoylphorbol Acetate more ... CTD PMID:18922899|PMID:21705328 Rac1 Rat phorbol 13-acetate 12-myristate increases expression ISO RGD:1605432 6480464 Tetradecanoylphorbol Acetate results in increased expression of RAC1 mRNA; Tetradecanoylphorbol Acetate results in increased expression more ... CTD PMID:18922899|PMID:28527916 Rac1 Rat picoxystrobin decreases expression ISO RGD:1605432 6480464 picoxystrobin results in decreased expression of RAC1 mRNA CTD PMID:33512557 Rac1 Rat plitidepsin increases activity ISO RGD:1605432 6480464 plitidepsin results in increased activity of RAC1 protein CTD PMID:18089842 Rac1 Rat poly(I:C) multiple interactions EXP 6480464 [Poly I-C co-treated with HU 211] results in decreased expression of RAC1 mRNA CTD PMID:26923065 Rac1 Rat poly(I:C) multiple interactions ISO RGD:1605432 6480464 [Poly I-C co-treated with Atorvastatin] results in decreased expression of RAC1 mRNA; [Poly I-C co-treated more ... CTD PMID:34696514 Rac1 Rat potassium chromate increases expression ISO RGD:1605432 6480464 potassium chromate(VI) results in increased expression of RAC1 mRNA CTD PMID:22079256 Rac1 Rat potassium chromate multiple interactions ISO RGD:1605432 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of RAC1 mRNA CTD PMID:22079256 Rac1 Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of RAC1 mRNA CTD PMID:30047161 Rac1 Rat puerarin multiple interactions EXP 6480464 puerarin inhibits the reaction [Glucose results in increased phosphorylation of and affects the localization of more ... CTD PMID:19854265 Rac1 Rat pyrrolidine dithiocarbamate multiple interactions ISO RGD:1605432 6480464 pyrrolidine dithiocarbamic acid inhibits the reaction [RAC1 protein inhibits the reaction [Oxygen deficiency results in more ... CTD PMID:12719791 Rac1 Rat ranitidine multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with Ranitidine] results in increased expression of RAC1 mRNA; Heparin inhibits the reaction more ... CTD PMID:16401727 Rac1 Rat reactive oxygen species multiple interactions ISO RGD:1605432 6480464 RAC1 protein mutant form inhibits the reaction [TNF protein results in increased abundance of Reactive more ... CTD PMID:10973919|PMID:14576080 Rac1 Rat reactive oxygen species increases abundance EXP 6480464 RAC1 protein results in increased abundance of Reactive Oxygen Species CTD PMID:17950325 Rac1 Rat reactive oxygen species multiple interactions EXP 6480464 Mycophenolic Acid inhibits the reaction [RAC1 protein results in increased abundance of Reactive Oxygen Species] CTD PMID:17950325 Rac1 Rat reactive oxygen species increases abundance ISO RGD:1605432 6480464 RAC1 protein results in increased abundance of Reactive Oxygen Species CTD PMID:12719791 Rac1 Rat resveratrol affects localization ISO RGD:1605432 6480464 resveratrol affects the localization of RAC1 protein CTD PMID:17194732 Rac1 Rat resveratrol multiple interactions ISO RGD:1553531 6480464 [resveratrol co-treated with Glucose] results in decreased expression of RAC1 mRNA CTD PMID:24659233 Rac1 Rat resveratrol multiple interactions EXP 6480464 dorsomorphin inhibits the reaction [Resveratrol inhibits the reaction [Glucose results in increased activity of RAC1 more ... CTD PMID:26054749 Rac1 Rat rimonabant multiple interactions ISO RGD:1553531 6480464 Rimonabant inhibits the reaction [Ethanol promotes the reaction [EHMT2 protein binds to RAC1 promoter]]; Rimonabant more ... CTD PMID:30143782 Rac1 Rat Risedronate sodium multiple interactions ISO RGD:1605432 6480464 Risedronic Acid results in increased abundance of [Guanosine Triphosphate binds to RAC1 protein] CTD PMID:16734383 Rac1 Rat Risedronate sodium multiple interactions ISO RGD:1553531 6480464 Risedronic Acid promotes the reaction [CSF1 protein results in increased abundance of [Guanosine Triphosphate binds more ... CTD PMID:16734383 Rac1 Rat Risedronate sodium decreases geranoylation ISO RGD:1553531 6480464 Risedronic Acid results in decreased geranoylation of RAC1 protein CTD PMID:16734383 Rac1 Rat ropivacaine decreases activity ISO RGD:1605432 155230817 Ropivacaine decreases activity of RAC1 protein in esophageal carcinoma cells RGD Rac1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of RAC1 protein CTD PMID:22223485 Rac1 Rat ruxolitinib multiple interactions ISO RGD:1605432 6480464 [ruxolitinib co-treated with Arsenic Trioxide] results in increased expression of RAC1 mRNA CTD PMID:30012499 Rac1 Rat secobarbital multiple interactions ISO RGD:1605432 6480464 Secobarbital inhibits the reaction [Guanosine 5'-O-(3-Thiotriphosphate) results in increased activity of RAC1 protein] CTD PMID:15263067 Rac1 Rat serpentine asbestos increases activity ISO RGD:1553531 6480464 Asbestos, Serpentine results in increased activity of RAC1 protein CTD PMID:19684199 Rac1 Rat serpentine asbestos multiple interactions ISO RGD:1553531 6480464 RAC1 protein affects the reaction [Asbestos, Serpentine results in increased expression of TNF mRNA]; RAC1 more ... CTD PMID:19684199 Rac1 Rat serpentine asbestos decreases response to substance ISO RGD:1553531 6480464 RAC1 gene mutant form results in decreased susceptibility to Asbestos, Serpentine CTD PMID:19684199 Rac1 Rat serpentine asbestos multiple interactions ISO RGD:1605432 6480464 RAC1 protein inhibits the reaction [Asbestos, Serpentine results in increased secretion of TNF protein] CTD PMID:19684199 Rac1 Rat sevoflurane multiple interactions EXP 6480464 PHLDA1 protein promotes the reaction [Sevoflurane results in increased expression of and results in increased more ... CTD PMID:36155068 Rac1 Rat sevoflurane decreases expression ISO RGD:1553531 6480464 Sevoflurane results in decreased expression of RAC1 protein CTD PMID:35249202 Rac1 Rat sevoflurane increases phosphorylation EXP 6480464 Sevoflurane results in increased phosphorylation of RAC1 protein CTD PMID:36155068 Rac1 Rat simvastatin multiple interactions ISO RGD:1605432 6480464 Cholesterol inhibits the reaction [Simvastatin affects the localization of and results in decreased activity of more ... CTD PMID:17513949|PMID:18625914|PMID:21334995 Rac1 Rat simvastatin decreases activity ISO RGD:1553531 6480464 Simvastatin results in decreased activity of RAC1 protein CTD PMID:17169357 Rac1 Rat simvastatin increases activity ISO RGD:1553531 6480464 Simvastatin results in increased activity of RAC1 protein CTD PMID:19332549 Rac1 Rat simvastatin decreases expression ISO RGD:1605432 6480464 Simvastatin results in decreased expression of RAC1 CTD PMID:17303772 Rac1 Rat simvastatin decreases activity ISO RGD:1605432 6480464 Simvastatin results in decreased activity of RAC1 protein CTD PMID:19360310 Rac1 Rat simvastatin increases expression EXP 6480464 Simvastatin results in increased expression of RAC1 protein CTD PMID:16698853 Rac1 Rat simvastatin multiple interactions EXP 6480464 Mevalonic Acid inhibits the reaction [Simvastatin results in increased expression of RAC1 protein] CTD PMID:16698853 Rac1 Rat simvastatin affects localization ISO RGD:1605432 6480464 Simvastatin affects the localization of RAC1 protein CTD PMID:20045437 Rac1 Rat sirolimus decreases expression EXP 6480464 Sirolimus results in decreased expression of RAC1 protein CTD PMID:21195169 Rac1 Rat sirolimus multiple interactions EXP 6480464 Sirolimus inhibits the reaction [Cadmium Chloride results in increased expression of RAC1 protein] CTD PMID:21195169 Rac1 Rat sodium arsenate multiple interactions ISO RGD:1605432 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of RAC1 more ... CTD PMID:32525701 Rac1 Rat sodium arsenite multiple interactions ISO RGD:1605432 6480464 [Ethanol co-treated with sodium arsenite] results in increased localization of RAC1 protein; NSC 23766 inhibits more ... CTD PMID:18182400|PMID:19349368 Rac1 Rat sodium arsenite increases expression ISO RGD:1553531 6480464 sodium arsenite results in increased expression of RAC1 protein CTD PMID:29044176 Rac1 Rat sodium arsenite decreases expression ISO RGD:1553531 6480464 sodium arsenite results in decreased expression of RAC1 mRNA CTD PMID:31233874 Rac1 Rat sodium arsenite multiple interactions ISO RGD:1553531 6480464 RAC1 protein affects the reaction [sodium arsenite results in increased expression of PECAM1 protein] CTD PMID:19033667 Rac1 Rat sodium arsenite increases localization ISO RGD:1605432 6480464 sodium arsenite results in increased localization of RAC1 protein CTD PMID:18182400 Rac1 Rat sodium arsenite increases activity ISO RGD:1605432 6480464 sodium arsenite results in increased activity of RAC1 protein CTD PMID:19349368|PMID:22634503 Rac1 Rat sodium chloride multiple interactions EXP 6480464 [Desoxycorticosterone co-treated with Sodium Chloride] results in increased expression of RAC1 protein CTD PMID:22431579 Rac1 Rat sodium chloride increases activity ISO RGD:1553531 6480464 Sodium Chloride results in increased activity of RAC1 protein CTD PMID:15975986 Rac1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of RAC1 mRNA CTD PMID:25993096 Rac1 Rat spironolactone decreases expression EXP 6480464 Spironolactone results in decreased expression of RAC1 protein CTD PMID:19114643 Rac1 Rat streptozocin multiple interactions ISO RGD:1553531 6480464 Atorvastatin inhibits the reaction [Streptozocin results in increased activity of and results in increased localization more ... CTD PMID:17279352 Rac1 Rat streptozocin increases activity EXP 6480464 Streptozocin results in increased activity of RAC1 protein CTD PMID:17589825 Rac1 Rat streptozocin multiple interactions EXP 6480464 Atorvastatin inhibits the reaction [Streptozocin results in increased activity of RAC1 protein] CTD PMID:17589825 Rac1 Rat styrene oxide decreases expression ISO RGD:1553531 6480464 styrene oxide results in decreased expression of RAC1 protein CTD PMID:17662326 Rac1 Rat sucrose increases activity ISO RGD:1553531 6480464 Sucrose results in increased activity of RAC1 protein CTD PMID:15975986 Rac1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of RAC1 mRNA CTD PMID:30047161 Rac1 Rat sunitinib increases expression ISO RGD:1605432 6480464 Sunitinib results in increased expression of RAC1 mRNA CTD PMID:31533062 Rac1 Rat tacrolimus hydrate increases expression EXP 6480464 Tacrolimus results in increased expression of RAC1 mRNA CTD PMID:17085464 Rac1 Rat tetrachloromethane increases expression ISO RGD:1553531 6480464 Carbon Tetrachloride results in increased expression of RAC1 mRNA CTD PMID:15056808 Rac1 Rat thiamylal multiple interactions ISO RGD:1605432 6480464 Thiamylal inhibits the reaction [Guanosine 5'-O-(3-Thiotriphosphate) results in increased activity of RAC1 protein] CTD PMID:15263067 Rac1 Rat titanium dioxide decreases methylation ISO RGD:1553531 6480464 titanium dioxide results in decreased methylation of RAC1 promoter CTD PMID:35295148 Rac1 Rat titanium dioxide increases methylation ISO RGD:1553531 6480464 titanium dioxide results in increased methylation of RAC1 gene CTD PMID:35295148 Rac1 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of RAC1 mRNA CTD PMID:25729387 Rac1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of RAC1 mRNA CTD PMID:25729387 Rac1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of RAC1 mRNA CTD PMID:33387578 Rac1 Rat trichostatin A decreases expression ISO RGD:1605432 6480464 trichostatin A results in decreased expression of RAC1 mRNA CTD PMID:19606018 Rac1 Rat triclosan increases activity ISO RGD:1605432 153345549 Triclosan increases activity of RAC1 protein in lung cancer cells RGD Rac1 Rat trimethyltin increases expression ISO RGD:1553531 6480464 trimethyltin results in increased expression of RAC1 mRNA CTD PMID:20833246 Rac1 Rat triphenyl phosphate affects expression ISO RGD:1605432 6480464 triphenyl phosphate affects the expression of RAC1 mRNA CTD PMID:37042841 Rac1 Rat Triptolide decreases expression EXP 6480464 triptolide results in decreased expression of RAC1 mRNA CTD PMID:27554044 Rac1 Rat Tubeimoside II multiple interactions ISO RGD:1605432 6480464 tubeimoside II inhibits the reaction [TGFB1 protein results in increased activity of RAC1 protein] CTD PMID:33412154 Rac1 Rat uranium atom affects expression ISO RGD:1605432 6480464 Uranium affects the expression of RAC1 mRNA CTD PMID:15672453 Rac1 Rat ursodeoxycholic acid multiple interactions ISO RGD:1605432 6480464 RAC1 mutant form inhibits the reaction [Ursodeoxycholic Acid results in increased expression of TNFRSF10B] CTD PMID:21362627 Rac1 Rat ursodeoxycholic acid affects expression ISO RGD:1605432 6480464 Ursodeoxycholic Acid affects the expression of RAC1 mRNA CTD PMID:18422935 Rac1 Rat valproic acid decreases expression ISO RGD:1553531 6480464 Valproic Acid results in decreased expression of RAC1 mRNA CTD PMID:21427059 Rac1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of RAC1 mRNA CTD PMID:18629315 Rac1 Rat Y-27632 increases activity EXP 6480464 Y 27632 results in increased activity of RAC1 protein CTD PMID:12105187 Rac1 Rat zinc dichloride multiple interactions ISO RGD:1553531 6480464 RAC1 protein affects the reaction [zinc chloride results in increased activity of MAPK8 protein] CTD PMID:11306679 Rac1 Rat zinc oxide multiple interactions ISO RGD:1605432 6480464 [RAC1 protein binds to CDC42 protein] affects the reaction [Zinc Oxide results in increased expression more ... CTD PMID:22166487 Rac1 Rat zoledronic acid multiple interactions ISO RGD:1553531 6480464 zoledronic acid results in increased abundance of [Guanosine Triphosphate binds to RAC1 protein] CTD PMID:16734383 Rac1 Rat zoledronic acid increases expression ISO RGD:1605432 6480464 zoledronic acid results in increased expression of RAC1 protein CTD PMID:28871336 Rac1 Rat zoledronic acid multiple interactions ISO RGD:1605432 6480464 zoledronic acid results in increased expression of [RAC1 protein binds to Guanosine Triphosphate] CTD PMID:28871336
Biological Process
Only show annotations with direct experimental evidence (0 objects hidden)
Rac1 Rat actin cytoskeleton organization IDA 1599401 RGD Rac1 Rat actin cytoskeleton organization acts_upstream_of_or_within ISO RGD:1605432 1624291 UniProtKB:P17105 PMID:19890013 RGD PMID:19890013 Rac1 Rat actin filament organization IMP 4145648 RGD Rac1 Rat actin filament organization involved_in IBA FB:FBgn0010333|FB:FBgn0010341|FB:FBgn0014011|FB:FBgn0014020|FB:FBgn0039532|MGI:108446|MGI:1096342|MGI:97845|PANTHER:PTN000632671|RGD:619755|RGD:71043|UniProtKB:P15153|UniProtKB:P60953|UniProtKB:P61586|UniProtKB:P63000|UniProtKB:Q58E25|UniProtKB:Q92730|UniProtKB:Q9HBH0|WB:WBGene00003239|WB:WBGene00004287|dictyBase:DDB_G0269178|dictyBase:DDB_G0279605 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Rac1 Rat actin filament organization involved_in ISO RGD:1605432 1624291 PMID:22796473 RGD PMID:22796473 Rac1 Rat actin filament organization involved_in ISS UniProtKB:P63000 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Rac1 Rat actin filament polymerization acts_upstream_of_or_within ISO RGD:1553531 1624291 PMID:22750946 RGD PMID:22750946 Rac1 Rat anatomical structure arrangement acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:2663662|MGI:2663669 PMID:20016102 RGD PMID:20016102 Rac1 Rat angiotensin-activated signaling pathway involved in heart process acts_upstream_of_or_within ISO RGD:1553531 1624291 PMID:26975711 RGD PMID:26975711 Rac1 Rat auditory receptor cell morphogenesis acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:2663662|MGI:2663669 PMID:20016102 RGD PMID:20016102 Rac1 Rat axon guidance acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:1932522|MGI:2663662 PMID:17409253 RGD PMID:17409253 Rac1 Rat bone resorption IDA 1599401 RGD Rac1 Rat cell adhesion acts_upstream_of_or_within ISO RGD:1553531 1624291 PMID:14657280 RGD PMID:14657280 Rac1 Rat cell chemotaxis involved_in IBA PANTHER:PTN008604698|RGD:619755|ZFIN:ZDB-GENE-030131-5415 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Rac1 Rat cell migration involved_in ISO RGD:1605432 1624291 PMID:23512198, PMID:26934001 RGD PMID:23512198|PMID:26934001 Rac1 Rat cell migration acts_upstream_of_or_within ISO RGD:1553531 1624291 PMID:15728191 RGD PMID:15728191 Rac1 Rat cell motility involved_in ISO RGD:1605432 1624291 PMID:19403692 RGD PMID:19403692 Rac1 Rat cell motility involved_in ISS UniProtKB:P63000 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Rac1 Rat cell projection assembly involved_in IBA FB:FBgn0010333|FB:FBgn0014011|MGI:97845|PANTHER:PTN002784640|UniProtKB:P60763|UniProtKB:P63000 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Rac1 Rat cell-cell junction organization acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:2663662|MGI:2663669 PMID:20016102 RGD PMID:20016102 Rac1 Rat cellular response to mechanical stimulus IDA 1299247 RGD Rac1 Rat cerebral cortex GABAergic interneuron development acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:2180784 PMID:23258346 RGD PMID:23258346 Rac1 Rat cerebral cortex radially oriented cell migration acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:1932522|MGI:2663662 PMID:17409253 RGD PMID:17409253 Rac1 Rat chemotaxis involved_in IBA MGI:97846|PANTHER:PTN008604830|ZFIN:ZDB-GENE-040625-27 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Rac1 Rat chemotaxis IMP 1299245 RGD Rac1 Rat cochlea morphogenesis acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:2663662|MGI:2663669 PMID:20016102 RGD PMID:20016102 Rac1 Rat cortical cytoskeleton organization involved_in IBA FB:FBgn0010333|PANTHER:PTN001530052|TAIR:locus:2131606|TAIR:locus:2198566|dictyBase:DDB_G0280975 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Rac1 Rat cytoskeleton organization acts_upstream_of_or_within ISO RGD:1553531 1624291 PMID:14657280 RGD PMID:14657280 Rac1 Rat dendrite development acts_upstream_of_or_within ISO RGD:1553531 1624291 PMID:12213441 RGD PMID:12213441 Rac1 Rat dendrite morphogenesis acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:1891740 PMID:20335472 RGD PMID:20335472 Rac1 Rat dopaminergic neuron differentiation acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:98958 PMID:18953410 RGD PMID:18953410 Rac1 Rat embryonic olfactory bulb interneuron precursor migration acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:1932522|MGI:2663662 PMID:17409253 RGD PMID:17409253 Rac1 Rat endocytosis acts_upstream_of_or_within ISO RGD:1553531 1624291 PMID:12446704 RGD PMID:12446704 Rac1 Rat engulfment of apoptotic cell involved_in ISO RGD:1553531 1624291 PMID:20691665 RGD PMID:20691665 Rac1 Rat enzyme-linked receptor protein signaling pathway involved_in ISO RGD:1553531 1624291 MGI:104683 PMID:14622576 RGD PMID:14622576 Rac1 Rat epithelial cell morphogenesis acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:2663662|MGI:2663669 PMID:20016102 RGD PMID:20016102 Rac1 Rat erythrocyte enucleation acts_upstream_of_or_within ISO RGD:1553531 1624291 PMID:18264091 RGD PMID:18264091 Rac1 Rat establishment or maintenance of cell polarity involved_in IBA FB:FBgn0010333|PANTHER:PTN001530052|UniProtKB:Q4WWL5|WB:WBGene00000424 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Rac1 Rat forebrain development involved_in ISO RGD:1553531 1624291 PMID:19007770 RGD PMID:19007770 Rac1 Rat G protein-coupled receptor signaling pathway acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:3040696|MGI:98923 PMID:21178006 RGD PMID:21178006 Rac1 Rat heart process acts_upstream_of_or_within ISO RGD:1553531 1624291 PMID:26975711 RGD PMID:26975711 Rac1 Rat hepatocyte growth factor receptor signaling pathway involved_in ISO RGD:1605432 1624291 PMID:25198505 RGD PMID:25198505 Rac1 Rat homeostasis of number of cells within a tissue acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:2180784 PMID:23258346 RGD PMID:23258346 Rac1 Rat hyperosmotic response acts_upstream_of_or_within ISO RGD:1553531 1624291 PMID:12783890 RGD PMID:12783890 Rac1 Rat interneuron migration acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:1932522|MGI:2663662 PMID:17409253 RGD PMID:17409253 Rac1 Rat lamellipodium assembly involved_in ISO RGD:1605432 1624291 PMID:9312003 RGD PMID:9312003 Rac1 Rat lamellipodium assembly acts_upstream_of_or_within ISO RGD:1553531 1624291 PMID:15728191 RGD PMID:15728191 Rac1 Rat localization within membrane involved_in ISO RGD:1605432 1624291 PMID:16636067 RGD PMID:16636067 Rac1 Rat mast cell chemotaxis IMP 4145648 RGD Rac1 Rat midbrain dopaminergic neuron differentiation involved_in ISO RGD:1553531 1624291 PMID:18953410, PMID:23109420 RGD PMID:18953410|PMID:23109420 Rac1 Rat motor neuron axon guidance involved_in IBA FB:FBgn0010333|PANTHER:PTN002784640|WB:WBGene00000424|WB:WBGene00004287 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Rac1 Rat negative regulation of fibroblast migration involved_in ISO RGD:1605432 1624291 PMID:19126672 RGD PMID:19126672 Rac1 Rat negative regulation of interleukin-23 production involved_in ISO RGD:1605432 1624291 PMID:16982892 RGD PMID:16982892 Rac1 Rat neuron migration involved_in ISS UniProtKB:P63001 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Rac1 Rat neuron migration acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:1932522|MGI:2663662 PMID:17409253 RGD PMID:17409253 Rac1 Rat neuron migration involved_in ISO RGD:1553531 1624291 PMID:22959435 RGD PMID:22959435 Rac1 Rat neuron projection morphogenesis involved_in ISO RGD:1553531 1624291 UniProtKB:P22725 PMID:21483795 RGD PMID:21483795 Rac1 Rat non-canonical Wnt signaling pathway involved_in ISO RGD:1553531 1624291 UniProtKB:P22725 PMID:21483795 RGD PMID:21483795 Rac1 Rat phagocytosis, engulfment involved_in ISO RGD:1553531 1624291 PMID:10934045 RGD PMID:10934045 Rac1 Rat positive regulation of actin filament polymerization acts_upstream_of_or_within ISO RGD:1553531 1624291 PMID:12853475 RGD PMID:12853475 Rac1 Rat positive regulation of bicellular tight junction assembly involved_in ISS UniProtKB:P63000 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Rac1 Rat positive regulation of bicellular tight junction assembly involved_in ISO RGD:1605432 1624291 PMID:22796473 RGD PMID:22796473 Rac1 Rat positive regulation of cell-substrate adhesion involved_in ISO RGD:1605432 1624291 UniProtKB:P48059|UniProtKB:Q15404 PMID:20926685 RGD PMID:20926685 Rac1 Rat positive regulation of dendritic spine development acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:2685385 PMID:25865668 RGD PMID:25865668 Rac1 Rat positive regulation of DNA replication IMP 2293350 RGD Rac1 Rat positive regulation of endothelial cell migration involved_in ISO RGD:1605432 1624291 PMID:18558630 RGD PMID:18558630 Rac1 Rat positive regulation of filopodium assembly IMP 2314386 RGD Rac1 Rat positive regulation of focal adhesion assembly involved_in ISO RGD:1605432 1624291 PMID:23129259 RGD PMID:23129259 Rac1 Rat positive regulation of insulin secretion involved in cellular response to glucose stimulus IMP 14392803 RGD Rac1 Rat positive regulation of insulin secretion involved in cellular response to glucose stimulus involved_in ISO RGD:1553531 1624291 PMID:23412604 RGD PMID:23412604 Rac1 Rat positive regulation of lamellipodium assembly involved_in ISO RGD:1605432 1624291 PMID:19625648, PMID:8625410 RGD PMID:19625648|PMID:8625410 Rac1 Rat positive regulation of lamellipodium assembly involved_in IBA MGI:97846|PANTHER:PTN008604830|UniProtKB:P15153 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Rac1 Rat positive regulation of lamellipodium assembly acts_upstream_of_or_within ISO RGD:1605432 1624291 PMID:15467718 RGD PMID:15467718 Rac1 Rat positive regulation of lamellipodium assembly IMP 1299247 RGD Rac1 Rat positive regulation of microtubule polymerization involved_in ISO RGD:1605432 1624291 PMID:25198505 RGD PMID:25198505 Rac1 Rat positive regulation of neutrophil chemotaxis involved_in ISO RGD:1605432 1624291 PMID:19625648 RGD PMID:19625648 Rac1 Rat positive regulation of neutrophil chemotaxis involved_in ISO RGD:1553531 1624291 PMID:19625648 RGD PMID:19625648 Rac1 Rat positive regulation of ovarian follicle development involved_in ISO RGD:1553531 1624291 PMID:27050391 RGD PMID:27050391 Rac1 Rat positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction acts_upstream_of_or_within ISO RGD:1553531 1624291 PMID:15728722 RGD PMID:15728722 Rac1 Rat positive regulation of protein phosphorylation involved_in ISS UniProtKB:P63000 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Rac1 Rat positive regulation of protein phosphorylation involved_in ISO RGD:1605432 1624291 PMID:23633677 RGD PMID:23633677 Rac1 Rat positive regulation of ruffle assembly acts_upstream_of_or_within ISO RGD:1605432 1624291 PMID:15467718 RGD PMID:15467718 Rac1 Rat positive regulation of skeletal muscle acetylcholine-gated channel clustering involved_in ISO RGD:1553531 1624291 MGI:104683 PMID:14622576 RGD PMID:14622576 Rac1 Rat positive regulation of stress fiber assembly involved_in ISO RGD:1605432 1624291 PMID:23129259, PMID:8625410 RGD PMID:23129259|PMID:8625410 Rac1 Rat positive regulation of substrate adhesion-dependent cell spreading involved_in ISO RGD:1605432 1624291 PMID:23129259 RGD PMID:23129259 Rac1 Rat postsynaptic actin cytoskeleton organization involved_in IDA 13702191 PMID:25284783 SynGO Rac1 Rat postsynaptic actin cytoskeleton organization involved_in EXP 13702191 PMID:25284783 SynGO Rac1 Rat postsynaptic actin cytoskeleton organization involved_in IMP 13702191 PMID:25284783 SynGO Rac1 Rat protein localization to plasma membrane acts_upstream_of_or_within ISO RGD:1553531 1624291 PMID:23184663 RGD PMID:23184663 Rac1 Rat quinolinate biosynthetic process acts_upstream_of_or_within ISO RGD:1553531 1624291 PMID:2419335 RGD PMID:2419335 Rac1 Rat Rac protein signal transduction involved_in IBA MGI:97845|PANTHER:PTN002784640 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Rac1 Rat Rac protein signal transduction TAS 1299245 RGD Rac1 Rat Rac protein signal transduction involved_in ISO RGD:1553531 1624291 MGI:104683 PMID:14622576 RGD PMID:14622576 Rac1 Rat regulation of actin cytoskeleton organization involved_in IBA MGI:97845|PANTHER:PTN001530052|TAIR:locus:2080878|UniProtKB:P63000|dictyBase:DDB_G0268622|dictyBase:DDB_G0269240|dictyBase:DDB_G0277869|dictyBase:DDB_G0279605|dictyBase:DDB_G0293526 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Rac1 Rat regulation of cell adhesion involved in heart morphogenesis involved_in ISO RGD:1553531 1624291 PMID:25514037 RGD PMID:25514037 Rac1 Rat regulation of cell migration involved_in ISS UniProtKB:P63000 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Rac1 Rat regulation of cell migration involved_in ISO RGD:1605432 1624291 PMID:19934221, PMID:22036506 RGD PMID:19934221|PMID:22036506 Rac1 Rat regulation of cell morphogenesis acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:2180784 PMID:23258346 RGD PMID:23258346 Rac1 Rat regulation of cell shape involved_in IBA FB:FBgn0010333|FB:FBgn0014011|PANTHER:PTN001530052|dictyBase:DDB_G0268622 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Rac1 Rat regulation of cell size involved_in ISO RGD:1605432 1624291 UniProtKB:P35241 PMID:22467863 RGD PMID:22467863 Rac1 Rat regulation of ERK5 cascade acts_upstream_of_or_within ISO RGD:1553531 1624291 PMID:26975711 RGD PMID:26975711 Rac1 Rat regulation of fibroblast migration involved_in ISO RGD:1553531 1624291 PMID:25074804 RGD PMID:25074804 Rac1 Rat regulation of lamellipodium assembly involved_in ISO RGD:1605432 1624291 UniProtKB:P42768 PMID:8625410 RGD PMID:8625410 Rac1 Rat regulation of neuron maturation acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:2180784 PMID:23258346 RGD PMID:23258346 Rac1 Rat regulation of neuron migration acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:1932522|MGI:2663662 PMID:17409253 RGD PMID:17409253 Rac1 Rat regulation of neuronal synaptic plasticity acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:2685385 PMID:25865668 RGD PMID:25865668 Rac1 Rat regulation of neutrophil migration involved_in IBA MGI:97846|PANTHER:PTN002784641|UniProtKB:P15153|ZFIN:ZDB-GENE-040625-27 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Rac1 Rat regulation of neutrophil migration involved_in IBA MGI:97845|PANTHER:PTN002514669|UniProtKB:P63000 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Rac1 Rat regulation of nitric oxide biosynthetic process involved_in IGI UniProtKB:P97710 13792550 PMID:16055727 ARUK-UCL Rac1 Rat regulation of postsynapse assembly involved_in ISO RGD:1553531 1624291 PMID:31369617 RGD PMID:31369617 Rac1 Rat regulation of receptor signaling pathway via JAK-STAT involved_in ISO RGD:1553531 1624291 PMID:27050391 RGD PMID:27050391 Rac1 Rat regulation of respiratory burst involved_in ISO RGD:1605432 1624291 PMID:16636067 RGD PMID:16636067 Rac1 Rat regulation of stress fiber assembly involved_in ISO RGD:1605432 1624291 UniProtKB:P42768 PMID:8625410 RGD PMID:8625410 Rac1 Rat regulation of synaptic vesicle endocytosis involved_in ISO RGD:1553531 1624291 PMID:34269176 RGD PMID:34269176 Rac1 Rat response to lipopolysaccharide acts_upstream_of_or_within ISO RGD:1553531 1624291 PMID:35263589 RGD PMID:35263589 Rac1 Rat response to lipopolysaccharide involved_in ISO RGD:1553531 1624291 PMID:35263589 RGD PMID:35263589 Rac1 Rat ruffle assembly involved_in ISO RGD:1553531 1624291 PMID:10934045 RGD PMID:10934045 Rac1 Rat ruffle assembly involved_in ISO RGD:1605432 1624291 PMID:10036235 RGD PMID:10036235 Rac1 Rat semaphorin-plexin signaling pathway involved_in IMP 8554409 PMID:20696765 UniProt Rac1 Rat signal transduction involved_in IBA CGD:CAL0000192659|FB:FBgn0010333|FB:FBgn0010341|FB:FBgn0014011|FB:FBgn0039532|MGI:106211|MGI:108446|MGI:1096342|MGI:1916831|MGI:1931551|MGI:97845|MGI:97846|PANTHER:PTN000632671|RGD:619755|RGD:619921|SGD:S000004219|SGD:S000006369|TAIR:locus:2827916|UniProtKB:I3LVS7|UniProtKB:P17081|UniProtKB:P60763|UniProtKB:P60953|UniProtKB:P61586|UniProtKB:P63000|UniProtKB:P84095|UniProtKB:Q8IXI1|UniProtKB:Q8IXI2|WB:WBGene00000424|WB:WBGene00003239|ZFIN:ZDB-GENE-030131-8783|ZFIN:ZDB-GENE-040322-2|dictyBase:DDB_G0268622|dictyBase:DDB_G0269178|dictyBase:DDB_G0277869|dictyBase:DDB_G0280975|dictyBase:DDB_G0293526 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Rac1 Rat small GTPase-mediated signal transduction involved_in ISO RGD:1605432 1624291 PMID:26934001 RGD PMID:26934001 Rac1 Rat small GTPase-mediated signal transduction acts_upstream_of_or_within ISO RGD:1553531 1624291 PMID:12525493, PMID:23967341 RGD PMID:12525493|PMID:23967341 Rac1 Rat small GTPase-mediated signal transduction involved_in IEA InterPro:IPR003578 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Rac1 Rat sphingosine-1-phosphate receptor signaling pathway involved_in ISO RGD:1605432 1624291 PMID:18558630 RGD PMID:18558630 Rac1 Rat substrate adhesion-dependent cell spreading involved_in ISS UniProtKB:P63000 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Rac1 Rat substrate adhesion-dependent cell spreading acts_upstream_of_or_within ISO RGD:1553531 1624291 PMID:18156211 RGD PMID:18156211 Rac1 Rat substrate adhesion-dependent cell spreading involved_in ISO RGD:1553531 1624291 PMID:19625648 RGD PMID:19625648 Rac1 Rat substrate adhesion-dependent cell spreading involved_in ISO RGD:1605432 1624291 PMID:19625648, PMID:28886345 RGD PMID:19625648|PMID:28886345 Rac1 Rat superoxide anion generation involved_in ISO RGD:1605432 1624291 PMID:38355798 RGD PMID:38355798 Rac1 Rat synaptic transmission, GABAergic acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:2180784 PMID:23258346 RGD PMID:23258346 Rac1 Rat Wnt signaling pathway, planar cell polarity pathway acts_upstream_of_or_within ISO RGD:1553531 1624291 MGI:98958 PMID:18953410 RGD PMID:18953410
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Rac1 Rat ATPase binding IPI RGD:2179 11341707 RGD Rac1 Rat enzyme binding enables ISO RGD:1605432 1624291 UniProtKB:Q9Y5S8 PMID:16636067 RGD PMID:16636067 Rac1 Rat G protein activity enables ISO RGD:1553531 1624291 EC:3.6.5.2 PMID:17058265, PMID:35263589, PMID:35676269 RGD PMID:17058265|PMID:35263589|PMID:35676269 Rac1 Rat G protein activity enables IEA EC:3.6.5.2 1600115 GO_REF:0000003 UniProt GO_REF:0000003 Rac1 Rat GTP binding IDA 2314386 RGD Rac1 Rat GTP binding IDA 704329 RGD Rac1 Rat GTP binding enables ISO RGD:1553531 1624291 PMID:12783890, PMID:14580336, PMID:15728191, PMID:23528453 RGD PMID:12783890|PMID:14580336|PMID:15728191|PMID:23528453 Rac1 Rat GTP binding enables IEA UniProtKB-KW:KW-0342 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Rac1 Rat GTP binding enables IBA CGD:CAL0000192612|CGD:CAL0000192659|CGD:CAL0000196388|FB:FBgn0039140|MGI:108446|MGI:97845|PANTHER:PTN000632671|RGD:619755|RGD:619921|RGD:71043|SGD:S000001380|TAIR:locus:2131606|TAIR:locus:2204380|UniProtKB:P15153|UniProtKB:P31021|UniProtKB:P60953|UniProtKB:P61586|UniProtKB:P63000|UniProtKB:Q15669|UniProtKB:Q24816|UniProtKB:Q9H4E5|UniProtKB:Q9SSX0|WB:WBGene00000390|WB:WBGene00000424|WB:WBGene00004287|WB:WBGene00004357 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Rac1 Rat GTP binding enables IEA InterPro:IPR001806|InterPro:IPR003578|InterPro:IPR005225 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Rac1 Rat GTP binding enables ISO RGD:1605432 1624291 PMID:12551911, PMID:15467718, PMID:15601624, PMID:19625648, PMID:22036506, PMID:23620790 RGD PMID:12551911|PMID:15467718|PMID:15601624|PMID:19625648|PMID:22036506|PMID:23620790 Rac1 Rat GTP-dependent protein binding enables ISO RGD:1553531 1624291 UniProtKB:Q9Z101 PMID:10954424 RGD PMID:10954424 Rac1 Rat GTPase activity enables ISO RGD:1605432 1624291 PMID:19787194, PMID:27917469 RGD PMID:19787194|PMID:27917469 Rac1 Rat GTPase activity IDA 704329 RGD Rac1 Rat GTPase activity enables IEA RHEA:19669 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Rac1 Rat GTPase activity enables ISO RGD:1553531 1624291 PMID:10699171, PMID:12525493, PMID:15249579 RGD PMID:10699171|PMID:12525493|PMID:15249579 Rac1 Rat GTPase activity enables IBA CGD:CAL0000184710|CGD:CAL0000197260|FB:FBgn0010333|FB:FBgn0010341|FB:FBgn0014011|FB:FBgn0014020|MGI:106211|MGI:1096342|MGI:1916831|MGI:97845|MGI:97846|PANTHER:PTN000632671|PomBase:SPAC110.03|PomBase:SPAC16.01|PomBase:SPAC16A10.04|PomBase:SPAC1F7.04|PomBase:SPAC23C4.08|RGD:619755|RGD:619921|SGD:S000000046|SGD:S000001380|SGD:S000001763|SGD:S000004219|SGD:S000005034|SGD:S000005124|SGD:S000006369|TAIR:locus:2099232|TAIR:locus:2131606|UniProtKB:P17081|UniProtKB:P60763|UniProtKB:P60953|UniProtKB:P61586|UniProtKB:P63000|UniProtKB:P84095|UniProtKB:Q58E25|UniProtKB:Q9H4E5|WB:WBGene00000390|WB:WBGene00000424|WB:WBGene00003239|WB:WBGene00004287|WB:WBGene00004357 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Rac1 Rat GTPase activity enables IEA InterPro:IPR001806 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Rac1 Rat histone deacetylase binding IPI RGD:619977 9590167 RGD Rac1 Rat hydrolase activity enables IEA UniProtKB-KW:KW-0378 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Rac1 Rat nucleotide binding enables IEA UniProtKB-KW:KW-0547 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Rac1 Rat protein binding IPI RGD:1354371 7242691 RGD Rac1 Rat protein binding IPI RGD:620632 1581694 RGD Rac1 Rat protein binding enables ISO RGD:1605432 1624291 UniProtKB:F1LYQ8|UniProtKB:O14713|UniProtKB:O15063|UniProtKB:O43157|UniProtKB:O60331|UniProtKB:O60784-2|UniProtKB:O75369|UniProtKB:P00491|UniProtKB:P04271|UniProtKB:P05067|UniProtKB:P05412|UniProtKB:P15498|UniProtKB:P16144|UniProtKB:P19174|UniProtKB:P21333|UniProtKB:P27986-2|UniProtKB:P32926|UniProtKB:P41227|UniProtKB:P41743|UniProtKB:P42768|UniProtKB:P43405-2|UniProtKB:P46940|UniProtKB:P52306|UniProtKB:P52565|UniProtKB:P52757|UniProtKB:P53365|UniProtKB:P98170|UniProtKB:Q01105|UniProtKB:Q01968|UniProtKB:Q03135|UniProtKB:Q06547-2|UniProtKB:Q13153|UniProtKB:Q13177|UniProtKB:Q13387-4|UniProtKB:Q13490|UniProtKB:Q14155|UniProtKB:Q14185|UniProtKB:Q14457|UniProtKB:Q15311|UniProtKB:Q16513|UniProtKB:Q5S007|UniProtKB:Q5VV41|UniProtKB:Q60838|UniProtKB:Q6A162|UniProtKB:Q6P589|UniProtKB:Q765P7|UniProtKB:Q7Z6J0|UniProtKB:Q86UR1|UniProtKB:Q8IYU2|UniProtKB:Q8N5Z5|UniProtKB:Q8TEJ3|UniProtKB:Q8WTV1|UniProtKB:Q8WUI4-6|UniProtKB:Q92608|UniProtKB:Q92619|UniProtKB:Q92963|UniProtKB:Q92997|UniProtKB:Q96F07|UniProtKB:Q96JM7-2|UniProtKB:Q96N96|UniProtKB:Q98PK8|UniProtKB:Q99750|UniProtKB:Q99755|UniProtKB:Q9BRK4|UniProtKB:Q9BVJ6|UniProtKB:Q9BYG4|UniProtKB:Q9BYG5|UniProtKB:Q9GSG9|UniProtKB:Q9H9P5|UniProtKB:Q9NPB6|UniProtKB:Q9NUQ9|UniProtKB:Q9NY61|UniProtKB:Q9P258|UniProtKB:Q9UBQ0-2|UniProtKB:Q9UHV9|UniProtKB:Q9UJX2|UniProtKB:Q9UQB8|UniProtKB:Q9Y6N9 PMID:10051605, PMID:11030651, PMID:11260256, PMID:11346801, PMID:11513578, PMID:11696321, PMID:11807099, PMID:12134158, PMID:12874273, PMID:12879077, PMID:12915445, PMID:12919680, PMID:15048733, more ... RGD PMID:10051605|PMID:11030651|PMID:11260256|PMID:11346801|PMID:11513578|PMID:11696321|PMID:11807099|PMID:12134158|PMID:12874273|PMID:12879077|PMID:12915445|PMID:12919680|PMID:15048733|PMID:15247908|PMID:15723800|PMID:16492808|PMID:16628218|PMID:16636067|PMID:16968699|PMID:17003044|PMID:17145773|PMID:17245428|PMID:18511940|PMID:18809683|PMID:19171758|PMID:19264842|PMID:19270716|PMID:19403692|PMID:19596003|PMID:19732720|PMID:19843518|PMID:20148946|PMID:20660631|PMID:20679435|PMID:20696164|PMID:20810653|PMID:20875796|PMID:20936779|PMID:20974804|PMID:21029865|PMID:21167153|PMID:21454543|PMID:21900206|PMID:21988832|PMID:22036506|PMID:22117219|PMID:22157745|PMID:22581261|PMID:22614015|PMID:22705156|PMID:22796473|PMID:23109420|PMID:23195690|PMID:23209303|PMID:23982733|PMID:24086303|PMID:24172987|PMID:24274578|PMID:24625804|PMID:24792722|PMID:25416956|PMID:25609649|PMID:25843002|PMID:26175416|PMID:27173435|PMID:28007913|PMID:29734338|PMID:29997244|PMID:30250061|PMID:31285585|PMID:31467278|PMID:31871319|PMID:31980649|PMID:32296183|PMID:32707033|PMID:32814053|PMID:33961781|PMID:35271311|PMID:38833990|PMID:7673236|PMID:8625410|PMID:8670882|PMID:9312003 Rac1 Rat protein binding enables ISO RGD:1605432,UniProtKB:P63000-1 1624291 UniProtKB:O75962-4|UniProtKB:Q13153|UniProtKB:Q6P589|UniProtKB:Q8TCU6 PMID:19693014, PMID:21422296, PMID:22949657, PMID:25150978, PMID:27150042 RGD PMID:19693014|PMID:21422296|PMID:22949657|PMID:25150978|PMID:27150042 Rac1 Rat protein binding enables IPI UniProtKB:Q5XI73 8554409 PMID:20696765 UniProt Rac1 Rat protein binding enables IPI UniProtKB:P52631 13792550 PMID:16055727 ARUK-UCL Rac1 Rat protein binding enables IPI UniProtKB:Q498M5 13673844 PMID:22128169 UniProt Rac1 Rat protein binding enables ISO RGD:1553531 1624291 MGI:3028642|PR:Q07139|PR:Q9CR75|PR:Q9JJR5|PR:Q9JKF1|UniProtKB:P08228|UniProtKB:Q13153|UniProtKB:Q5SSM3|UniProtKB:Q62108|UniProtKB:Q69ZI1|UniProtKB:Q8BK67|UniProtKB:Q8BWW9|UniProtKB:Q9WUM4|UniProtKB:Q9Z207 PMID:14573547, PMID:17227220, PMID:18219391, PMID:18264091, PMID:18325335, PMID:18604197, PMID:18854161, PMID:19455133, PMID:19893577, PMID:20974804, PMID:22959435, PMID:24352656, PMID:25074804, more ... RGD PMID:14573547|PMID:17227220|PMID:18219391|PMID:18264091|PMID:18325335|PMID:18604197|PMID:18854161|PMID:19455133|PMID:19893577|PMID:20974804|PMID:22959435|PMID:24352656|PMID:25074804|PMID:28671696|PMID:8464478 Rac1 Rat protein binding enables IPI UniProtKB:Q9QY40 8554409 PMID:20696765 UniProt Rac1 Rat protein kinase binding enables IPI UniProtKB:D3ZG85 8554575 PMID:20861382 BHF-UCL Rac1 Rat protein kinase binding enables IBA FB:FBgn0010333|FB:FBgn0014011|PANTHER:PTN001530052|RGD:619755|TAIR:locus:2170778|TAIR:locus:2204380|UniProtKB:P63000|dictyBase:DDB_G0268622|dictyBase:DDB_G0269176|dictyBase:DDB_G0277869|dictyBase:DDB_G0282365|dictyBase:DDB_G0286555|dictyBase:DDB_G0293526 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Rac1 Rat protein kinase binding enables ISO RGD:1605432 1624291 UniProtKB:Q13177 PMID:8625410 RGD PMID:8625410 Rac1 Rat protein-containing complex binding enables ISO RGD:1605432 1624291 PMID:21107423 RGD PMID:21107423 Rac1 Rat Rho GDP-dissociation inhibitor binding IPI RGD:1359547 9684983 RGD Rac1 Rat small GTPase binding IPI RGD:61908 4892340 RGD Rac1 Rat thioesterase binding enables ISO RGD:1605432 1624291 UniProtKB:P35125 PMID:12612085 RGD PMID:12612085
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-catechin (ISO) (-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1,8-cineole (ISO) 11-deoxycorticosterone (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 2-acetamidofluorene (ISO) 2-trans,6-trans,10-trans-geranylgeranyl diphosphate (ISO) 2-trans,6-trans-farnesyl diphosphate (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO) 3-methylcholanthrene (ISO) 3-phenylprop-2-enal (EXP) 4,5,4'-trihydroxy-3,3'-dimethoxybibenzyl (ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxycoumarin (ISO) 4-tert-Octylphenol (EXP) 6-propyl-2-thiouracil (EXP) 7,8-diacetoxy-4-methylcoumarin (ISO) acetylsalicylic acid (ISO) acteoside (ISO) actinomycin D (ISO) Aflatoxin B2 alpha (ISO) AICA ribonucleotide (EXP) aldehydo-D-glucose (EXP,ISO) all-trans-retinoic acid (EXP,ISO) amitrole (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) apilimod (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atorvastatin calcium (EXP,ISO) azathioprine (ISO) azithromycin (ISO) belinostat (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) C60 fullerene (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) cannabidiol (ISO) captan (ISO) carbon nanotube (ISO) carvedilol (EXP) chloropicrin (ISO) chloroprene (EXP) chlorpyrifos (ISO) cholesterol (ISO) cisplatin (EXP,ISO) clemizole (EXP) clozapine (ISO) cobalt dichloride (ISO) cocaine (EXP,ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) corn oil (ISO) Cuprizon (ISO) curcumin (EXP) D-glucose (EXP,ISO) daidzein (ISO) decabromodiphenyl ether (ISO) deguelin (ISO) dexamethasone (EXP) diallyl disulfide (ISO) diarsenic trioxide (ISO) dibenziodolium (ISO) dibutyl phthalate (ISO) diethylstilbestrol (EXP) Dimethyldithiophosphate (ISO) Dimethylphosphate (ISO) dioxygen (ISO) disodium selenite (ISO) disulfiram (ISO) diuron (ISO) dizocilpine maleate (EXP) dorsomorphin (EXP) doxorubicin (EXP,ISO) enzyme inhibitor (ISO) ethanol (EXP,ISO) farnesol (ISO) farnesyl diphosphate (ISO) felodipine (ISO) flavonoids (ISO) flubendazole (ISO) folic acid (ISO) folpet (ISO) gallic acid (ISO) genistein (ISO) gentamycin (EXP) geranylgeraniol (ISO) glucose (EXP,ISO) graphene oxide (ISO) GTP (EXP,ISO) guanosine 5'-[gamma-thio]triphosphate (ISO) GYS32661 (ISO) haloperidol (EXP) heparin (EXP) indometacin (EXP) irbesartan (ISO) ivermectin (ISO) kainic acid (EXP) kanamycin A (ISO) L-ascorbic acid (ISO) lead diacetate (EXP) lipopolysaccharide (EXP,ISO) lovastatin (ISO) luteolin (ISO) Maduramicin (EXP) mebendazole (ISO) melittin (ISO) mercury atom (ISO) mercury dichloride (EXP) mercury(0) (ISO) methidathion (ISO) methimazole (EXP) methohexital (ISO) methotrexate (ISO) methylmercury chloride (EXP) mevalonic acid (EXP,ISO) mevastatin (ISO) ML-7 (EXP) mycophenolic acid (EXP) N-acetyl-L-cysteine (EXP) N-formyl-L-methionyl-L-leucyl-L-phenylalanine (EXP,ISO) N-nitrosodiethylamine (EXP) N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (EXP) nebivolol (EXP) nitrates (ISO) nitrofen (EXP) NSC 23766 (ISO) Nutlin-3 (ISO) oxaliplatin (EXP) ozone (ISO) p-tert-Amylphenol (EXP) paclitaxel (ISO) pamidronate (ISO) PD 0325901 (ISO) pentobarbital (ISO) perfluorooctane-1-sulfonic acid (ISO) phenylephrine (EXP) phorbol 13-acetate 12-myristate (ISO) picoxystrobin (ISO) plitidepsin (ISO) poly(I:C) (EXP,ISO) potassium chromate (ISO) propiconazole (EXP) puerarin (EXP) pyrrolidine dithiocarbamate (ISO) ranitidine (EXP) reactive oxygen species (EXP,ISO) resveratrol (EXP,ISO) rimonabant (ISO) Risedronate sodium (ISO) ropivacaine (ISO) rotenone (EXP) ruxolitinib (ISO) secobarbital (ISO) serpentine asbestos (ISO) sevoflurane (EXP,ISO) simvastatin (EXP,ISO) sirolimus (EXP) sodium arsenate (ISO) sodium arsenite (ISO) sodium chloride (EXP,ISO) sodium dichromate (EXP) spironolactone (EXP) streptozocin (EXP,ISO) styrene oxide (ISO) sucrose (ISO) sulfadimethoxine (EXP) sunitinib (ISO) tacrolimus hydrate (EXP) tetrachloromethane (ISO) thiamylal (ISO) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) trimethyltin (ISO) triphenyl phosphate (ISO) Triptolide (EXP) Tubeimoside II (ISO) uranium atom (ISO) ursodeoxycholic acid (ISO) valproic acid (ISO) vinclozolin (EXP) Y-27632 (EXP) zinc dichloride (ISO) zinc oxide (ISO) zoledronic acid (ISO)
Biological Process
actin cytoskeleton organization (IDA,ISO) actin filament organization (IBA,IMP,ISO,ISS) actin filament polymerization (ISO) anatomical structure arrangement (ISO) angiotensin-activated signaling pathway involved in heart process (ISO) auditory receptor cell morphogenesis (ISO) axon guidance (ISO) bone resorption (IDA) cell adhesion (ISO) cell chemotaxis (IBA) cell migration (ISO) cell motility (ISO,ISS) cell projection assembly (IBA) cell-cell junction organization (ISO) cellular response to mechanical stimulus (IDA) cerebral cortex GABAergic interneuron development (ISO) cerebral cortex radially oriented cell migration (ISO) chemotaxis (IBA,IMP) cochlea morphogenesis (ISO) cortical cytoskeleton organization (IBA) cytoskeleton organization (ISO) dendrite development (ISO) dendrite morphogenesis (ISO) dopaminergic neuron differentiation (ISO) embryonic olfactory bulb interneuron precursor migration (ISO) endocytosis (ISO) engulfment of apoptotic cell (ISO) enzyme-linked receptor protein signaling pathway (ISO) epithelial cell morphogenesis (ISO) erythrocyte enucleation (ISO) establishment or maintenance of cell polarity (IBA) forebrain development (ISO) G protein-coupled receptor signaling pathway (ISO) heart process (ISO) hepatocyte growth factor receptor signaling pathway (ISO) homeostasis of number of cells within a tissue (ISO) hyperosmotic response (ISO) interneuron migration (ISO) lamellipodium assembly (ISO) localization within membrane (ISO) mast cell chemotaxis (IMP) midbrain dopaminergic neuron differentiation (ISO) motor neuron axon guidance (IBA) negative regulation of fibroblast migration (ISO) negative regulation of interleukin-23 production (ISO) neuron migration (ISO,ISS) neuron projection morphogenesis (ISO) non-canonical Wnt signaling pathway (ISO) phagocytosis, engulfment (ISO) positive regulation of actin filament polymerization (ISO) positive regulation of bicellular tight junction assembly (ISO,ISS) positive regulation of cell-substrate adhesion (ISO) positive regulation of dendritic spine development (ISO) positive regulation of DNA replication (IMP) positive regulation of endothelial cell migration (ISO) positive regulation of filopodium assembly (IMP) positive regulation of focal adhesion assembly (ISO) positive regulation of insulin secretion involved in cellular response to glucose stimulus (IMP,ISO) positive regulation of lamellipodium assembly (IBA,IMP,ISO) positive regulation of microtubule polymerization (ISO) positive regulation of neutrophil chemotaxis (ISO) positive regulation of ovarian follicle development (ISO) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (ISO) positive regulation of protein phosphorylation (ISO,ISS) positive regulation of ruffle assembly (ISO) positive regulation of skeletal muscle acetylcholine-gated channel clustering (ISO) positive regulation of stress fiber assembly (ISO) positive regulation of substrate adhesion-dependent cell spreading (ISO) postsynaptic actin cytoskeleton organization (EXP,IDA,IMP) protein localization to plasma membrane (ISO) quinolinate biosynthetic process (ISO) Rac protein signal transduction (IBA,ISO,TAS) regulation of actin cytoskeleton organization (IBA) regulation of cell adhesion involved in heart morphogenesis (ISO) regulation of cell migration (ISO,ISS) regulation of cell morphogenesis (ISO) regulation of cell shape (IBA) regulation of cell size (ISO) regulation of ERK5 cascade (ISO) regulation of fibroblast migration (ISO) regulation of lamellipodium assembly (ISO) regulation of neuron maturation (ISO) regulation of neuron migration (ISO) regulation of neuronal synaptic plasticity (ISO) regulation of neutrophil migration (IBA) regulation of nitric oxide biosynthetic process (IGI) regulation of postsynapse assembly (ISO) regulation of receptor signaling pathway via JAK-STAT (ISO) regulation of respiratory burst (ISO) regulation of stress fiber assembly (ISO) regulation of synaptic vesicle endocytosis (ISO) response to lipopolysaccharide (ISO) ruffle assembly (ISO) semaphorin-plexin signaling pathway (IMP) signal transduction (IBA) small GTPase-mediated signal transduction (IEA,ISO) sphingosine-1-phosphate receptor signaling pathway (ISO) substrate adhesion-dependent cell spreading (ISO,ISS) superoxide anion generation (ISO) synaptic transmission, GABAergic (ISO) Wnt signaling pathway, planar cell polarity pathway (ISO)
Cellular Component
actin filament (ISO) cell cortex (ISO) cell projection (IBA,IEA,ISO) cytoplasm (IEA,ISO) cytoplasmic ribonucleoprotein granule (ISO) cytoplasmic vesicle (IBA,ISO) cytoskeleton (IBA) cytosol (IDA) dendrite (IEA) early endosome membrane (ISO) GABA-ergic synapse (EXP,IDA,IMP) glutamatergic synapse (ISO) Golgi membrane (IDA) kinocilium (ISO) lamellipodium (IEA,ISO,ISS) melanosome (IEA) membrane (IDA,IEA,ISO) NADPH oxidase complex (ISO) neuron projection (IBA) nucleus (IEA,ISO,ISS) pericentriolar material (ISO) phagocytic cup (ISO) plasma membrane (IBA,IEA,ISO,TAS) postsynapse (ISO) postsynaptic membrane (ISO) presynaptic membrane (ISO) recycling endosome membrane (ISO) ruffle membrane (ISO) synapse (IEA) synaptic vesicle membrane (ISO) trans-Golgi network (ISO)
Molecular Function
ATPase binding (IPI) enzyme binding (ISO) G protein activity (IEA,ISO) GTP binding (IBA,IDA,IEA,ISO) GTP-dependent protein binding (ISO) GTPase activity (IBA,IDA,IEA,ISO) histone deacetylase binding (IPI) hydrolase activity (IEA) nucleotide binding (IEA) protein binding (IPI,ISO) protein kinase binding (IBA,IPI,ISO) protein-containing complex binding (ISO) Rho GDP-dissociation inhibitor binding (IPI) small GTPase binding (IPI) thioesterase binding (ISO)
1.
Signal regulatory protein alpha ligation induces macrophage nitric oxide production through JAK/STAT- and phosphatidylinositol 3-kinase/Rac1/NAPDH oxidase/H2O2-dependent pathways.
Alblas J, etal., Mol Cell Biol. 2005 Aug;25(16):7181-92. doi: 10.1128/MCB.25.16.7181-7192.2005.
2.
RAC1b overexpression correlates with poor prognosis in KRAS/BRAF WT metastatic colorectal cancer patients treated with first-line FOLFOX/XELOX chemotherapy.
Alonso-Espinaco V, etal., Eur J Cancer. 2014 Jul;50(11):1973-81. doi: 10.1016/j.ejca.2014.04.019. Epub 2014 May 12.
3.
Ras-related C3 botulinum toxin substrate 1 (RAC1) regulates glucose-stimulated insulin secretion via modulation of F-actin.
Asahara S, etal., Diabetologia. 2013 May;56(5):1088-97. doi: 10.1007/s00125-013-2849-5. Epub 2013 Feb 15.
4.
Unexpected role of the copper transporter ATP7A in PDGF-induced vascular smooth muscle cell migration.
Ashino T, etal., Circ Res. 2010 Sep 17;107(6):787-99. doi: 10.1161/CIRCRESAHA.110.225334. Epub 2010 Jul 29.
5.
The Ras/Rac1/Cdc42/SEK/JNK/c-Jun cascade is a key pathway by which agonists stimulate DNA synthesis in primary cultures of rat hepatocytes.
Auer KL, etal., Mol Biol Cell. 1998 Mar;9(3):561-73.
6.
Inhibition of growth and migration of cholangiocarcinoma cells by pamidronate.
Buranrat B, etal., Exp Ther Med. 2019 Nov;18(5):3977-3983. doi: 10.3892/etm.2019.8041. Epub 2019 Sep 23.
7.
A bibenzyl from Dendrobium ellipsophyllum inhibits migration in lung cancer cells.
Chaotham C and Chanvorachote P, J Nat Med. 2015 Oct;69(4):565-74. doi: 10.1007/s11418-015-0925-5. Epub 2015 Jun 25.
8.
Cytosol-derived proteins are sufficient for Arp2/3 recruitment and ARF/coatomer-dependent actin polymerization on Golgi membranes.
Chen JL, etal., FEBS Lett. 2004 May 21;566(1-3):281-6.
9.
CDKL5, a protein associated with rett syndrome, regulates neuronal morphogenesis via Rac1 signaling.
Chen Q, etal., J Neurosci. 2010 Sep 22;30(38):12777-86. doi: 10.1523/JNEUROSCI.1102-10.2010.
10.
Cellular function of RhoGDI-alpha mediates the cycling of Rac1 and the regulation of pancreatic beta cell death.
Cho Y, etal., Transplant Proc. 2012 May;44(4):1083-5. doi: 10.1016/j.transproceed.2012.03.021.
11.
p38 MAP-kinases pathway regulation, function and role in human diseases.
Cuenda A and Rousseau S, Biochim Biophys Acta. 2007 Aug;1773(8):1358-75. Epub 2007 Mar 24.
12.
Association of RhoGDIalpha with Rac1 GTPase mediates free radical production during myocardial hypertrophy.
Custodis F, etal., Cardiovasc Res. 2006 Jul 15;71(2):342-51. Epub 2006 Apr 19.
13.
Serine 34 phosphorylation of rho guanine dissociation inhibitor (RhoGDIalpha) links signaling from conventional protein kinase C to RhoGTPase in cell adhesion.
Dovas A, etal., J Biol Chem. 2010 Jul 23;285(30):23296-308. doi: 10.1074/jbc.M109.098129. Epub 2010 May 15.
14.
Role of Rac1-dependent NADPH oxidase in the growth of pancreatic cancer.
Du J, etal., Cancer Gene Ther. 2011 Feb;18(2):135-43. doi: 10.1038/cgt.2010.64. Epub 2010 Oct 29.
15.
Clinical value of Tiam1-Rac1 signaling in primary gallbladder carcinoma.
Du X, etal., Med Oncol. 2012 Sep;29(3):1873-8. doi: 10.1007/s12032-011-0046-2. Epub 2011 Aug 19.
16.
MEK kinases are regulated by EGF and selectively interact with Rac/Cdc42.
Fanger GR, etal., EMBO J. 1997 Aug 15;16(16):4961-72.
17.
MicroRNA-142-3p Promotes Cellular Invasion of Colorectal Cancer Cells by Activation of RAC1.
Gao X, etal., Technol Cancer Res Treat. 2018 Jan 1;17:1533033818790508. doi: 10.1177/1533033818790508.
18.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
19.
DAMTC regulates cytoskeletal reorganization and cell motility in human lung adenocarcinoma cell line: an integrated proteomics and transcriptomics approach.
Goel A, etal., Cell Death Dis. 2012 Oct 11;3(10):e402. doi: 10.1038/cddis.2012.141.
20.
RAC1b Overexpression Confers Resistance to Chemotherapy Treatment in Colorectal Cancer.
Goka ET, etal., Mol Cancer Ther. 2019 May;18(5):957-968. doi: 10.1158/1535-7163.MCT-18-0955. Epub 2019 Mar 29.
21.
Small interfering RNA targeting Rac1 sensitizes colon cancer to dihydroartemisinin-induced cell cycle arrest and inhibited cell migration by suppressing NFκB activity.
Han P, etal., Mol Cell Biochem. 2013 Jul;379(1-2):171-80. doi: 10.1007/s11010-013-1639-1. Epub 2013 Apr 5.
22.
Early requirement of Rac1 in a mouse model of pancreatic cancer.
Heid I, etal., Gastroenterology. 2011 Aug;141(2):719-30, 730.e1-7. doi: 10.1053/j.gastro.2011.04.043. Epub 2011 Apr 28.
23.
The small GTP-binding protein Rac1 induces cardiac myocyte hypertrophy through the activation of apoptosis signal-regulating kinase 1 and nuclear factor-kappa B.
Higuchi Y, etal., J Biol Chem 2003 Jun 6;278(23):20770-7.
24.
Cloning of a novel human Rac1b splice variant with increased expression in colorectal tumors.
Jordan P, etal., Oncogene. 1999 Nov 18;18(48):6835-9.
25.
Alterations in G protein and MAP kinase signaling pathways during cardiac remodeling in hypertension and heart failure.
Kacimi R and Gerdes AM, Hypertension. 2003 Apr;41(4):968-77. Epub 2003 Mar 17.
26.
Effects of cell tension on the small GTPase Rac.
Katsumi A, etal., J Cell Biol 2002 Jul 8;158(1):153-64. Epub 2002 Jul 8.
27.
Histone deacetylase 3 mediates allergic skin inflammation by regulating expression of MCP1 protein.
Kim Y, etal., J Biol Chem. 2012 Jul 27;287(31):25844-59. doi: 10.1074/jbc.M112.348284. Epub 2012 Jun 7.
28.
HACE1 Prevents Lung Carcinogenesis via Inhibition of RAC-Family GTPases.
Kogler M, etal., Cancer Res. 2020 Jul 15;80(14):3009-3022. doi: 10.1158/0008-5472.CAN-19-2270. Epub 2020 May 4.
29.
Gene expression pattern of laser microdissected colonic crypts of adenomas with low grade dysplasia.
Lechner S, etal., Gut. 2003 Aug;52(8):1148-53.
30.
Semaphorin 5A and plexin-B3 inhibit human glioma cell motility through RhoGDIalpha-mediated inactivation of Rac1 GTPase.
Li X and Lee AY, J Biol Chem. 2010 Oct 15;285(42):32436-45. doi: 10.1074/jbc.M110.120451. Epub 2010 Aug 9.
31.
Sleeping Beauty insertional mutagenesis screen identifies the pro-metastatic roles of CNPY2 and ACTN2 in hepatocellular carcinoma tumor progression.
Lo LH, etal., Biochem Biophys Res Commun. 2021 Feb 19;541:70-77. doi: 10.1016/j.bbrc.2021.01.017. Epub 2021 Jan 19.
32.
Luteolin attenuates migration and invasion of lung cancer cells via suppressing focal adhesion kinase and non-receptor tyrosine kinase signaling pathway.
Masraksa W, etal., Nutr Res Pract. 2020 Apr;14(2):127-133. doi: 10.4162/nrp.2020.14.2.127. Epub 2019 Nov 22.
33.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
34.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
35.
Distribution of Rho family GTPases in the adult rat hippocampus and cerebellum.
O'Kane EM, etal., Brain Res Mol Brain Res 2003 May 26;114(1):1-8.
36.
Involvement of hnRNP A1 in the matrix metalloprotease-3-dependent regulation of Rac1 pre-mRNA splicing.
Pelisch F, etal., J Cell Biochem. 2012 Jul;113(7):2319-29. doi: 10.1002/jcb.24103.
37.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
38.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
39.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
40.
Antigen-stimulated activation of phospholipase D1b by Rac1, ARF6, and PKCalpha in RBL-2H3 cells.
Powner DJ, etal., Mol Biol Cell 2002 Apr;13(4):1252-62.
41.
Prognostic value of Tiam1 and Rac1 overexpression in nasopharyngeal carcinoma.
Qi Y, etal., ORL J Otorhinolaryngol Relat Spec. 2009;71(3):163-71. doi: 10.1159/000223440. Epub 2009 Jun 9.
42.
Semaphorin-3F suppresses the stemness of colorectal cancer cells by inactivating Rac1.
Rao J, etal., Cancer Lett. 2015 Mar 1;358(1):76-84. doi: 10.1016/j.canlet.2014.12.040. Epub 2014 Dec 18.
43.
Rac-GTPase, osteoclast cytoskeleton and bone resorption.
Razzouk S, etal., Eur J Cell Biol. 1999 Apr;78(4):249-55.
44.
GOA pipeline
RGD automated data pipeline
45.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
46.
Wnt signaling through Dishevelled, Rac and JNK regulates dendritic development.
Rosso SB, etal., Nat Neurosci. 2005 Jan;8(1):34-42. Epub 2004 Dec 19.
47.
Requirement of Rac1 in the development of cardiac hypertrophy.
Satoh M, etal., Proc Natl Acad Sci U S A. 2006 May 9;103(19):7432-7. Epub 2006 May 1.
48.
Rho GTPases in insulin-stimulated glucose uptake.
Satoh T Small GTPases. 2014;5:e28102. doi: 10.4161/sgtp.28102. Epub 2014 Mar 10.
49.
Verbascoside Attenuates Rac-1 and HIF-1α Signaling Cascade in Colorectal Cancer Cells.
Seyfi D, etal., Anticancer Agents Med Chem. 2018;18(15):2149-2155. doi: 10.2174/1871520618666180611112125.
50.
Deleted in colorectal cancer binding netrin-1 mediates cell substrate adhesion and recruits Cdc42, Rac1, Pak1, and N-WASP into an intracellular signaling complex that promotes growth cone expansion.
Shekarabi M, etal., J Neurosci. 2005 Mar 23;25(12):3132-41.
51.
GIT1 and ßPIX are essential for GABA(A) receptor synaptic stability and inhibitory neurotransmission.
Smith KR, etal., Cell Rep. 2014 Oct 9;9(1):298-310. doi: 10.1016/j.celrep.2014.08.061. Epub 2014 Oct 2.
52.
Possible role of direct Rac1-Rab7 interaction in ruffled border formation of osteoclasts.
Sun Y, etal., J Biol Chem. 2005 Sep 16;280(37):32356-61. Epub 2005 Jul 21.
53.
The activity of RhoA is correlated with lymph node metastasis in human colorectal cancer.
Takami Y, etal., Dig Dis Sci. 2008 Feb;53(2):467-73. Epub 2007 Jun 28.
54.
Signaling from the small GTP-binding proteins Rac1 and Cdc42 to the c-Jun N-terminal kinase/stress-activated protein kinase pathway. A role for mixed lineage kinase 3/protein-tyrosine kinase 1, a novel member of the mixed lineage kinase family.
Teramoto H, etal., J Biol Chem. 1996 Nov 1;271(44):27225-8.
55.
Methylation-mediated silencing of the miR-124 genes facilitates pancreatic cancer progression and metastasis by targeting Rac1.
Wang P, etal., Oncogene. 2014 Jan 23;33(4):514-24. doi: 10.1038/onc.2012.598. Epub 2013 Jan 21.
56.
Triptolide downregulates Rac1 and the JAK/STAT3 pathway and inhibits colitis-related colon cancer progression.
Wang Z, etal., Exp Mol Med. 2009 Oct 31;41(10):717-27. doi: 10.3858/emm.2009.41.10.078.
57.
Sh3rf2/POSHER protein promotes cell survival by ring-mediated proteasomal degradation of the c-Jun N-terminal kinase scaffold POSH (Plenty of SH3s) protein.
Wilhelm M, etal., J Biol Chem. 2012 Jan 13;287(3):2247-56. doi: 10.1074/jbc.M111.269431. Epub 2011 Nov 28.
58.
Triclosan potentiates epithelial-to-mesenchymal transition in anoikis-resistant human lung cancer cells.
Winitthana T, etal., PLoS One. 2014 Oct 16;9(10):e110851. doi: 10.1371/journal.pone.0110851. eCollection 2014.
59.
Rac GTPase activity is essential for lipopolysaccharide signaling to extracellular signal-regulated kinase and p38 MAP kinase activation in rat-2 fibroblasts.
Woo CH and Kim JH, Mol Cells 2002 Jun 30;13(3):470-5.
60.
Eotaxin induces migration of RBL-2H3 mast cells via a Rac-ERK-dependent pathway.
Woo CH, etal., Biochem Biophys Res Commun. 2002 Nov 1;298(3):392-7.
61.
Leukotriene B(4) stimulates Rac-ERK cascade to generate reactive oxygen species that mediates chemotaxis.
Woo CH, etal., J Biol Chem 2002 Mar 8;277(10):8572-8. Epub 2001 Dec 27.
62.
Expression and significance of Rac1, Pak1 and Rock1 in gastric carcinoma.
Wu YJ, etal., Asia Pac J Clin Oncol. 2014 Jun;10(2):e33-9. doi: 10.1111/ajco.12052. Epub 2013 Jan 8.
63.
Effect of blocking Rac1 expression in cholangiocarcinoma QBC939 cells.
Xudong L and Guangyi W, Braz J Med Biol Res. 2011 May;44(5):483-8. doi: 10.1590/S0100-879X2011007500057. Epub 2011 May 2.
64.
Up-regulation of Tiam1 and Rac1 correlates with poor prognosis in hepatocellular carcinoma.
Yang W, etal., Jpn J Clin Oncol. 2010 Nov;40(11):1053-9. doi: 10.1093/jjco/hyq086. Epub 2010 Jun 3.
65.
Potential role of lncRNA HULC/miR‑128‑3p/RAC1 axis in the inflammatory response during LPS‑induced sepsis in HMEC‑1 cells.
Yang W, etal., Mol Med Rep. 2020 Dec;22(6):5095-5104. doi: 10.3892/mmr.2020.11601. Epub 2020 Oct 14.
66.
Role of EHD2 in migration and invasion of human breast cancer cells.
Yang X, etal., Tumour Biol. 2015 May;36(5):3717-26. doi: 10.1007/s13277-014-3011-9. Epub 2015 Jan 5.
67.
Expression of Rac1, HIF-1α, and VEGF in gastric carcinoma: correlation with angiogenesis and prognosis.
Zhan H, etal., Onkologie. 2013;36(3):102-7. doi: 10.1159/000348525. Epub 2013 Feb 25.
68.
A GIT1/PIX/Rac/PAK signaling module regulates spine morphogenesis and synapse formation through MLC.
Zhang H, etal., J Neurosci. 2005 Mar 30;25(13):3379-88.
69.
Ropivacaine inhibits the migration of esophageal cancer cells via sodium-channel-independent but prenylation-dependent inhibition of Rac1/JNK/paxillin/FAK.
Zhang Y, etal., Biochem Biophys Res Commun. 2018 Jul 2;501(4):1074-1079. doi: 10.1016/j.bbrc.2018.05.110. Epub 2018 May 21.
70.
RAC1-GTP promotes epithelial-mesenchymal transition and invasion of colorectal cancer by activation of STAT3.
Zhou K, etal., Lab Invest. 2018 Aug;98(8):989-998. doi: 10.1038/s41374-018-0071-2. Epub 2018 Jun 8.
71.
Rho GTPases: RAC1 polymorphisms affected platinum-based chemotherapy toxicity in lung cancer patients.
Zou T, etal., Cancer Chemother Pharmacol. 2016 Aug;78(2):249-58. doi: 10.1007/s00280-016-3072-0. Epub 2016 Jun 14.
Rac1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 16,150,411 - 16,170,864 (+) NCBI GRCr8 mRatBN7.2 12 11,037,028 - 11,057,251 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 11,036,698 - 11,057,251 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 11,844,100 - 11,864,510 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 12,467,387 - 12,487,799 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 11,492,647 - 11,513,133 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 13,090,316 - 13,111,841 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 13,090,172 - 13,111,873 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 15,133,521 - 15,153,741 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 11,380,314 - 11,400,531 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 11,419,965 - 11,428,962 (+) NCBI Celera 12 12,831,091 - 12,851,324 (+) NCBI Celera Cytogenetic Map 12 p11 NCBI
RAC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 6,374,527 - 6,403,967 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 6,374,527 - 6,403,967 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 6,414,158 - 6,443,598 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 6,380,651 - 6,410,123 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 7 6,291,529 - 6,321,004 (-) NCBI Celera Cytogenetic Map 7 p22.1 NCBI HuRef 7 6,287,239 - 6,316,490 (+) NCBI HuRef CHM1_1 7 6,413,683 - 6,443,197 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 6,493,927 - 6,523,370 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 6,460,486 - 6,489,951 (+) NCBI
Rac1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 143,491,236 - 143,513,786 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 143,489,389 - 143,513,791 (-) Ensembl GRCm39 Ensembl GRCm38 5 143,505,481 - 143,528,031 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 143,503,634 - 143,528,036 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 144,266,349 - 144,288,861 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 143,761,100 - 143,783,611 (-) NCBI MGSCv36 mm8 Celera 5 140,552,192 - 140,574,740 (-) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 82.22 NCBI
Rac1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955460 13,270,159 - 13,311,351 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955460 13,270,159 - 13,295,562 (-) NCBI ChiLan1.0 ChiLan1.0
RAC1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 11,267,125 - 11,296,710 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 59,591,833 - 59,621,373 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 7,039,379 - 7,068,866 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 6,559,590 - 6,599,814 (+) NCBI panpan1.1 PanPan1.1 panPan2
RAC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 11,726,259 - 11,758,532 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 11,655,494 - 11,757,216 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 13,358,080 - 13,382,295 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 11,733,309 - 11,759,080 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 11,733,323 - 11,759,075 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 11,609,365 - 11,633,590 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 11,589,106 - 11,613,379 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 11,817,075 - 11,841,312 (+) NCBI UU_Cfam_GSD_1.0
Rac1
RAC1
RAC1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 28 15,583,609 - 15,610,753 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 28 15,583,516 - 15,610,328 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666102 459,743 - 488,113 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rac1
.
Predicted Target Of
Count of predictions: 175 Count of miRNA genes: 126 Interacting mature miRNAs: 132 Transcripts: ENSRNOT00000001417 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
2312418 Kidm41 Kidney mass QTL 41 3.7 0.0001 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 12 1 19611090 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 1331739 Hrtrt14 Heart rate QTL 14 3.56232 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 12 9318216 12829686 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 8525423 28064601 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 1600391 Edcs2 Endometrial carcinoma susceptibility QTL2 3.5 0.01 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 12 6833190 17870186 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 8449490 28302290 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat
RH140831
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,057,339 - 11,057,559 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,110,681 - 13,110,900 NCBI Rnor6.0 Rnor_5.0 12 15,153,830 - 15,154,049 UniSTS Rnor5.0 RGSC_v3.4 12 11,400,620 - 11,400,839 UniSTS RGSC3.4 Celera 12 12,851,413 - 12,851,632 UniSTS RH 3.4 Map 12 145.61 UniSTS Cytogenetic Map 12 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001417 ⟹ ENSRNOP00000001417
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 12 13,090,367 - 13,111,873 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000087094 ⟹ ENSRNOP00000071616
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 11,046,647 - 11,057,251 (+) Ensembl Rnor_6.0 Ensembl 12 13,097,269 - 13,110,592 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000092558 ⟹ ENSRNOP00000075900
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 11,036,698 - 11,057,251 (+) Ensembl Rnor_6.0 Ensembl 12 13,090,172 - 13,109,135 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000092628 ⟹ ENSRNOP00000075897
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 12 13,102,019 - 13,102,706 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113039 ⟹ ENSRNOP00000076799
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 11,043,004 - 11,057,251 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114561 ⟹ ENSRNOP00000091529
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 11,043,004 - 11,057,251 (+) Ensembl
RefSeq Acc Id:
NM_134366 ⟹ NP_599193
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 16,150,643 - 16,170,864 (+) NCBI mRatBN7.2 12 11,037,028 - 11,057,251 (+) NCBI Rnor_6.0 12 13,090,372 - 13,110,592 (+) NCBI Rnor_5.0 12 15,133,521 - 15,153,741 (+) NCBI RGSC_v3.4 12 11,380,314 - 11,400,531 (+) RGD Celera 12 12,831,091 - 12,851,324 (+) RGD
Sequence:
ATGCAGGCCATCAAGTGTGTGGTGGTGGGAGACGGAGCCGTTGGTAAAACCTGCCTGCTCATCAGTTACACGACCAATGCGTTCCCTGGAGAGTACATCCCCACCGTCTTTGACAACTATTCTGCCAA
hide sequence
RefSeq Acc Id:
XM_063271554 ⟹ XP_063127624
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 16,150,411 - 16,170,581 (+) NCBI
RefSeq Acc Id:
NP_599193 ⟸ NM_134366
- UniProtKB:
Q6RUV5 (UniProtKB/Swiss-Prot), A0A0G2K0X4 (UniProtKB/TrEMBL), A6K1K8 (UniProtKB/TrEMBL)
- Sequence:
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEK
hide sequence
Ensembl Acc Id:
ENSRNOP00000075897 ⟸ ENSRNOT00000092628
Ensembl Acc Id:
ENSRNOP00000075900 ⟸ ENSRNOT00000092558
Ensembl Acc Id:
ENSRNOP00000071616 ⟸ ENSRNOT00000087094
Ensembl Acc Id:
ENSRNOP00000001417 ⟸ ENSRNOT00000001417
Ensembl Acc Id:
ENSRNOP00000076799 ⟸ ENSRNOT00000113039
Ensembl Acc Id:
ENSRNOP00000091529 ⟸ ENSRNOT00000114561
RefSeq Acc Id:
XP_063127624 ⟸ XM_063271554
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6G820 (UniProtKB/TrEMBL)
RGD ID: 13698441 Promoter ID: EPDNEW_R8962 Type: initiation region Name: Rac1_1 Description: ras-related C3 botulinum toxin substrate 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 13,090,171 - 13,090,231 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2018-01-09
Rac1
Rac family small GTPase 1
Rac1
ras-related C3 botulinum toxin substrate 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Rac1
ras-related C3 botulinum toxin substrate 1
ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
Name updated
1299863 APPROVED
2002-08-07
Rac1
ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_cellular_localization
colocalizes at the plasma membrane of RBL-2H3 cells in actin-rich structures with phospholipase D, ARF6, and PKC alpha following antigen stimulation
727254
gene_expression
expressed in hippocampus and cerebellum
1299238
gene_process
enhanced the expression of a kappaB and induced the degradation of IkappaBalpha
704329
gene_process
essential for leukotriene B4 induced production of reactive oxygen species, chemotaxis, and cellular proliferation
1299245
gene_process
may play a role in synaptic plasticity in brain
1299238
gene_process
may play a role in cellular motility through regulation by stretch tension
1299247
gene_regulation
activated by treatment of cells with lipopolysaccharide (LPS)
1299246
