Symbol:
Pak2
Name:
p21 (RAC1) activated kinase 2
RGD ID:
61953
Description:
Predicted to enable several functions, including enzyme binding activity; identical protein binding activity; and protein tyrosine kinase activator activity. Involved in cardiac muscle hypertrophy and cellular response to transforming growth factor beta stimulus. Located in secretory granule. Biomarker of ureteral obstruction. Human ortholog(s) of this gene implicated in ductal carcinoma in situ. Orthologous to human PAK2 (p21 (RAC1) activated kinase 2); PARTICIPATES IN vascular endothelial growth factor signaling pathway; epidermal growth factor/neuregulin signaling pathway; mitogen activated protein kinase signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 2,4,6-trinitrobenzenesulfonic acid.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
gamma-PAK; LOC100910732; p21 (CDKN1A)-activated kinase 2; p21 protein (Cdc42/Rac)-activated kinase 2; p21-activated kinase 2; PAK-2; serine/threonine-protein kinase PAK 2; serine/threonine-protein kinase PAK 2-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 82,212,896 - 82,273,803 (+) NCBI GRCr8 mRatBN7.2 11 68,707,940 - 68,768,816 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 68,707,969 - 68,768,816 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 77,545,003 - 77,605,878 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 70,206,629 - 70,267,901 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 69,234,099 - 69,294,967 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 72,829,407 - 72,865,815 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 71,959,228 - 72,021,224 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 72,829,238 - 72,865,902 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 75,895,329 - 75,939,106 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 70,529,961 - 70,588,511 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 70,587,549 - 70,646,100 (+) NCBI Celera 11 68,130,464 - 68,189,144 (+) NCBI Celera Cytogenetic Map 11 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Disease Annotations - ClinVar
Imported Disease Annotations - CTD
Imported Disease Annotations - MGI
Imported Disease Annotations - OMIM
Only show annotations with direct experimental evidence (0 objects hidden)
Pak2 Rat (-)-citrinin increases activity ISO RGD:732793 6480464 [Citrinin results in increased activity of CASP3 protein] which results in increased activity of PAK2 more ... CTD PMID:18767140 Pak2 Rat (S)-nicotine multiple interactions ISO RGD:62246 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in increased expression of PAK2 mRNA; Nicotine inhibits the reaction more ... CTD PMID:20230807 Pak2 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:62246 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in decreased expression of PAK2 mRNA] CTD PMID:22206623 Pak2 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:62246 6480464 1,2-Dimethylhydrazine results in decreased expression of PAK2 mRNA CTD PMID:22206623 Pak2 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO RGD:62246 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in increased expression of PAK2 mRNA; [Nicotine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] more ... CTD PMID:20230807 Pak2 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases expression ISO RGD:62246 6480464 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine results in increased expression of PAK2 mRNA CTD PMID:20230807 Pak2 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:62246 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of PAK2 mRNA CTD PMID:17942748 Pak2 Rat 17beta-estradiol decreases expression ISO RGD:62246 6480464 Estradiol results in decreased expression of PAK2 mRNA CTD PMID:19484750 Pak2 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one decreases expression ISO RGD:732793 6480464 Metribolone results in decreased expression of PAK2 protein CTD PMID:17152098 Pak2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:62246 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of PAK2 mRNA CTD PMID:17942748 Pak2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PAK2 mRNA CTD PMID:33387578 Pak2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PAK2 mRNA CTD PMID:34747641 Pak2 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in increased expression of PAK2 mRNA CTD PMID:32109520 Pak2 Rat 2,4,6-trinitrobenzenesulfonic acid increases expression EXP 6480464 Trinitrobenzenesulfonic Acid results in increased expression of PAK2 mRNA CTD PMID:23537331 Pak2 Rat 2-amino-14,16-dimethyloctadecan-3-ol increases expression ISO RGD:732793 6480464 2-amino-14,16-dimethyloctadecan-3-ol results in increased expression of PAK2 protein CTD PMID:32044396 Pak2 Rat 2-ethoxyethanol increases expression EXP 6480464 2-ethoxyethanol results in increased expression of PAK2 mRNA CTD PMID:19643169 Pak2 Rat 2-methoxyethanol increases expression EXP 6480464 methyl cellosolve results in increased expression of PAK2 mRNA CTD PMID:19643169 Pak2 Rat 4,4'-diaminodiphenylmethane decreases expression ISO RGD:62246 6480464 4,4'-diaminodiphenylmethane results in decreased expression of PAK2 mRNA CTD PMID:18648102 Pak2 Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one increases expression ISO RGD:732793 6480464 Oxazolone results in increased expression of PAK2 mRNA CTD PMID:23999411 Pak2 Rat aflatoxin B1 increases methylation ISO RGD:732793 6480464 Aflatoxin B1 results in increased methylation of PAK2 gene CTD PMID:27153756 Pak2 Rat all-trans-retinoic acid decreases expression ISO RGD:732793 6480464 Tretinoin results in decreased expression of PAK2 mRNA CTD PMID:15498508 Pak2 Rat ammonium chloride increases expression EXP 6480464 Ammonium Chloride results in increased expression of PAK2 mRNA CTD PMID:12420312 Pak2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PAK2 mRNA CTD PMID:16483693 Pak2 Rat arsane affects methylation ISO RGD:732793 6480464 Arsenic affects the methylation of PAK2 gene CTD PMID:25304211 Pak2 Rat arsane multiple interactions ISO RGD:732793 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PAK2 more ... CTD PMID:39836092 Pak2 Rat arsenic atom affects methylation ISO RGD:732793 6480464 Arsenic affects the methylation of PAK2 gene CTD PMID:25304211 Pak2 Rat arsenic atom multiple interactions ISO RGD:732793 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PAK2 more ... CTD PMID:39836092 Pak2 Rat arsenite(3-) decreases expression ISO RGD:62246 6480464 arsenite results in decreased expression of PAK2 mRNA CTD PMID:33053406 Pak2 Rat arsenous acid multiple interactions ISO RGD:732793 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to PAK2 protein] CTD PMID:26598702 Pak2 Rat benzo[a]pyrene decreases methylation ISO RGD:732793 6480464 Benzo(a)pyrene results in decreased methylation of PAK2 5' UTR CTD PMID:27901495 Pak2 Rat benzo[a]pyrene increases methylation ISO RGD:732793 6480464 Benzo(a)pyrene results in increased methylation of PAK2 3' UTR; Benzo(a)pyrene results in increased methylation of more ... CTD PMID:27901495 Pak2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RGD:732793 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of PAK2 mRNA CTD PMID:19150397|PMID:20018196 Pak2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:62246 6480464 Diethylhexyl Phthalate results in decreased expression of PAK2 mRNA CTD PMID:33754040 Pak2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PAK2 mRNA CTD PMID:25181051 Pak2 Rat bisphenol A increases expression ISO RGD:732793 6480464 bisphenol A results in increased expression of PAK2 protein CTD PMID:37567409 Pak2 Rat bisphenol A decreases methylation ISO RGD:732793 6480464 bisphenol A results in decreased methylation of PAK2 gene CTD PMID:31601247 Pak2 Rat bisphenol AF increases expression ISO RGD:732793 6480464 bisphenol AF results in increased expression of PAK2 protein CTD PMID:34186270 Pak2 Rat butanal decreases expression ISO RGD:732793 6480464 butyraldehyde results in decreased expression of PAK2 mRNA CTD PMID:26079696 Pak2 Rat cadmium atom increases expression ISO RGD:62246 6480464 Cadmium results in increased expression of PAK2 mRNA CTD PMID:26187450 Pak2 Rat caffeine multiple interactions ISO RGD:62246 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in increased expression of PAK2 mRNA; Caffeine inhibits the reaction more ... CTD PMID:20230807 Pak2 Rat caffeine affects phosphorylation ISO RGD:732793 6480464 Caffeine affects the phosphorylation of PAK2 protein CTD PMID:35688186 Pak2 Rat caffeine increases activity ISO RGD:732793 6480464 Caffeine results in increased activity of PAK2 protein CTD PMID:19325779 Pak2 Rat carbamazepine affects expression ISO RGD:732793 6480464 Carbamazepine affects the expression of PAK2 mRNA CTD PMID:24752500 Pak2 Rat CGP 52608 multiple interactions ISO RGD:732793 6480464 CGP 52608 promotes the reaction [RORA protein binds to PAK2 gene] CTD PMID:28238834 Pak2 Rat chlorpyrifos multiple interactions EXP 6480464 [Chlorpyrifos co-treated with Ethylenethiourea] results in decreased expression of PAK2 mRNA CTD PMID:27905518 Pak2 Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of PAK2 mRNA CTD PMID:27905518 Pak2 Rat cisplatin multiple interactions ISO RGD:62246 6480464 PAK2 protein modified form promotes the reaction [Cisplatin results in increased activity of CASP3 protein]; more ... CTD PMID:21499899 Pak2 Rat copper atom multiple interactions ISO RGD:62246 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression more ... CTD PMID:15467011 Pak2 Rat copper atom multiple interactions ISO RGD:732793 6480464 [Chelating Agents binds to Copper] which results in increased expression of PAK2 mRNA CTD PMID:30911355 Pak2 Rat copper(0) multiple interactions ISO RGD:62246 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression more ... CTD PMID:15467011 Pak2 Rat copper(0) multiple interactions ISO RGD:732793 6480464 [Chelating Agents binds to Copper] which results in increased expression of PAK2 mRNA CTD PMID:30911355 Pak2 Rat copper(II) sulfate increases expression ISO RGD:732793 6480464 Copper Sulfate results in increased expression of PAK2 mRNA CTD PMID:19549813 Pak2 Rat coumarin affects phosphorylation ISO RGD:732793 6480464 coumarin affects the phosphorylation of PAK2 protein CTD PMID:35688186 Pak2 Rat curcumin decreases cleavage ISO RGD:732793 6480464 Curcumin results in decreased cleavage of PAK2 protein CTD PMID:15095415 Pak2 Rat cyclosporin A increases expression ISO RGD:732793 6480464 Cyclosporine results in increased expression of PAK2 mRNA CTD PMID:20106945|PMID:25562108 Pak2 Rat diarsenic trioxide multiple interactions ISO RGD:732793 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to PAK2 protein] CTD PMID:26598702 Pak2 Rat Dibutyl phosphate affects expression ISO RGD:732793 6480464 di-n-butylphosphoric acid affects the expression of PAK2 mRNA CTD PMID:37042841 Pak2 Rat dibutyl phthalate increases expression ISO RGD:62246 6480464 Dibutyl Phthalate results in increased expression of PAK2 mRNA CTD PMID:17361019|PMID:21266533 Pak2 Rat diclofenac affects expression ISO RGD:732793 6480464 Diclofenac affects the expression of PAK2 mRNA CTD PMID:24752500 Pak2 Rat dimethylarsinic acid decreases expression EXP 6480464 Cacodylic Acid results in decreased expression of PAK2 mRNA CTD PMID:17720352 Pak2 Rat doxorubicin decreases expression ISO RGD:732793 6480464 Doxorubicin results in decreased expression of PAK2 mRNA CTD PMID:29803840 Pak2 Rat epoxiconazole increases expression ISO RGD:62246 6480464 epoxiconazole results in increased expression of PAK2 mRNA CTD PMID:35436446 Pak2 Rat ethanol affects splicing ISO RGD:62246 6480464 Ethanol affects the splicing of PAK2 mRNA CTD PMID:30319688 Pak2 Rat Ethylenethiourea multiple interactions EXP 6480464 [Chlorpyrifos co-treated with Ethylenethiourea] results in decreased expression of PAK2 mRNA CTD PMID:27905518 Pak2 Rat folic acid multiple interactions ISO RGD:62246 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in decreased expression of PAK2 mRNA] CTD PMID:22206623 Pak2 Rat FR900359 affects phosphorylation ISO RGD:732793 6480464 FR900359 affects the phosphorylation of PAK2 protein CTD PMID:37730182 Pak2 Rat genistein increases expression ISO RGD:62246 6480464 Genistein results in increased expression of PAK2 mRNA CTD PMID:32186404 Pak2 Rat hexadecanoic acid decreases phosphorylation ISO RGD:732793 6480464 Palmitic Acid results in decreased phosphorylation of PAK2 protein CTD PMID:28073184 Pak2 Rat hydrogen peroxide multiple interactions ISO RGD:62246 6480464 [Hydrogen Peroxide co-treated with N-(oxo-5,6-dihydrophenanthridin-2-yl)-N,N-dimethylacetamide hydrochloride] results in increased phosphorylation of PAK2 protein CTD PMID:31494107 Pak2 Rat ivermectin decreases expression ISO RGD:732793 6480464 Ivermectin results in decreased expression of PAK2 protein CTD PMID:32959892 Pak2 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of PAK2 mRNA CTD PMID:30467583 Pak2 Rat methotrexate increases expression ISO RGD:732793 6480464 Methotrexate results in increased expression of PAK2 mRNA CTD PMID:21678067 Pak2 Rat methyl methanesulfonate decreases expression ISO RGD:732793 6480464 Methyl Methanesulfonate results in decreased expression of PAK2 mRNA CTD PMID:23649840 Pak2 Rat methylmercury chloride increases expression ISO RGD:732793 6480464 methylmercuric chloride results in increased expression of PAK2 mRNA CTD PMID:28001369 Pak2 Rat N(4)-hydroxycytidine decreases expression ISO RGD:62246 6480464 N(4)-hydroxycytidine results in decreased expression of PAK2 mRNA CTD PMID:37748715 Pak2 Rat N-formyl-L-methionyl-L-leucyl-L-phenylalanine increases phosphorylation EXP 6480464 N-Formylmethionine Leucyl-Phenylalanine results in increased phosphorylation of PAK2 protein CTD PMID:19445920 Pak2 Rat N-formyl-L-methionyl-L-leucyl-L-phenylalanine multiple interactions EXP 6480464 2-benzyl-3-(4-hydroxymethylphenyl)indazole inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine results in increased phosphorylation of PAK2 protein] CTD PMID:19445920 Pak2 Rat nickel atom increases expression ISO RGD:732793 6480464 Nickel results in increased expression of PAK2 mRNA CTD PMID:24768652 Pak2 Rat nicotine multiple interactions ISO RGD:62246 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in increased expression of PAK2 mRNA; Nicotine inhibits the reaction more ... CTD PMID:20230807 Pak2 Rat oxaliplatin decreases expression ISO RGD:732793 6480464 oxaliplatin results in decreased expression of PAK2 mRNA CTD PMID:17762391 Pak2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PAK2 mRNA CTD PMID:25729387 Pak2 Rat p-menthan-3-ol increases expression ISO RGD:732793 6480464 Menthol results in increased expression of PAK2 mRNA CTD PMID:26760959 Pak2 Rat p-toluidine decreases expression EXP 6480464 4-toluidine results in decreased expression of PAK2 mRNA CTD PMID:27638505 Pak2 Rat paracetamol decreases expression ISO RGD:62246 6480464 Acetaminophen results in decreased expression of PAK2 mRNA CTD PMID:17585979 Pak2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PAK2 mRNA CTD PMID:33387578 Pak2 Rat paracetamol increases expression ISO RGD:732793 6480464 Acetaminophen results in increased expression of PAK2 mRNA CTD PMID:29067470 Pak2 Rat paracetamol affects expression ISO RGD:62246 6480464 Acetaminophen affects the expression of PAK2 mRNA CTD PMID:17562736 Pak2 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of PAK2 mRNA CTD PMID:19162173 Pak2 Rat pirinixic acid multiple interactions ISO RGD:732793 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Pak2 Rat poly(I:C) multiple interactions EXP 6480464 [Poly I-C co-treated with HU 211] results in decreased expression of PAK2 mRNA CTD PMID:26923065 Pak2 Rat resveratrol increases expression ISO RGD:62246 6480464 resveratrol results in increased expression of PAK2 protein CTD PMID:25505154 Pak2 Rat Salinomycin decreases expression ISO RGD:732793 6480464 salinomycin results in decreased expression of PAK2 mRNA CTD PMID:19682730 Pak2 Rat SB 431542 multiple interactions ISO RGD:732793 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of PAK2 more ... CTD PMID:37664457 Pak2 Rat sodium arsenite multiple interactions ISO RGD:732793 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PAK2 more ... CTD PMID:39836092 Pak2 Rat tamibarotene affects expression ISO RGD:732793 6480464 tamibarotene affects the expression of PAK2 mRNA CTD PMID:15498508 Pak2 Rat tetrachloromethane increases expression ISO RGD:62246 6480464 Carbon Tetrachloride results in increased expression of PAK2 mRNA CTD PMID:31919559 Pak2 Rat tetracycline increases expression ISO RGD:62246 6480464 Tetracycline results in increased expression of PAK2 mRNA CTD PMID:16917069 Pak2 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of PAK2 protein CTD PMID:35544339 Pak2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PAK2 mRNA CTD PMID:34492290 Pak2 Rat titanium dioxide increases methylation ISO RGD:62246 6480464 titanium dioxide results in increased methylation of PAK2 gene CTD PMID:35295148 Pak2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PAK2 mRNA CTD PMID:25729387 Pak2 Rat triphenyl phosphate affects expression ISO RGD:732793 6480464 triphenyl phosphate affects the expression of PAK2 mRNA CTD PMID:37042841 Pak2 Rat valproic acid decreases methylation ISO RGD:732793 6480464 Valproic Acid results in decreased methylation of PAK2 gene CTD PMID:29154799 Pak2 Rat valproic acid decreases expression ISO RGD:732793 6480464 Valproic Acid results in decreased expression of PAK2 mRNA CTD PMID:23179753|PMID:27188386 Pak2 Rat valproic acid affects expression ISO RGD:732793 6480464 Valproic Acid affects the expression of PAK2 mRNA CTD PMID:25979313 Pak2 Rat vitamin E increases expression ISO RGD:732793 6480464 Vitamin E results in increased expression of PAK2 mRNA CTD PMID:19244175 Pak2 Rat zearalenone decreases expression ISO RGD:62246 6480464 Zearalenone results in decreased expression of PAK2 protein CTD PMID:36252740
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Pak2 Rat ATP binding enables IEA UniProtKB-KW:KW-0067 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Pak2 Rat ATP binding enables IEA InterPro:IPR000719|InterPro:IPR017441 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Pak2 Rat ATP binding enables IEA UniRule:UR001503341 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Pak2 Rat catalytic activity enables IEA UniProtKB-KW:KW-0021 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Pak2 Rat identical protein binding enables ISO RGD:732793 1624291 UniProtKB:Q13177 PMID:16837009 RGD PMID:16837009 Pak2 Rat identical protein binding enables IEA UniProtKB:Q13177|ensembl:ENSP00000314067 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pak2 Rat kinase activity enables IEA UniProtKB-KW:KW-0418 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Pak2 Rat nucleotide binding enables IEA UniRule:UR001503341 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Pak2 Rat nucleotide binding enables IEA UniProtKB-KW:KW-0547 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Pak2 Rat protein binding enables ISO RGD:62246 1624291 UniProtKB:P42859|UniProtKB:Q80U72 PMID:18716323, PMID:19240112 RGD PMID:18716323|PMID:19240112 Pak2 Rat protein binding enables ISO RGD:732793 1624291 UniProtKB:O43639|UniProtKB:O55043|UniProtKB:O60504|UniProtKB:O94875|UniProtKB:P03406|UniProtKB:P04049|UniProtKB:P08631|UniProtKB:P12931|UniProtKB:P16333|UniProtKB:P42858|UniProtKB:P53667|UniProtKB:P55210|UniProtKB:P60953|UniProtKB:P62993|UniProtKB:P63000|UniProtKB:Q14155|UniProtKB:Q14160|UniProtKB:Q15052|UniProtKB:Q5PP90|UniProtKB:Q8TEJ3|UniProtKB:Q9BX66|UniProtKB:Q9H4E5|UniProtKB:Q9NYB9-2 PMID:10607567, PMID:16374509, PMID:16527308, PMID:16787945, PMID:16837009, PMID:18716323, PMID:19240112, PMID:19264842, PMID:19435845, PMID:20696164, PMID:20936779, PMID:21516116, PMID:21555521, more ... RGD PMID:10607567|PMID:16374509|PMID:16527308|PMID:16787945|PMID:16837009|PMID:18716323|PMID:19240112|PMID:19264842|PMID:19435845|PMID:20696164|PMID:20936779|PMID:21516116|PMID:21555521|PMID:22705156|PMID:25416956|PMID:28514442|PMID:32296183|PMID:32707033|PMID:33961781|PMID:35271311 Pak2 Rat protein kinase activity enables IEA UniProtKB:Q8CIN4|ensembl:ENSMUSP00000023467 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pak2 Rat protein kinase activity enables IEA InterPro:IPR000719|InterPro:IPR008271 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Pak2 Rat protein kinase activity enables ISO RGD:62246 1624291 PMID:23509247 RGD PMID:23509247 Pak2 Rat protein kinase binding enables ISO RGD:732793 1624291 UniProtKB:P00519 PMID:11121037 RGD PMID:11121037 Pak2 Rat protein kinase binding enables IEA UniProtKB:Q13177|ensembl:ENSP00000314067 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pak2 Rat protein serine kinase activity enables IEA RHEA:17989 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Pak2 Rat protein serine/threonine kinase activity enables IEA UniProtKB-KW:KW-0723 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Pak2 Rat protein serine/threonine kinase activity enables IEA EC:2.7.11.1 1600115 GO_REF:0000003 UniProt GO_REF:0000003 Pak2 Rat protein serine/threonine kinase activity enables IEA UniProtKB:Q13177|ensembl:ENSP00000314067 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pak2 Rat protein serine/threonine kinase activity enables ISO RGD:62246 1624291 PMID:28408623 RGD PMID:28408623 Pak2 Rat protein serine/threonine kinase activity enables IBA CGD:CAL0000192143|FB:FBgn0025743|FB:FBgn0044826|FB:FBgn0261456|FB:FBgn0267698|MGI:1339975|MGI:1339984|MGI:1349394|MGI:1355329|MGI:1920334|PANTHER:PTN000684825|PomBase:SPAC1F5.09c|PomBase:SPBC1604.14c|RGD:3250|RGD:3251|RGD:621590|SGD:S000000999|SGD:S000005242|UniProtKB:O75914|UniProtKB:O95819|UniProtKB:O96013|UniProtKB:Q13043|UniProtKB:Q13153|UniProtKB:Q13177|UniProtKB:Q13188|UniProtKB:Q8N4C8|UniProtKB:Q9H2K8|UniProtKB:Q9UKE5|WB:WBGene00003144|dictyBase:DDB_G0269166|dictyBase:DDB_G0276459 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Pak2 Rat protein serine/threonine kinase activity enables IEA UniProtKB:Q8CIN4|ensembl:ENSMUSP00000023467 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pak2 Rat protein serine/threonine kinase activity enables IEA InterPro:IPR033923|InterPro:IPR035064 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Pak2 Rat protein serine/threonine kinase activity enables ISO RGD:732793 1624291 PMID:11121037, PMID:11278486, PMID:11805089, PMID:17060906, PMID:21555521, PMID:27889207, PMID:33693784 RGD PMID:11121037|PMID:11278486|PMID:11805089|PMID:17060906|PMID:21555521|PMID:27889207|PMID:33693784 Pak2 Rat protein serine/threonine kinase activity enables ISS UniProtKB:Q13177 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Pak2 Rat protein tyrosine kinase activator activity enables ISO RGD:732793 1624291 PMID:11121037 RGD PMID:11121037 Pak2 Rat protein tyrosine kinase activator activity enables IEA UniProtKB:Q13177|ensembl:ENSP00000314067 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pak2 Rat small GTPase binding enables ISO RGD:732793 1624291 UniProtKB:P60953|UniProtKB:P63000 PMID:8625410 RGD PMID:8625410 Pak2 Rat small GTPase binding enables IEA UniProtKB:Q13177|ensembl:ENSP00000314067 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pak2 Rat transferase activity enables IEA UniProtKB-KW:KW-0808 1600115 GO_REF:0000043 UniProt GO_REF:0000043
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-citrinin (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4,6-trinitrobenzenesulfonic acid (EXP) 2-amino-14,16-dimethyloctadecan-3-ol (ISO) 2-ethoxyethanol (EXP) 2-methoxyethanol (EXP) 4,4'-diaminodiphenylmethane (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) butanal (ISO) cadmium atom (ISO)
References
References - curated
#
Reference Title
Reference Citation
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Expression of mitogen-activated protein kinase pathways during postnatal development of rat heart.
Kim SO, etal., J Cell Biochem 1998 Nov 1;71(2):286-301.
4.
Identification and validation of new autoantibodies for the diagnosis of DCIS and node negative early-stage breast cancers.
Lacombe J, etal., Int J Cancer. 2013 Mar 1;132(5):1105-13. doi: 10.1002/ijc.27766. Epub 2012 Aug 28.
5.
A brain serine/threonine protein kinase activated by Cdc42 and Rac1.
Manser E, etal., Nature 1994 Jan 6;367(6458):40-6.
6.
A novel serine kinase activated by rac1/CDC42Hs-dependent autophosphorylation is related to PAK65 and STE20.
Martin GA, etal., EMBO J 1995 May 1;14(9):1970-8.
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
10.
GOA pipeline
RGD automated data pipeline
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Comprehensive gene review and curation
RGD comprehensive gene curation
13.
p21-activated protein kinase gamma-PAK in pituitary secretory granules phosphorylates prolactin.
Tuazon PT, etal., FEBS Lett. 2002 Mar 27;515(1-3):84-8.
14.
A novel player in cellular hypertrophy: Gibetagamma/PI3K-dependent activation of the RacGEF TIAM-1 is required for alpha(1)-adrenoceptor induced hypertrophy in neonatal rat cardiomyocytes.
Vettel C, etal., J Mol Cell Cardiol. 2012 Aug;53(2):165-75. doi: 10.1016/j.yjmcc.2012.04.015. Epub 2012 May 4.
15.
Imatinib mesylate blocks a non-Smad TGF-beta pathway and reduces renal fibrogenesis in vivo.
Wang S, etal., FASEB J. 2005 Jan;19(1):1-11.
16.
Cell-type-specific activation of PAK2 by transforming growth factor beta independent of Smad2 and Smad3.
Wilkes MC, etal., Mol Cell Biol. 2003 Dec;23(23):8878-89.
17.
p21-activated kinases regulate actin remodeling in glomerular podocytes.
Zhu J, etal., Am J Physiol Renal Physiol. 2010 Apr;298(4):F951-61. doi: 10.1152/ajprenal.00536.2009. Epub 2010 Jan 13.
Additional References at PubMed
Genomics
Comparative Map Data
Pak2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 82,212,896 - 82,273,803 (+) NCBI GRCr8 mRatBN7.2 11 68,707,940 - 68,768,816 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 68,707,969 - 68,768,816 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 77,545,003 - 77,605,878 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 70,206,629 - 70,267,901 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 69,234,099 - 69,294,967 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 72,829,407 - 72,865,815 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 71,959,228 - 72,021,224 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 72,829,238 - 72,865,902 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 75,895,329 - 75,939,106 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 70,529,961 - 70,588,511 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 70,587,549 - 70,646,100 (+) NCBI Celera 11 68,130,464 - 68,189,144 (+) NCBI Celera Cytogenetic Map 11 q22 NCBI
PAK2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 196,739,857 - 196,832,647 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 196,739,857 - 196,832,647 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 196,466,728 - 196,559,518 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 197,951,312 - 198,043,756 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 197,955,224 - 198,047,662 NCBI Celera 3 195,047,767 - 195,144,272 (+) NCBI Celera Cytogenetic Map 3 q29 NCBI HuRef 3 193,763,319 - 193,859,670 (+) NCBI HuRef CHM1_1 3 196,437,954 - 196,530,860 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 199,459,234 - 199,558,334 (+) NCBI T2T-CHM13v2.0
Pak2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 31,835,108 - 31,898,160 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 31,835,108 - 31,898,160 (-) Ensembl GRCm39 Ensembl GRCm38 16 32,016,290 - 32,079,342 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 32,016,290 - 32,079,342 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 32,017,949 - 32,079,359 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 31,937,610 - 31,999,020 (-) NCBI MGSCv36 mm8 Celera 16 32,511,700 - 32,575,354 (-) NCBI Celera Cytogenetic Map 16 B2 NCBI cM Map 16 22.4 NCBI
Pak2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955420 12,892,845 - 12,930,955 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955420 12,893,760 - 12,930,955 (+) NCBI ChiLan1.0 ChiLan1.0
PAK2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 194,609,641 - 194,699,725 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 194,614,360 - 194,704,443 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 194,084,037 - 194,174,010 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 204,023,357 - 204,111,515 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 204,023,357 - 204,111,507 (+) Ensembl panpan1.1 panPan2
PAK2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 33 29,774,645 - 29,863,661 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 33 29,774,593 - 29,987,478 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 33 29,798,837 - 29,887,939 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 33 30,018,726 - 30,108,342 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 33 30,018,587 - 30,235,797 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 33 29,795,936 - 29,906,532 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 33 29,850,899 - 29,940,690 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 33 30,473,517 - 30,563,048 (+) NCBI UU_Cfam_GSD_1.0
Pak2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 124,493,276 - 124,572,628 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936784 1,351,039 - 1,391,992 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936784 1,351,034 - 1,391,992 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PAK2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 133,273,112 - 133,389,458 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 133,276,122 - 133,383,506 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 142,923,496 - 142,963,953 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PAK2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 90,474,367 - 90,488,814 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 90,398,660 - 90,449,346 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 ChlSab1.1 Ensembl 15 90,398,660 - 90,449,346 (-) NCBI ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 64,177,811 - 64,268,335 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pak2
miRNA Target Status (No longer updated)
Predicted Target Of
Count of predictions: 27 Count of miRNA genes: 26 Interacting mature miRNAs: 27 Transcripts: ENSRNOT00000049862 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
QTLs in Region (GRCr8)
1300147 Bp187 Blood pressure QTL 187 3.67 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 11 1 69446234 Rat 724554 Iddm17 Insulin dependent diabetes mellitus QTL 17 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 18976208 86241447 Rat 70208 Niddm22 Non-insulin dependent diabetes mellitus QTL 22 3.61 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 11 59802794 82566553 Rat 70180 BpQTLcluster10 Blood pressure QTL cluster 10 3.19 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 11 34918041 79918041 Rat 1581565 Pur10 Proteinuria QTL 10 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 44803318 82846466 Rat 4889859 Pur28 Proteinuria QTL 28 19.5 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 11 45459323 75190161 Rat 634339 Niddm50 Non-insulin dependent diabetes mellitus QTL 50 3.32 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 11 66422148 86241447 Rat 10755497 Bp388 Blood pressure QTL 388 2.76 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 19456205 76331918 Rat 1549848 Bvd6 Brain ventricular dilatation QTL 6 3.1 0.0001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 11 66113321 82169223 Rat 10058954 Gmadr7 Adrenal mass QTL 7 2.49 0.0049 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 11 60346590 86241447 Rat 2298551 Neuinf10 Neuroinflammation QTL 10 3.7 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 11 31239134 78851519 Rat 1300135 Rf19 Renal function QTL 19 3.38 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 11 40946188 82566702 Rat 2312566 Glom20 Glomerulus QTL 20 3.6 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 11 44285759 82566702 Rat 1354593 Stl12 Serum triglyceride level QTL 12 3.36 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 11 66422148 86241447 Rat 724563 Uae10 Urinary albumin excretion QTL 10 6 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 11 27672410 82846715 Rat 724561 Plsm4 Polydactyly-luxate syndrome (PLS) morphotypes QTL 4 0.0003 forelimb integrity trait (VT:0010562) front foot phalanges count (CMO:0001947) 11 54457534 86241447 Rat 4889521 Gluco62 Glucose level QTL 62 2.82 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 55136729 82993457 Rat 7411658 Foco27 Food consumption QTL 27 16.2 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 11 56351424 86241447 Rat 631506 Bp104 Blood pressure QTL 104 2.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 59802794 82566545 Rat 1581572 Uae35 Urinary albumin excretion QTL 35 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 44803318 82846466 Rat 1300110 Stl7 Serum triglyceride level QTL 7 4.64 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 11 29528418 82566702 Rat
Expression
RNA-SEQ Expression
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
2
6
5
20
21
24
6
17
6
51
29
13
8
12
18
Too many to show, limit is 500. Download them if you would like to view them all.
Sequence
Ensembl Acc Id:
ENSRNOT00000049862 ⟹ ENSRNOP00000040162
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 68,707,969 - 68,767,873 (+) Ensembl Rnor_6.0 Ensembl 11 71,959,228 - 72,017,463 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000071060 ⟹ ENSRNOP00000065949
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 11 72,829,238 - 72,865,902 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000077269 ⟹ ENSRNOP00000072644
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 68,730,236 - 68,768,816 (+) Ensembl Rnor_6.0 Ensembl 11 71,981,060 - 72,021,224 (+) Ensembl
RefSeq Acc Id:
NM_001393703 ⟹ NP_001380632
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 82,212,935 - 82,273,803 (+) NCBI mRatBN7.2 11 68,707,940 - 68,768,816 (+) NCBI
RefSeq Acc Id:
NM_053306 ⟹ NP_445758
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 82,212,935 - 82,273,803 (+) NCBI mRatBN7.2 11 68,707,940 - 68,768,816 (+) NCBI Rnor_6.0 11 72,829,407 - 72,865,815 (+) NCBI Rnor_5.0 11 75,895,329 - 75,939,106 (+) NCBI RGSC_v3.4 11 70,529,961 - 70,588,511 (+) RGD Celera 11 68,130,464 - 68,189,144 (+) RGD
Sequence:
AAAGTACAAAGAAGTTACTGCCATCCTCCCTCTCTCGTCCCCTAGCACAGTGCTCGCCCGCGTC
hide sequence
RefSeq Acc Id:
XM_063270441 ⟹ XP_063126511
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 82,212,896 - 82,273,803 (+) NCBI
RefSeq Acc Id:
NP_445758 ⟸ NM_053306
- UniProtKB:
Q64303 (UniProtKB/Swiss-Prot), Q9QYU0 (UniProtKB/Swiss-Prot), A6IRU5 (UniProtKB/TrEMBL), A0A8L2R675 (UniProtKB/TrEMBL)
- Sequence:
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSSTEKGS
hide sequence
Ensembl Acc Id:
ENSRNOP00000065949 ⟸ ENSRNOT00000071060
Ensembl Acc Id:
ENSRNOP00000072644 ⟸ ENSRNOT00000077269
Ensembl Acc Id:
ENSRNOP00000040162 ⟸ ENSRNOT00000049862
RefSeq Acc Id:
NP_001380632 ⟸ NM_001393703
- UniProtKB:
Q64303 (UniProtKB/Swiss-Prot), Q9QYU0 (UniProtKB/Swiss-Prot), A6IRU5 (UniProtKB/TrEMBL), A0A8L2R675 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063126511 ⟸ XM_063270441
- Peptide Label:
isoform X1
- UniProtKB:
Q9QYU0 (UniProtKB/Swiss-Prot), Q64303 (UniProtKB/Swiss-Prot), A6IRU5 (UniProtKB/TrEMBL), A0A8L2R675 (UniProtKB/TrEMBL)
Additional Information
Nomenclature History
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Pak2
p21 (RAC1) activated kinase 2
LOC100910732
serine/threonine-protein kinase PAK 2-like
Data merged from RGD:6497075
737654 PROVISIONAL
2017-06-20
Pak2
p21 (RAC1) activated kinase 2
Pak2
p21 protein (Cdc42/Rac)-activated kinase 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2017-03-27
Pak2
p21 protein (Cdc42/Rac)-activated kinase 2
Pak2
p21 (RAC1) activated kinase 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-05-12
Pak2
p21 (RAC1) activated kinase 2
Pak2
p21 protein (Cdc42/Rac)-activated kinase 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-07-05
LOC100910732
serine/threonine-protein kinase PAK 2-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2009-05-27
Pak2
p21 protein (Cdc42/Rac)-activated kinase 2
Pak2
p21 (CDKN1A)-activated kinase 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Pak2
p21 (CDKN1A)-activated kinase 2
Symbol and Name status set to approved
70586 APPROVED
RGD Curation Notes
Note Type
Note
Reference
gene_expression
expressed in many tissues
61685
gene_expression
expressed in many tissues
70317
gene_function
phosphorylates protein serine/threonine residues
61685
gene_function
phosphorylates protein serine/threonine residues
70317
