Symbol:
Prkce
Name:
protein kinase C, epsilon
RGD ID:
61925
Description:
Enables several functions, including SH3 domain binding activity; diacylglycerol-dependent, calcium-independent serine/threonine kinase activity; and protein serine/threonine kinase binding activity. Involved in several processes, including cellular response to platelet-derived growth factor stimulus; negative regulation of mitochondrial calcium ion concentration; and negative regulation of mitochondrial membrane potential. Located in Golgi membrane and T-tubule. Is active in glutamatergic synapse; neuromuscular junction; and presynaptic cytosol. Used to study hypertension. Biomarker of type 2 diabetes mellitus. Orthologous to human PRKCE (protein kinase C epsilon); PARTICIPATES IN eicosanoid signaling pathway; endothelin signaling pathway; interleukin-2 signaling pathway; INTERACTS WITH (R)-adrenaline; (S)-nicotine; 1,1-dichloroethene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
nPKC-epsilon; Pkce; protein kinase C epsilon type
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRKCE (protein kinase C epsilon) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Prkce (protein kinase C, epsilon) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Prkce (protein kinase C epsilon) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRKCE (protein kinase C epsilon) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRKCE (protein kinase C epsilon) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prkce (protein kinase C epsilon) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRKCE (protein kinase C epsilon) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PRKCE (protein kinase C epsilon) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prkce (protein kinase C epsilon) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PRKCH (protein kinase C eta) HGNC
OrthoDB
Alliance orthologs 3
Mus musculus (house mouse):
Prkce (protein kinase C, epsilon)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PRKCE (protein kinase C epsilon)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prkcea (protein kinase C, epsilon a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prkceb (protein kinase C, epsilon b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PKC1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Pkc98E
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pkc-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
prkce
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 13,718,050 - 14,204,931 (-) NCBI GRCr8 mRatBN7.2 6 7,965,048 - 8,451,966 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 7,965,048 - 8,451,719 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 8,241,962 - 8,728,298 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 8,551,358 - 9,037,685 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 8,078,663 - 8,564,995 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 9,483,400 - 9,973,396 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 9,790,422 - 9,973,396 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 9,404,548 - 9,883,579 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 9,631,234 - 10,097,311 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 9,631,241 - 10,097,311 (+) NCBI Celera 6 7,696,161 - 8,179,574 (-) NCBI Celera Cytogenetic Map 6 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prkce Rat (R)-adrenaline affects response to substance ISO Prkce (Mus musculus) 6480464 PRKCE protein affects the susceptibility to Epinephrine CTD PMID:11454025 Prkce Rat (R)-adrenaline affects response to substance EXP 6480464 PRKCE protein affects the susceptibility to Epinephrine CTD PMID:11454025 Prkce Rat (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of PRKCE mRNA CTD PMID:20426880 Prkce Rat 1,1-dichloroethene increases expression EXP 6480464 vinylidene chloride results in increased expression of PRKCE protein CTD PMID:14565772 Prkce Rat 1,2-dimethylhydrazine decreases expression ISO Prkce (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PRKCE mRNA CTD PMID:22206623 Prkce Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of PRKCE mRNA CTD PMID:12075121 and PMID:29097150 Prkce Rat 17beta-estradiol increases expression ISO Prkce (Mus musculus) 6480464 Estradiol results in increased expression of PRKCE mRNA CTD PMID:25210133 Prkce Rat 17beta-estradiol multiple interactions ISO PRKCE (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of PRKCE mRNA and Estradiol promotes the reaction [HSF protein binds to PRKCE promoter] CTD PMID:30165855 and PMID:31614463 Prkce Rat 17beta-estradiol increases expression ISO PRKCE (Homo sapiens) 6480464 Estradiol results in increased expression of PRKCE mRNA CTD PMID:21795739 and PMID:31614463 Prkce Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Prkce (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Prkce Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:21394737 Prkce Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Prkce (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Prkce Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which affects the localization of PRKCE protein CTD PMID:15761253 Prkce Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PRKCE mRNA CTD PMID:33387578 Prkce Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Prkce (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRKCE mRNA CTD PMID:32553695 Prkce Rat 2,3,7,8-tetrachlorodibenzodioxine increases localization EXP 6480464 Tetrachlorodibenzodioxin results in increased localization of PRKCE protein CTD PMID:17222441 Prkce Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects localization ISO PRKCE (Homo sapiens) 6480464 2 more ... CTD PMID:15475174 Prkce Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PRKCE mRNA CTD PMID:21346803 Prkce Rat 2-butoxyethanol decreases expression ISO Prkce (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of PRKCE mRNA CTD PMID:19812364 Prkce Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO Prkce (Mus musculus) 6480464 bisindolylmaleimide I inhibits the reaction [Tetradecanoylphorbol Acetate promotes the reaction [PRKCE protein binds to STAT3 protein]] CTD PMID:24496235 Prkce Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione decreases expression ISO PRKCE (Homo sapiens) 6480464 bisindolylmaleimide I results in decreased expression of PRKCE mRNA CTD PMID:28780155 Prkce Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO PRKCE (Homo sapiens) 6480464 bisindolylmaleimide I inhibits the reaction [puag-haad results in increased expression of PRKCE mRNA] CTD PMID:28780155 Prkce Rat 4,4'-diaminodiphenylmethane decreases expression ISO Prkce (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of PRKCE mRNA CTD PMID:18648102 Prkce Rat 4,4'-sulfonyldiphenol decreases expression ISO Prkce (Mus musculus) 6480464 bisphenol S results in decreased expression of PRKCE mRNA CTD PMID:39298647 Prkce Rat 4,4'-sulfonyldiphenol increases methylation ISO PRKCE (Homo sapiens) 6480464 bisphenol S results in increased methylation of PRKCE gene CTD PMID:31601247 Prkce Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of PRKCE mRNA CTD PMID:21346803 Prkce Rat 5-aza-2'-deoxycytidine decreases expression EXP 6480464 Decitabine results in decreased expression of PRKCE protein CTD PMID:34536542 Prkce Rat 7,12-dimethyltetraphene decreases expression ISO Prkce (Mus musculus) 6480464 9 more ... CTD PMID:32553695 Prkce Rat acetaldehyde multiple interactions ISO PRKCE (Homo sapiens) 6480464 PRKCE protein affects the reaction [EGF protein inhibits the reaction [Acetaldehyde results in increased transport of Inulin]] and PRKCE protein affects the reaction [EGF protein results in decreased susceptibility to Acetaldehyde] CTD PMID:17991733 Prkce Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of PRKCE mRNA CTD PMID:31881176 Prkce Rat acetylsalicylic acid multiple interactions ISO PRKCE (Homo sapiens) 6480464 Aspirin inhibits the reaction [Deoxycholic Acid results in increased cleavage of PRKCE protein] CTD PMID:17644113 Prkce Rat aflatoxin B1 decreases expression ISO Prkce (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of PRKCE mRNA CTD PMID:19770486 Prkce Rat aflatoxin B1 affects methylation ISO PRKCE (Homo sapiens) 6480464 Aflatoxin B1 affects the methylation of PRKCE intron CTD PMID:30157460 Prkce Rat aflatoxin B1 decreases methylation ISO PRKCE (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PRKCE gene CTD PMID:27153756 Prkce Rat aflatoxin B1 decreases expression ISO PRKCE (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of PRKCE mRNA CTD PMID:21641981 and PMID:22100608 Prkce Rat Aflatoxin B2 alpha decreases methylation ISO PRKCE (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of PRKCE intron CTD PMID:30157460 Prkce Rat all-trans-retinoic acid increases expression ISO PRKCE (Homo sapiens) 6480464 Tretinoin results in increased expression of PRKCE mRNA CTD PMID:23724009 Prkce Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PRKCE mRNA CTD PMID:16483693 Prkce Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of PRKCE mRNA CTD PMID:30779732 Prkce Rat arjunolic acid multiple interactions EXP 6480464 arjunolic acid inhibits the reaction [Streptozocin results in increased expression of PRKCE protein] CTD PMID:19682444 Prkce Rat Aroclor 1254 affects localization ISO PRKCE (Homo sapiens) 6480464 Chlorodiphenyl (54% Chlorine) affects the localization of PRKCE protein CTD PMID:15475174 Prkce Rat arsane affects methylation ISO PRKCE (Homo sapiens) 6480464 Arsenic affects the methylation of PRKCE gene CTD PMID:25304211 Prkce Rat arsane multiple interactions ISO PRKCE (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PRKCE mRNA CTD PMID:39836092 Prkce Rat arsenic atom affects methylation ISO PRKCE (Homo sapiens) 6480464 Arsenic affects the methylation of PRKCE gene CTD PMID:25304211 Prkce Rat arsenic atom multiple interactions ISO PRKCE (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PRKCE mRNA CTD PMID:39836092 Prkce Rat arsenous acid multiple interactions EXP 6480464 Arsenic Trioxide promotes the reaction [Berberine results in decreased activity of PRKCE protein] CTD PMID:18294404 Prkce Rat arsenous acid affects localization EXP 6480464 Arsenic Trioxide affects the localization of PRKCE protein CTD PMID:18294404 Prkce Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of PRKCE gene CTD PMID:35440735 Prkce Rat benzo[a]pyrene decreases expression ISO PRKCE (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PRKCE mRNA CTD PMID:22316170 Prkce Rat benzo[a]pyrene affects methylation ISO PRKCE (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PRKCE intron CTD PMID:30157460 Prkce Rat benzo[a]pyrene decreases methylation ISO PRKCE (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PRKCE exon CTD PMID:27901495 Prkce Rat benzo[a]pyrene decreases methylation ISO Prkce (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of PRKCE intron CTD PMID:27901495 Prkce Rat benzo[a]pyrene multiple interactions ISO Prkce (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of PRKCE mRNA CTD PMID:27858113 Prkce Rat benzo[a]pyrene decreases expression ISO Prkce (Mus musculus) 6480464 Benzo(a)pyrene metabolite results in decreased expression of PRKCE mRNA and Benzo(a)pyrene results in decreased expression of PRKCE mRNA CTD PMID:19770486 more ... Prkce Rat benzo[a]pyrene diol epoxide I increases expression ISO PRKCE (Homo sapiens) 6480464 7 more ... CTD PMID:17944540 Prkce Rat benzo[b]fluoranthene multiple interactions ISO Prkce (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of PRKCE mRNA CTD PMID:27858113 Prkce Rat benzo[e]pyrene increases methylation ISO PRKCE (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of PRKCE intron CTD PMID:30157460 Prkce Rat berberine multiple interactions EXP 6480464 arsenic trioxide promotes the reaction [Berberine results in decreased activity of PRKCE protein] and Berberine results in decreased activity of and affects the localization of PRKCE protein CTD PMID:18294404 Prkce Rat berberine decreases activity EXP 6480464 Berberine results in decreased activity of PRKCE protein CTD PMID:18294404 Prkce Rat bis(2-ethylhexyl) phthalate affects methylation ISO Prkce (Mus musculus) 6480464 Diethylhexyl Phthalate affects the methylation of PRKCE gene CTD PMID:32864567 Prkce Rat bis(2-ethylhexyl) phthalate decreases expression ISO Prkce (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of PRKCE mRNA CTD PMID:34319233 Prkce Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PRKCE mRNA CTD PMID:12075121 and PMID:29097150 Prkce Rat bisphenol A increases expression ISO PRKCE (Homo sapiens) 6480464 bisphenol A results in increased expression of PRKCE mRNA CTD PMID:36232920 Prkce Rat bisphenol A decreases methylation ISO PRKCE (Homo sapiens) 6480464 bisphenol A results in decreased methylation of PRKCE gene CTD PMID:31601247 Prkce Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PRKCE mRNA CTD PMID:25181051 and PMID:33296240 Prkce Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of PRKCE mRNA CTD PMID:19167457 Prkce Rat cadmium atom multiple interactions ISO Prkce (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PRKCE mRNA CTD PMID:33259630 Prkce Rat cadmium dichloride multiple interactions ISO Prkce (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PRKCE mRNA CTD PMID:33259630 Prkce Rat calcium atom multiple interactions ISO PRKCE (Homo sapiens) 6480464 chelerythrine inhibits the reaction [Calcium results in increased phosphorylation of PRKCE protein] and PRKCE protein affects the reaction [F2RL1 protein promotes the reaction [[Capsaicin results in increased activity of TRPV1 protein] which results in increased abundance of Calcium]] CTD PMID:16793902 and PMID:21562303 Prkce Rat calcium atom affects response to substance ISO Prkce (Mus musculus) 6480464 PRKCE protein affects the susceptibility to Calcium CTD PMID:15242976 Prkce Rat calcium atom multiple interactions ISO Prkce (Mus musculus) 6480464 PRKCE protein affects the reaction [Oxygen deficiency results in increased abundance of Calcium] CTD PMID:17087917 Prkce Rat calcium atom increases phosphorylation ISO PRKCE (Homo sapiens) 6480464 Calcium results in increased phosphorylation of PRKCE protein CTD PMID:21562303 Prkce Rat calcium(0) multiple interactions ISO PRKCE (Homo sapiens) 6480464 chelerythrine inhibits the reaction [Calcium results in increased phosphorylation of PRKCE protein] and PRKCE protein affects the reaction [F2RL1 protein promotes the reaction [[Capsaicin results in increased activity of TRPV1 protein] which results in increased abundance of Calcium]] CTD PMID:16793902 and PMID:21562303 Prkce Rat calcium(0) affects response to substance ISO Prkce (Mus musculus) 6480464 PRKCE protein affects the susceptibility to Calcium CTD PMID:15242976 Prkce Rat calcium(0) multiple interactions ISO Prkce (Mus musculus) 6480464 PRKCE protein affects the reaction [Oxygen deficiency results in increased abundance of Calcium] CTD PMID:17087917 Prkce Rat calcium(0) increases phosphorylation ISO PRKCE (Homo sapiens) 6480464 Calcium results in increased phosphorylation of PRKCE protein CTD PMID:21562303 Prkce Rat capsaicin multiple interactions ISO PRKCE (Homo sapiens) 6480464 PRKCE protein affects the reaction [F2RL1 protein promotes the reaction [[Capsaicin results in increased activity of TRPV1 protein] which results in increased abundance of Calcium]] CTD PMID:16793902 Prkce Rat carbon nanotube decreases expression ISO Prkce (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Prkce Rat carvedilol increases activity EXP 6480464 carvedilol results in increased activity of PRKCE protein CTD PMID:16782078 Prkce Rat celecoxib multiple interactions ISO Prkce (Mus musculus) 6480464 Celecoxib inhibits the reaction [deoxynivalenol affects the localization of PRKCE protein] CTD PMID:32416088 Prkce Rat CGP 52608 multiple interactions ISO PRKCE (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PRKCE gene] CTD PMID:28238834 Prkce Rat CGS-21680 multiple interactions EXP 6480464 2-(4-(2-carboxyethyl)phenethylamino)-5'-N-ethylcarboxamidoadenosine affects the localization of and results in increased activity of PRKCE protein CTD PMID:12590138 Prkce Rat chelerythrine multiple interactions EXP 6480464 [chelerythrine results in decreased activity of PRKCE protein] which results in decreased susceptibility to Phenylephrine CTD PMID:12700091 Prkce Rat chelerythrine multiple interactions ISO PRKCE (Homo sapiens) 6480464 chelerythrine inhibits the reaction [Calcium results in increased phosphorylation of PRKCE protein] CTD PMID:21562303 Prkce Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of PRKCE mRNA CTD PMID:18668222 Prkce Rat chlorpyrifos increases expression ISO Prkce (Mus musculus) 6480464 Chlorpyrifos results in increased expression of PRKCE mRNA CTD PMID:37019170 Prkce Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of PRKCE mRNA CTD PMID:19368821 Prkce Rat chrysene multiple interactions ISO Prkce (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of PRKCE mRNA CTD PMID:27858113 Prkce Rat cisplatin multiple interactions ISO PRKCE (Homo sapiens) 6480464 Cisplatin promotes the reaction [jinfukang results in decreased expression of PRKCE mRNA] and jinfukang promotes the reaction [Cisplatin results in decreased expression of PRKCE mRNA] CTD PMID:27392435 Prkce Rat clomiphene affects localization ISO PRKCE (Homo sapiens) 6480464 Clomiphene affects the localization of PRKCE protein CTD PMID:9714066 Prkce Rat clozapine increases expression EXP 6480464 Clozapine results in increased expression of PRKCE mRNA CTD PMID:15860345 Prkce Rat cobalt dichloride decreases expression ISO PRKCE (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PRKCE mRNA CTD PMID:19320972 Prkce Rat cobalt dichloride multiple interactions EXP 6480464 cobaltous chloride results in increased oxidation of and results in increased activity of PRKCE protein more ... CTD PMID:18375950 Prkce Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of PRKCE mRNA CTD PMID:20187946 Prkce Rat cocaine decreases phosphorylation EXP 6480464 Cocaine results in decreased phosphorylation of PRKCE protein CTD PMID:15677681 Prkce Rat cocaine decreases expression EXP 6480464 Cocaine results in decreased expression of PRKCE protein CTD PMID:15677681 Prkce Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of PRKCE mRNA CTD PMID:26577399 Prkce Rat curcumin multiple interactions ISO PRKCE (Homo sapiens) 6480464 Curcumin inhibits the reaction [PRKCE protein results in increased expression of IVL mRNA] CTD PMID:17148446 Prkce Rat curcumin decreases expression ISO PRKCE (Homo sapiens) 6480464 Curcumin analog results in decreased expression of PRKCE mRNA CTD PMID:26409325 Prkce Rat curcumin decreases response to substance ISO PRKCE (Homo sapiens) 6480464 PRKCE protein results in decreased susceptibility to Curcumin CTD PMID:14742295 Prkce Rat cycloheximide multiple interactions EXP 6480464 Cycloheximide inhibits the reaction [Buthionine Sulfoximine results in increased expression of PRKCE protein] and Cycloheximide inhibits the reaction [diethyl maleate results in increased expression of PRKCE protein] CTD PMID:11118818 Prkce Rat daidzein multiple interactions EXP 6480464 daidzein affects the localization of and results in increased activity of PRKCE protein CTD PMID:16972265 Prkce Rat deoxycholic acid multiple interactions ISO PRKCE (Homo sapiens) 6480464 Aspirin inhibits the reaction [Deoxycholic Acid results in increased cleavage of PRKCE protein] CTD PMID:17644113 Prkce Rat deoxycholic acid increases cleavage ISO PRKCE (Homo sapiens) 6480464 Deoxycholic Acid results in increased cleavage of PRKCE protein CTD PMID:17644113 Prkce Rat deoxynivalenol multiple interactions ISO Prkce (Mus musculus) 6480464 Celecoxib inhibits the reaction [deoxynivalenol affects the localization of PRKCE protein] and Ro 31-8220 inhibits the reaction [deoxynivalenol affects the localization of PRKCE protein] CTD PMID:32416088 Prkce Rat deoxynivalenol affects localization ISO Prkce (Mus musculus) 6480464 deoxynivalenol affects the localization of PRKCE protein CTD PMID:32416088 Prkce Rat diarsenic trioxide multiple interactions EXP 6480464 Arsenic Trioxide promotes the reaction [Berberine results in decreased activity of PRKCE protein] CTD PMID:18294404 Prkce Rat diarsenic trioxide affects localization EXP 6480464 Arsenic Trioxide affects the localization of PRKCE protein CTD PMID:18294404 Prkce Rat dibenziodolium multiple interactions ISO PRKCE (Homo sapiens) 6480464 diphenyleneiodonium inhibits the reaction [Pt(O and O'-acac)(gamma-acac)(DMS) affects the localization of PRKCE protein] CTD PMID:21420390 Prkce Rat Dibutyl phosphate affects expression ISO PRKCE (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PRKCE mRNA CTD PMID:37042841 Prkce Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PRKCE mRNA CTD PMID:21266533 Prkce Rat dibutyl phthalate decreases expression ISO Prkce (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of PRKCE mRNA CTD PMID:21266533 Prkce Rat dieldrin affects methylation ISO Prkce (Mus musculus) 6480464 Dieldrin affects the methylation of PRKCE gene CTD PMID:38995845 Prkce Rat diethyl maleate multiple interactions EXP 6480464 Cycloheximide inhibits the reaction [diethyl maleate results in increased expression of PRKCE protein] and diethyl maleate results in increased expression of and results in increased activity of PRKCE protein CTD PMID:11118818 Prkce Rat dioxygen multiple interactions ISO Prkce (Mus musculus) 6480464 GPX1 protein inhibits the reaction [Oxygen deficiency results in increased activity of PRKCE protein] more ... CTD PMID:17087917 Prkce Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of PRKCE mRNA CTD PMID:33729688 Prkce Rat dioxygen decreases response to substance ISO Prkce (Mus musculus) 6480464 PRKCE gene mutant form results in decreased susceptibility to Oxygen deficiency CTD PMID:18638544 Prkce Rat dioxygen increases activity ISO Prkce (Mus musculus) 6480464 Oxygen deficiency results in increased activity of PRKCE protein CTD PMID:17087917 Prkce Rat diuron decreases expression ISO PRKCE (Homo sapiens) 6480464 Diuron results in decreased expression of PRKCE mRNA CTD PMID:35967413 Prkce Rat divanadium pentaoxide affects expression ISO Prkce (Mus musculus) 6480464 vanadium pentoxide affects the expression of PRKCE mRNA CTD PMID:26210822 Prkce Rat dobutamine affects response to substance ISO Prkce (Mus musculus) 6480464 PRKCE protein affects the susceptibility to Dobutamine CTD PMID:15242976 Prkce Rat dofetilide multiple interactions EXP 6480464 dofetilide inhibits the reaction [Isoproterenol results in increased expression of PRKCE mRNA] and dofetilide inhibits the reaction [Isoproterenol results in increased expression of PRKCE protein] CTD PMID:20723002 Prkce Rat dorsomorphin multiple interactions ISO PRKCE (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Prkce Rat doxorubicin increases oxidation EXP 6480464 Doxorubicin results in increased oxidation of PRKCE protein CTD PMID:28818578 Prkce Rat doxorubicin decreases expression ISO PRKCE (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PRKCE mRNA CTD PMID:29803840 Prkce Rat Droloxifene affects localization ISO PRKCE (Homo sapiens) 6480464 droloxifene affects the localization of PRKCE protein CTD PMID:9714066 Prkce Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of PRKCE mRNA CTD PMID:20655511 Prkce Rat ethanol affects splicing ISO Prkce (Mus musculus) 6480464 Ethanol affects the splicing of PRKCE mRNA CTD PMID:30319688 Prkce Rat ethanol multiple interactions EXP 6480464 Ethanol inhibits the reaction [Streptozocin results in increased expression of PRKCE protein] CTD PMID:12198386 Prkce Rat ethanol increases response to substance EXP 6480464 PRKCE results in increased susceptibility to Ethanol CTD PMID:20726883 Prkce Rat formaldehyde decreases expression ISO PRKCE (Homo sapiens) 6480464 Formaldehyde results in decreased expression of PRKCE mRNA CTD PMID:23416264 and PMID:23649840 Prkce Rat FR900359 affects phosphorylation ISO PRKCE (Homo sapiens) 6480464 FR900359 affects the phosphorylation of PRKCE protein CTD PMID:37730182 Prkce Rat genistein increases expression EXP 6480464 Genistein results in increased expression of PRKCE mRNA CTD PMID:12075121 Prkce Rat genistein decreases expression ISO Prkce (Mus musculus) 6480464 Genistein results in decreased expression of PRKCE mRNA CTD PMID:32186404 Prkce Rat gingerol multiple interactions ISO PRKCE (Homo sapiens) 6480464 PRKCE protein affects the reaction [gingerol results in increased expression of GDF15 protein] CTD PMID:18058799 Prkce Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of PRKCE mRNA CTD PMID:15860345 Prkce Rat Heptachlor epoxide increases expression ISO Prkce (Mus musculus) 6480464 Heptachlor Epoxide results in increased expression of PRKCE protein alternative form CTD PMID:11170310 and PMID:11246134 Prkce Rat Heptachlor epoxide decreases expression ISO Prkce (Mus musculus) 6480464 Heptachlor Epoxide results in decreased expression of PRKCE protein alternative form CTD PMID:11170310 Prkce Rat hexadecanoic acid increases phosphorylation ISO PRKCE (Homo sapiens) 6480464 Palmitic Acid results in increased phosphorylation of PRKCE protein CTD PMID:28073184 and PMID:38431059 Prkce Rat hydrogen peroxide multiple interactions ISO Prkce (Mus musculus) 6480464 Hydrogen Peroxide inhibits the reaction [Rotenone inhibits the reaction [Oxygen deficiency results in increased activity of PRKCE protein]] CTD PMID:17087917 Prkce Rat hydrogen peroxide increases activity ISO Prkce (Mus musculus) 6480464 Hydrogen Peroxide results in increased activity of PRKCE protein CTD PMID:17087917 Prkce Rat indometacin increases expression ISO PRKCE (Homo sapiens) 6480464 Indomethacin results in increased expression of PRKCE protein CTD PMID:10702201 Prkce Rat inulin multiple interactions ISO PRKCE (Homo sapiens) 6480464 PRKCE protein affects the reaction [EGF protein inhibits the reaction [Acetaldehyde results in increased transport of Inulin]] CTD PMID:17991733 Prkce Rat isoprenaline multiple interactions EXP 6480464 1-(methanesulfonamido-1-naphthyloxy)-2-(N-(4-methane sulfonamidophenethyl)-N-acetamido)ethane inhibits the reaction [Isoproterenol results in increased expression of PRKCE mRNA] more ... CTD PMID:16716347 more ... Prkce Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of PRKCE mRNA more ... CTD PMID:12775975 more ... Prkce Rat isoprenaline increases phosphorylation EXP 6480464 Isoproterenol results in increased phosphorylation of PRKCE protein CTD PMID:16716347 Prkce Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of PRKCE protein CTD PMID:16547843 Prkce Rat lead diacetate multiple interactions ISO Prkce (Mus musculus) 6480464 [lead acetate results in increased abundance of Lead] which results in increased methylation of PRKCE intron CTD PMID:33445541 Prkce Rat lead(0) decreases expression EXP 6480464 Lead results in decreased expression of PRKCE protein CTD PMID:16547843 Prkce Rat lead(0) multiple interactions ISO Prkce (Mus musculus) 6480464 [lead acetate results in increased abundance of Lead] which results in increased methylation of PRKCE intron CTD PMID:33445541 Prkce Rat lead(0) affects expression ISO PRKCE (Homo sapiens) 6480464 Lead affects the expression of PRKCE mRNA CTD PMID:28903495 Prkce Rat lead(0) increases activity EXP 6480464 Lead results in increased activity of PRKCE protein CTD PMID:10693946 Prkce Rat Licochalcone A decreases expression ISO PRKCE (Homo sapiens) 6480464 licochalcone A results in decreased expression of PRKCE mRNA CTD PMID:30055311 Prkce Rat lipopolysaccharide multiple interactions ISO Prkce (Mus musculus) 6480464 Lipopolysaccharides affects the localization of and results in increased activity of PRKCE protein and PRKCE protein promotes the reaction [Lipopolysaccharides results in increased secretion of IL12B protein] CTD PMID:16330529 Prkce Rat lithium atom multiple interactions EXP 6480464 Lithium inhibits the reaction [Methamphetamine results in increased expression of PRKCE mRNA] CTD PMID:19149911 Prkce Rat lithium hydride multiple interactions EXP 6480464 Lithium inhibits the reaction [Methamphetamine results in increased expression of PRKCE mRNA] CTD PMID:19149911 Prkce Rat lysophosphatidylcholine multiple interactions EXP 6480464 PRKCE affects the reaction [Lysophosphatidylcholines results in increased phosphorylation of GJA1 protein] CTD PMID:23973256 Prkce Rat methamphetamine multiple interactions EXP 6480464 Lithium inhibits the reaction [Methamphetamine results in increased expression of PRKCE mRNA] CTD PMID:19149911 Prkce Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of PRKCE mRNA CTD PMID:19149911 Prkce Rat methapyrilene increases methylation ISO PRKCE (Homo sapiens) 6480464 Methapyrilene results in increased methylation of PRKCE intron CTD PMID:30157460 Prkce Rat methotrexate affects expression ISO Prkce (Mus musculus) 6480464 Methotrexate affects the expression of PRKCE mRNA CTD PMID:18502557 Prkce Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PRKCE gene CTD PMID:35440735 Prkce Rat methyl methanesulfonate increases expression ISO PRKCE (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of PRKCE mRNA CTD PMID:23649840 Prkce Rat methylene blue multiple interactions ISO Prkce (Mus musculus) 6480464 Methylene Blue inhibits the reaction [Sodium Cyanide results in increased activity of and affects the localization of PRKCE protein] CTD PMID:31173149 Prkce Rat methylparaben decreases expression ISO PRKCE (Homo sapiens) 6480464 methylparaben results in decreased expression of PRKCE mRNA CTD PMID:31745603 Prkce Rat morin decreases expression ISO PRKCE (Homo sapiens) 6480464 morin results in decreased expression of PRKCE mRNA CTD PMID:28689916 Prkce Rat myxothiazol multiple interactions ISO Prkce (Mus musculus) 6480464 myxothiazol inhibits the reaction [Oxygen deficiency results in increased activity of PRKCE protein] CTD PMID:17087917 Prkce Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [NGF protein results in increased localization of and results in increased activity of PRKCE protein] CTD PMID:18375950 Prkce Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of PRKCE mRNA CTD PMID:20360939 Prkce Rat nicotine increases expression EXP 6480464 Nicotine results in increased expression of PRKCE mRNA CTD PMID:20426880 Prkce Rat nimesulide multiple interactions EXP 6480464 nimesulide inhibits the reaction [F2 protein affects the localization of PRKCE protein] and nimesulide inhibits the reaction [KNG1 protein affects the localization of PRKCE protein] CTD PMID:21811393 Prkce Rat O-methyleugenol decreases expression ISO PRKCE (Homo sapiens) 6480464 methyleugenol results in decreased expression of PRKCE mRNA CTD PMID:32234424 Prkce Rat obeticholic acid increases expression ISO PRKCE (Homo sapiens) 6480464 obeticholic acid results in increased expression of PRKCE mRNA CTD PMID:27939613 Prkce Rat ozone multiple interactions ISO Prkce (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of PRKCE mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of PRKCE mRNA CTD PMID:34911549 Prkce Rat paclitaxel affects response to substance EXP 6480464 PRKCE protein affects the susceptibility to Paclitaxel CTD PMID:11738263 Prkce Rat paracetamol multiple interactions EXP 6480464 Acetaminophen inhibits the reaction [F2 protein affects the localization of PRKCE protein] and Acetaminophen inhibits the reaction [KNG1 protein affects the localization of PRKCE protein] CTD PMID:21811393 Prkce Rat PCB138 multiple interactions ISO Prkce (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Prkce Rat PD123319 increases expression EXP 6480464 PD 123319 results in increased expression of PRKCE protein CTD PMID:11893553 Prkce Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of PRKCE mRNA CTD PMID:20360939 Prkce Rat phenobarbital decreases methylation ISO Prkce (Mus musculus) 6480464 Phenobarbital results in decreased methylation of PRKCE gene CTD PMID:19233941 Prkce Rat phenylephrine multiple interactions ISO Prkce (Mus musculus) 6480464 DGKE protein inhibits the reaction [Phenylephrine results in increased localization of PRKCE protein] and Diglycerides affects the reaction [Phenylephrine results in increased localization of PRKCE protein] CTD PMID:18487437 Prkce Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of PRKCE protein CTD PMID:12720544 Prkce Rat phenylephrine affects localization EXP 6480464 Phenylephrine affects the localization of PRKCE protein CTD PMID:12720544 Prkce Rat phenylephrine multiple interactions EXP 6480464 [chelerythrine results in decreased activity of PRKCE protein] which results in decreased susceptibility to Phenylephrine more ... CTD PMID:12700091 and PMID:16809552 Prkce Rat phenylephrine increases localization ISO Prkce (Mus musculus) 6480464 Phenylephrine results in increased localization of PRKCE protein CTD PMID:18487437 Prkce Rat phenylephrine affects localization ISO Prkce (Mus musculus) 6480464 Phenylephrine affects the localization of PRKCE protein CTD PMID:12003851 Prkce Rat phorbol 12,13-dibutanoate affects binding ISO Prkce (Mus musculus) 6480464 Phorbol 12 and 13-Dibutyrate binds to PRKCE protein CTD PMID:8106444 Prkce Rat phorbol 13-acetate 12-myristate decreases expression ISO PRKCE (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in decreased expression of PRKCE protein CTD PMID:18313772 Prkce Rat phorbol 13-acetate 12-myristate affects localization ISO PRKCE (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate affects the localization of PRKCE protein CTD PMID:14975926 and PMID:21705328 Prkce Rat phorbol 13-acetate 12-myristate decreases expression EXP 6480464 [Tetradecanoylphorbol Acetate results in decreased expression of VEGFA mRNA] which results in decreased expression of PRKCE protein and Tetradecanoylphorbol Acetate results in decreased expression of PRKCE protein CTD PMID:12590138 Prkce Rat phorbol 13-acetate 12-myristate multiple interactions EXP 6480464 PRKCE protein affects the reaction [Tetradecanoylphorbol Acetate results in decreased expression of VEGFA mRNA] and Tetradecanoylphorbol Acetate affects the localization of and results in increased activity of PRKCE protein CTD PMID:12590138 Prkce Rat phorbol 13-acetate 12-myristate increases activity ISO Prkce (Mus musculus) 6480464 Tetradecanoylphorbol Acetate results in increased activity of PRKCE protein CTD PMID:11507057 Prkce Rat phorbol 13-acetate 12-myristate affects localization ISO Prkce (Mus musculus) 6480464 Tetradecanoylphorbol Acetate affects the localization of PRKCE protein CTD PMID:12003851 Prkce Rat phorbol 13-acetate 12-myristate multiple interactions ISO Prkce (Mus musculus) 6480464 bisindolylmaleimide I inhibits the reaction [Tetradecanoylphorbol Acetate promotes the reaction [PRKCE protein binds to STAT3 protein]] more ... CTD PMID:11507057 more ... Prkce Rat phorbol 13-acetate 12-myristate increases activity ISO PRKCE (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased activity of PRKCE protein CTD PMID:14975926 Prkce Rat phorbol 13-acetate 12-myristate multiple interactions ISO PRKCE (Homo sapiens) 6480464 PRKCE protein affects the reaction [Tetradecanoylphorbol Acetate results in increased expression of SOD2 mRNA] and Tetradecanoylphorbol Acetate results in increased activity of and results in increased localization of PRKCE protein CTD PMID:16793902 and PMID:21705328 Prkce Rat picrotoxin decreases expression EXP 6480464 Picrotoxin results in decreased expression of PRKCE mRNA CTD PMID:15170462 Prkce Rat pirinixic acid multiple interactions ISO Prkce (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of PRKCE mRNA CTD PMID:19710929 Prkce Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of PRKCE mRNA CTD PMID:19162173 Prkce Rat potassium chromate decreases expression ISO PRKCE (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of PRKCE mRNA CTD PMID:22714537 Prkce Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of PRKCE mRNA CTD PMID:19162173 Prkce Rat progesterone decreases expression EXP 6480464 Progesterone results in decreased expression of PRKCE mRNA CTD PMID:17170212 Prkce Rat progesterone multiple interactions ISO Prkce (Mus musculus) 6480464 PRKCE protein promotes the reaction [[Tetradecanoylphorbol Acetate results in increased expression of and results in increased phosphorylation of STAR protein] which results in increased abundance of Progesterone] CTD PMID:21047949 Prkce Rat propiconazole decreases expression ISO Prkce (Mus musculus) 6480464 propiconazole results in decreased expression of PRKCE mRNA CTD PMID:21278054 Prkce Rat prostaglandin E2 affects response to substance EXP 6480464 PRKCE protein affects the susceptibility to Dinoprostone CTD PMID:18509033 Prkce Rat quercetin decreases expression ISO Prkce (Mus musculus) 6480464 Quercetin results in decreased expression of PRKCE mRNA CTD PMID:26076811 Prkce Rat reactive oxygen species multiple interactions ISO PRKCE (Homo sapiens) 6480464 [Pt(O and O'-acac)(gamma-acac)(DMS) results in increased abundance of Reactive Oxygen Species] which results in increased activity of PRKCE protein CTD PMID:21420390 Prkce Rat Rebamipide increases expression EXP 6480464 rebamipide results in increased expression of PRKCE mRNA CTD PMID:15104358 Prkce Rat Ro 31-8220 multiple interactions ISO Prkce (Mus musculus) 6480464 Ro 31-8220 inhibits the reaction [deoxynivalenol affects the localization of PRKCE protein] CTD PMID:32416088 Prkce Rat rotenone multiple interactions ISO Prkce (Mus musculus) 6480464 Hydrogen Peroxide inhibits the reaction [Rotenone inhibits the reaction [Oxygen deficiency results in increased activity of PRKCE protein]] and Rotenone inhibits the reaction [Oxygen deficiency results in increased activity of PRKCE protein] CTD PMID:17087917 Prkce Rat S-butyl-DL-homocysteine (S,R)-sulfoximine multiple interactions EXP 6480464 Buthionine Sulfoximine results in increased expression of and results in increased activity of PRKCE protein and Cycloheximide inhibits the reaction [Buthionine Sulfoximine results in increased expression of PRKCE protein] CTD PMID:11118818 Prkce Rat SB 431542 multiple interactions ISO PRKCE (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Prkce Rat Se-methyl-L-selenocysteine decreases expression ISO Prkce (Mus musculus) 6480464 selenomethylselenocysteine results in decreased expression of PRKCE protein CTD PMID:10656618 Prkce Rat Se-methylselenocysteine decreases expression ISO Prkce (Mus musculus) 6480464 selenomethylselenocysteine results in decreased expression of PRKCE protein CTD PMID:10656618 Prkce Rat silicon dioxide increases expression ISO PRKCE (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of PRKCE mRNA CTD PMID:25895662 Prkce Rat sodium arsenate increases expression ISO Prkce (Mus musculus) 6480464 sodium arsenate results in increased expression of PRKCE mRNA CTD PMID:21795629 Prkce Rat sodium arsenite multiple interactions ISO PRKCE (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PRKCE mRNA CTD PMID:39836092 Prkce Rat sodium cyanide multiple interactions ISO Prkce (Mus musculus) 6480464 [Sodium Cyanide results in increased activity of PRKCE protein] which results in increased phosphorylation of ATP1A2 protein more ... CTD PMID:31173149 Prkce Rat streptozocin multiple interactions EXP 6480464 [Streptozocin co-treated with Dietary Fats] results in increased expression of PRKCE mRNA more ... CTD PMID:12198386 more ... Prkce Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of PRKCE protein CTD PMID:12198386 and PMID:19682444 Prkce Rat sunitinib increases expression ISO PRKCE (Homo sapiens) 6480464 Sunitinib results in increased expression of PRKCE mRNA CTD PMID:31533062 Prkce Rat tamoxifen affects localization ISO PRKCE (Homo sapiens) 6480464 Tamoxifen affects the localization of PRKCE protein CTD PMID:9714066 Prkce Rat tert-butyl hydroperoxide decreases expression ISO PRKCE (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of PRKCE mRNA CTD PMID:27509014 Prkce Rat tetraphene multiple interactions ISO Prkce (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of PRKCE mRNA CTD PMID:27858113 Prkce Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PRKCE mRNA CTD PMID:23411599 and PMID:34492290 Prkce Rat thiram decreases activity ISO PRKCE (Homo sapiens) 6480464 Thiram results in decreased activity of PRKCE protein CTD PMID:15998240 Prkce Rat thiram increases expression ISO PRKCE (Homo sapiens) 6480464 Thiram results in increased expression of PRKCE mRNA CTD PMID:38568856 Prkce Rat titanium dioxide increases methylation ISO Prkce (Mus musculus) 6480464 titanium dioxide results in increased methylation of PRKCE gene CTD PMID:35295148 Prkce Rat titanium dioxide decreases methylation ISO Prkce (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PRKCE gene CTD PMID:35295148 Prkce Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of PRKCE mRNA CTD PMID:33387578 Prkce Rat trichostatin A increases expression ISO PRKCE (Homo sapiens) 6480464 trichostatin A results in increased expression of PRKCE mRNA CTD PMID:24935251 and PMID:26272509 Prkce Rat trichostatin A multiple interactions ISO PRKCE (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PRKCE mRNA CTD PMID:27188386 Prkce Rat troglitazone decreases expression ISO PRKCE (Homo sapiens) 6480464 troglitazone results in decreased expression of PRKCE mRNA CTD PMID:19140230 Prkce Rat tungsten decreases expression ISO Prkce (Mus musculus) 6480464 Tungsten results in decreased expression of PRKCE mRNA CTD PMID:30912803 Prkce Rat tunicamycin increases expression ISO Prkce (Mus musculus) 6480464 Tunicamycin results in increased expression of PRKCE mRNA CTD PMID:17127020 Prkce Rat urethane increases expression ISO PRKCE (Homo sapiens) 6480464 Urethane results in increased expression of PRKCE mRNA CTD PMID:28818685 Prkce Rat valproic acid multiple interactions EXP 6480464 Valproic Acid inhibits the reaction [TAC1 protein results in increased phosphorylation of and results in increased activity of PRKCE protein] CTD PMID:12807426 Prkce Rat valproic acid multiple interactions ISO PRKCE (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PRKCE mRNA CTD PMID:27188386 Prkce Rat valproic acid increases expression ISO PRKCE (Homo sapiens) 6480464 Valproic Acid results in increased expression of PRKCE mRNA CTD PMID:26272509 Prkce Rat venlafaxine hydrochloride increases expression EXP 6480464 Venlafaxine Hydrochloride results in increased expression of PRKCE mRNA CTD PMID:25423262 Prkce Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of PRKCE mRNA CTD PMID:19015723 Prkce Rat vincristine increases response to substance EXP 6480464 PRKCE protein results in increased susceptibility to Vincristine CTD PMID:12809704 Prkce Rat vitamin D multiple interactions ISO Prkce (Mus musculus) 6480464 Vitamin D inhibits the reaction [Dust results in increased activity of PRKCE protein] CTD PMID:23281135 Prkce Rat zinc atom multiple interactions ISO PRKCE (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of PRKCE mRNA CTD PMID:18593933 Prkce Rat zinc(0) multiple interactions ISO PRKCE (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of PRKCE mRNA CTD PMID:18593933
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(R)-adrenaline (EXP,ISO) (S)-nicotine (EXP) 1,1-dichloroethene (EXP) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dinitrotoluene (EXP) 2-butoxyethanol (ISO) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 5-aza-2'-deoxycytidine (EXP) 7,12-dimethyltetraphene (ISO) acetaldehyde (ISO) acetamide (EXP) acetylsalicylic acid (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) amphetamine (EXP) arjunolic acid (EXP) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (EXP) atrazine (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (ISO) benzo[e]pyrene (ISO) berberine (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) calcium atom (ISO) calcium(0) (ISO) capsaicin (ISO) carbon nanotube (ISO) carvedilol (EXP) celecoxib (ISO) CGP 52608 (ISO) CGS-21680 (EXP) chelerythrine (EXP,ISO) chlorpyrifos (EXP,ISO) chrysene (ISO) cisplatin (ISO) clomiphene (ISO) clozapine (EXP) cobalt dichloride (EXP,ISO) cocaine (EXP) Cuprizon (EXP) curcumin (ISO) cycloheximide (EXP) daidzein (EXP) deoxycholic acid (ISO) deoxynivalenol (ISO) diarsenic trioxide (EXP) dibenziodolium (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dieldrin (ISO) diethyl maleate (EXP) dioxygen (EXP,ISO) diuron (ISO) divanadium pentaoxide (ISO) dobutamine (ISO) dofetilide (EXP) dorsomorphin (ISO) doxorubicin (EXP,ISO) Droloxifene (ISO) ethanol (EXP,ISO) formaldehyde (ISO) FR900359 (ISO) genistein (EXP,ISO) gingerol (ISO) haloperidol (EXP) Heptachlor epoxide (ISO) hexadecanoic acid (ISO) hydrogen peroxide (ISO) indometacin (ISO) inulin (ISO) isoprenaline (EXP) lead diacetate (EXP,ISO) lead(0) (EXP,ISO) Licochalcone A (ISO) lipopolysaccharide (ISO) lithium atom (EXP) lithium hydride (EXP) lysophosphatidylcholine (EXP) methamphetamine (EXP) methapyrilene (ISO) methotrexate (ISO) methoxychlor (EXP) methyl methanesulfonate (ISO) methylene blue (ISO) methylparaben (ISO) morin (ISO) myxothiazol (ISO) N-acetyl-L-cysteine (EXP) N-nitrosodiethylamine (EXP) nicotine (EXP) nimesulide (EXP) O-methyleugenol (ISO) obeticholic acid (ISO) ozone (ISO) paclitaxel (EXP) paracetamol (EXP) PCB138 (ISO) PD123319 (EXP) phenethyl caffeate (EXP) phenobarbital (ISO) phenylephrine (EXP,ISO) phorbol 12,13-dibutanoate (ISO) phorbol 13-acetate 12-myristate (EXP,ISO) picrotoxin (EXP) pirinixic acid (EXP,ISO) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (EXP,ISO) propiconazole (ISO) prostaglandin E2 (EXP) quercetin (ISO) reactive oxygen species (ISO) Rebamipide (EXP) Ro 31-8220 (ISO) rotenone (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP) SB 431542 (ISO) Se-methyl-L-selenocysteine (ISO) Se-methylselenocysteine (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium cyanide (ISO) streptozocin (EXP) sunitinib (ISO) tamoxifen (ISO) tert-butyl hydroperoxide (ISO) tetraphene (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) troglitazone (ISO) tungsten (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (EXP,ISO) venlafaxine hydrochloride (EXP) vinclozolin (EXP) vincristine (EXP) vitamin D (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
cell adhesion (IEA) cell division (IEA) cell-substrate adhesion (IEA,ISO) cellular response to ethanol (IEA,ISO) cellular response to hypoxia (IEA,ISO) cellular response to platelet-derived growth factor stimulus (IMP) cellular response to prostaglandin E stimulus (IEA,ISO) establishment of localization in cell (IEA,ISO) immune system process (IEA) insulin secretion (IEA,ISO) intracellular signal transduction (IBA,IDA) lipopolysaccharide-mediated signaling pathway (IEA,ISO,ISS) locomotory exploration behavior (IEA,ISO) macrophage activation involved in immune response (IEA,ISO) MAPK cascade (IEA,ISO) mucus secretion (IEA,ISO) negative regulation of apoptotic process (IMP) negative regulation of mitochondrial calcium ion concentration (IMP) negative regulation of mitochondrial membrane potential (IMP) negative regulation of protein ubiquitination (IEA,ISO) negative regulation of release of sequestered calcium ion into cytosol (IMP) peptidyl-serine phosphorylation (ISO) positive regulation of actin filament polymerization (IEA,ISO,ISS) positive regulation of canonical NF-kappaB signal transduction (IEA,ISO) positive regulation of cell-substrate adhesion (IEA,ISO) positive regulation of cytokinesis (IEA,ISO,ISS) positive regulation of epithelial cell migration (IEA,ISO,ISS) positive regulation of fibroblast migration (IEA,ISO,ISS) positive regulation of insulin secretion (IEA,ISO) positive regulation of lipid catabolic process (IEA,ISO) positive regulation of MAPK cascade (IEA,ISO) positive regulation of mucus secretion (IEA,ISO) positive regulation of synaptic transmission, GABAergic (IEA,ISO) positive regulation of wound healing (IEA,ISO,ISS) presynaptic modulation of chemical synaptic transmission (EXP,IDA) protein phosphorylation (ISO) regulation of insulin secretion involved in cellular response to glucose stimulus (IEA,ISO) regulation of lipid metabolic process (IEA,ISO) regulation of peptidyl-tyrosine phosphorylation (ISO) regulation of release of sequestered calcium ion into cytosol (IEA,ISO) response to morphine (IEA,ISO) synaptic transmission, GABAergic (IEA,ISO) toxin catabolic process (IEA,ISO) TRAM-dependent toll-like receptor 4 signaling pathway (IEA,ISO,ISS) xenobiotic catabolic process (IEA,ISO)
Cellular Component
cell periphery (IEA,ISO,ISS) cytoplasm (IEA,ISO) cytoskeleton (IEA) cytosol (IEA,ISO) endoplasmic reticulum (IEA,ISO) glutamatergic synapse (IDA) Golgi apparatus (IEA,ISO,ISS) Golgi membrane (IDA) intermediate filament cytoskeleton (IEA,ISO) intracellular membrane-bounded organelle (IEA,ISO) membrane (IEA,ISO) mitochondrion (IEA,ISO) neuromuscular junction (EXP,IDA) nucleus (IEA,ISO) perinuclear region of cytoplasm (IEA,ISO,ISS) plasma membrane (IEA,ISO) presynaptic cytosol (IDA) synapse (IEA) T-tubule (IDA)
Molecular Function
14-3-3 protein binding (IEA,ISO) actin monomer binding (IEA,ISO,ISS) ATP binding (IEA) diacylglycerol-dependent serine/threonine kinase activity (IEA) diacylglycerol-dependent, calcium-independent serine/threonine kinase activity (IEA,IMP,ISO) enzyme activator activity (IEA,ISO) enzyme binding (IEA,ISO) ethanol binding (IEA,ISO) kinase activity (IEA) metal ion binding (IEA) nucleotide binding (IEA) protein binding (IPI,ISO) protein kinase activity (IEA,ISO,ISS) protein kinase binding (IPI) protein serine kinase activity (IEA) protein serine/threonine kinase activity (IBA,IEA,ISO) protein serine/threonine kinase binding (IPI) SH3 domain binding (IPI) signaling receptor activator activity (IEA,ISO) signaling receptor binding (IPI) transferase activity (IEA) zinc ion binding (IEA)
1.
Protein kinase C translocation and PKC-dependent protein phosphorylation during myocardial ischemia.
Albert CJ and Ford DA, Am J Physiol. 1999 Feb;276(2 Pt 2):H642-50.
2.
Skin immunosenescence: decreased receptor for activated C kinase-1 expression correlates with defective tumour necrosis factor-alpha production in epidermal cells.
Corsini E, etal., Br J Dermatol. 2009 Jan;160(1):16-25. Epub 2008 Oct 11.
3.
The coatomer protein beta'-COP, a selective binding protein (RACK) for protein kinase Cepsilon.
Csukai M, etal., J Biol Chem 1997 Nov 14;272(46):29200-6.
4.
Post-conditioning protects cardiomyocytes from apoptosis via PKC(epsilon)-interacting with calcium-sensing receptors to inhibit endo(sarco)plasmic reticulum-mitochondria crosstalk.
Dong S, etal., Mol Cell Biochem. 2010 Aug;341(1-2):195-206. doi: 10.1007/s11010-010-0450-5. Epub 2010 Apr 11.
5.
Adenoprotection of the heart involves phospholipase C-induced activation and translocation of PKC-epsilon to RACK2 in adult rat and mouse.
Fenton RA, etal., Am J Physiol Heart Circ Physiol. 2009 Aug;297(2):H718-25. Epub 2009 Jun 12.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
8.
CASK associates with glutamate receptor interacting protein and signaling molecules.
Hong CJ and Hsueh YP, Biochem Biophys Res Commun. 2006 Dec 22;351(3):771-6. Epub 2006 Oct 30.
9.
MicroRNA-143 promotes cardiac ischemia-mediated mitochondrial impairment by the inhibition of protein kinase Cepsilon.
Hong H, etal., Basic Res Cardiol. 2017 Sep 8;112(6):60. doi: 10.1007/s00395-017-0649-7.
10.
Isolation of cDNA clones encoding protein kinase C: evidence for a protein kinase C-related gene family.
Housey GM, etal., Proc Natl Acad Sci U S A 1987 Feb;84(4):1065-9.
11.
PKCepsilon-PKD1 signaling complex at Z-discs plays a pivotal role in the cardiac hypertrophy induced by G-protein coupling receptor agonists.
Iwata M, etal., Biochem Biophys Res Commun. 2005 Feb 25;327(4):1105-13. doi: 10.1016/j.bbrc.2004.12.128.
12.
The regulatory domain of protein kinase C delta positively regulates insulin receptor signaling.
Jacob AI, etal., J Mol Endocrinol. 2010 Mar;44(3):155-69. Epub 2009 Dec 1.
13.
Protein kinase C isozymes in hypertension and hypertrophy: insight from SHHF rat hearts.
Johnsen DD, etal., Mol Cell Biochem. 2005 Feb;270(1-2):63-9.
14.
Mammalian homologue of the Caenorhabditis elegans UNC-76 protein involved in axonal outgrowth is a protein kinase C zeta-interacting protein.
Kuroda S, etal., J Cell Biol 1999 Feb 8;144(3):403-11.
15.
Selective changes in protein kinase C isoforms and phosphorylation of endogenous substrate proteins in rat cerebral cortex during pre- and postnatal ethanol exposure.
Mahadev K and Vemuri MC, Arch Biochem Biophys. 1998 Aug 15;356(2):249-57.
16.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
17.
Role of protein kinase C in the signal pathways that link Na+/K+-ATPase to ERK1/2.
Mohammadi K, etal., J Biol Chem 2001 Nov 9;276(45):42050-6.
18.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
19.
Protein kinase C: poised to signal.
Newton AC Am J Physiol Endocrinol Metab. 2010 Mar;298(3):E395-402. Epub 2009 Nov 24.
20.
The novel protein kinase C epsilon isoform modulates acetylcholine release in the rat neuromuscular junction.
Obis T, etal., Mol Brain. 2015 Dec 1;8(1):80. doi: 10.1186/s13041-015-0171-5.
21.
The structure, expression, and properties of additional members of the protein kinase C family.
Ono Y, etal., J Biol Chem 1988 May 15;263(14):6927-32.
22.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
23.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
24.
GOA pipeline
RGD automated data pipeline
25.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
26.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
27.
Cellular and intracellular localization of epsilon-subspecies of protein kinase C in the rat brain; presynaptic localization of the epsilon-subspecies.
Saito N, etal., Brain Res. 1993 Apr 2;607(1-2):241-8.
28.
Expression of Protein Kinase C Isoforms in Pancreatic Islets and Liver of Male Goto-Kakizaki Rats, a Model of Type 2 Diabetes.
Seed Ahmed M, etal., PLoS One. 2015 Sep 23;10(9):e0135781. doi: 10.1371/journal.pone.0135781. eCollection 2015.
29.
Molecular cloning and characterization of a novel protein kinase C-interacting protein with structural motifs related to RBCC family proteins.
Tokunaga C, etal., Biochem Biophys Res Commun 1998 Mar 17;244(2):353-9.
30.
Role of coronin 1B in PDGF-induced migration of vascular smooth muscle cells.
Williams HC, etal., Circ Res. 2012 Jun 22;111(1):56-65. doi: 10.1161/CIRCRESAHA.111.255745. Epub 2012 May 22.
31.
Changes in protein kinase C (PKC) activity, isozyme translocation, and GAP-43 phosphorylation in the rat hippocampal formation after a single-trial contextual fear conditioning paradigm.
Young E, etal., Hippocampus 2002;12(4):457-64.
Prkce Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 13,718,050 - 14,204,931 (-) NCBI GRCr8 mRatBN7.2 6 7,965,048 - 8,451,966 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 7,965,048 - 8,451,719 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 8,241,962 - 8,728,298 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 8,551,358 - 9,037,685 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 8,078,663 - 8,564,995 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 9,483,400 - 9,973,396 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 9,790,422 - 9,973,396 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 9,404,548 - 9,883,579 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 9,631,234 - 10,097,311 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 9,631,241 - 10,097,311 (+) NCBI Celera 6 7,696,161 - 8,179,574 (-) NCBI Celera Cytogenetic Map 6 q12 NCBI
PRKCE Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 45,651,279 - 46,187,990 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 45,651,345 - 46,187,990 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 45,878,814 - 46,415,129 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 45,732,547 - 46,268,633 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 45,790,693 - 46,326,779 NCBI Celera 2 45,717,245 - 46,253,470 (+) NCBI Celera Cytogenetic Map 2 p21 NCBI HuRef 2 45,617,217 - 46,153,158 (+) NCBI HuRef CHM1_1 2 45,810,047 - 46,345,904 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 45,656,327 - 46,193,193 (+) NCBI T2T-CHM13v2.0
Prkce Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 86,472,631 - 86,965,347 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 86,475,213 - 86,965,347 (+) Ensembl GRCm39 Ensembl GRCm38 17 86,167,785 - 86,657,919 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 86,167,785 - 86,657,919 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 86,567,125 - 87,057,259 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 86,076,916 - 86,563,024 (+) NCBI MGSCv36 mm8 Celera 17 90,540,474 - 91,038,578 (+) NCBI Celera Cytogenetic Map 17 E4 NCBI cM Map 17 56.74 NCBI
Prkce Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955441 12,642,697 - 13,139,372 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955441 12,642,703 - 13,142,396 (+) NCBI ChiLan1.0 ChiLan1.0
PRKCE Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 80,214,185 - 80,750,763 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 80,218,154 - 80,754,448 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 45,757,629 - 46,294,064 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 46,688,109 - 47,223,421 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 46,688,436 - 47,220,313 (+) Ensembl panpan1.1 panPan2
PRKCE Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 47,976,929 - 48,464,614 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 47,976,768 - 48,535,296 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 47,832,146 - 48,319,423 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 48,849,986 - 49,335,766 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 48,849,926 - 49,335,759 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 48,557,609 - 49,044,861 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 48,849,404 - 49,334,809 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 49,029,809 - 49,517,384 (+) NCBI UU_Cfam_GSD_1.0
Prkce Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 34,589,765 - 35,066,607 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936508 6,017,551 - 6,494,427 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936508 6,018,374 - 6,495,216 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRKCE Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 94,349,889 - 94,866,306 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 94,351,277 - 94,864,549 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 100,427,723 - 100,762,372 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRKCE Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 61,022,903 - 61,570,390 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 61,026,017 - 61,242,343 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 50,297,930 - 50,835,743 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prkce
.
Predicted Target Of
Count of predictions: 66 Count of miRNA genes: 52 Interacting mature miRNAs: 57 Transcripts: ENSRNOT00000020959 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
8552962 Pigfal16 Plasma insulin-like growth factor 1 level QTL 16 9.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 6 1 41223769 Rat 7411603 Foco13 Food consumption QTL 13 5.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 6 1 41223769 Rat 1598843 Cm63 Cardiac mass QTL 63 2.6 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 1 39036266 Rat 738024 Sach5 Saccharine consumption QTL 5 3.9 0.00039 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 6 1 43394190 Rat 1549905 Stresp10 Stress response QTL 10 6.83 0.0066 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 6 1 27574569 Rat 7411542 Bw127 Body weight QTL 127 5.5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 1 41223769 Rat 8693699 Alc37 Alcohol consumption QTL 37 2.6 0.224 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 6 7964167 21301982 Rat 2293706 Bmd20 Bone mineral density QTL 20 4.3 0.0002 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 6 5074497 19988050 Rat 9589048 Scfw3 Subcutaneous fat weight QTL 3 4.57 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 6 1 41223769 Rat 1331743 Uae28 Urinary albumin excretion QTL 28 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 1 34235784 Rat 738023 Alc17 Alcohol consumption QTL 17 3.1 0.003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 6 1 27574569 Rat 1354616 Despr12 Despair related QTL 12 0.0012 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 6 1 27574569 Rat 2293709 Bss23 Bone structure and strength QTL 23 5.18 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 6 1 42487980 Rat 2293650 Bss31 Bone structure and strength QTL 31 5.05 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 6 1 42487980 Rat 7411584 Foco4 Food consumption QTL 4 4.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 6 1 42838846 Rat 2300176 Bmd51 Bone mineral density QTL 51 11.7 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 6 1 27574569 Rat 1300128 Rf16 Renal function QTL 16 3.89 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 5074497 34434305 Rat 2301972 Bp325 Blood pressure QTL 325 4.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 1 72227641 Rat 1300164 Rf15 Renal function QTL 15 3.12 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 5074497 54641141 Rat 2293656 Bss28 Bone structure and strength QTL 28 6.79 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 6 1 42487980 Rat 9589129 Insul24 Insulin level QTL 24 19.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 6 1 41223769 Rat 2300190 Bmd52 Bone mineral density QTL 52 11.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 6 1 27574569 Rat 1578758 Tcas9 Tongue tumor susceptibility QTL 9 3.29 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 6 1 37618905 Rat 8693690 Alc35 Alcohol consumption QTL 35 2.2 0.606 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 6 7964167 21301982 Rat
D6Rat211
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 6 14,028,632 - 14,028,767 (+) Marker Load Pipeline mRatBN7.2 6 8,275,655 - 8,275,790 (-) MAPPER mRatBN7.2 Rnor_6.0 6 9,659,961 - 9,660,095 NCBI Rnor6.0 Rnor_5.0 6 9,577,576 - 9,577,710 UniSTS Rnor5.0 RGSC_v3.4 6 9,807,867 - 9,808,002 RGD RGSC3.4 RGSC_v3.4 6 9,807,868 - 9,808,002 UniSTS RGSC3.4 RGSC_v3.1 6 9,807,867 - 9,808,002 RGD Celera 6 8,004,968 - 8,005,102 UniSTS SHRSP x BN Map 6 1.1099 UniSTS SHRSP x BN Map 6 1.1099 RGD Cytogenetic Map 6 q12 UniSTS
RH132957
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 8,232,099 - 8,232,286 (-) MAPPER mRatBN7.2 Rnor_6.0 6 9,704,663 - 9,704,849 NCBI Rnor6.0 Rnor_5.0 6 9,619,780 - 9,619,966 UniSTS Rnor5.0 Celera 6 7,961,503 - 7,961,689 UniSTS Cytogenetic Map 6 q12 UniSTS
RH133520
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 7,964,891 - 7,965,091 (-) MAPPER mRatBN7.2 Rnor_6.0 6 9,973,353 - 9,973,552 NCBI Rnor6.0 Rnor_5.0 6 9,883,536 - 9,883,735 UniSTS Rnor5.0 RGSC_v3.4 6 10,097,268 - 10,097,467 UniSTS RGSC3.4 Celera 6 7,696,005 - 7,696,204 UniSTS Cytogenetic Map 6 q12 UniSTS
RH140883
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 8,181,763 - 8,181,960 (-) MAPPER mRatBN7.2 Rnor_6.0 6 9,754,982 - 9,755,178 NCBI Rnor6.0 Rnor_5.0 6 9,669,040 - 9,669,236 UniSTS Rnor5.0 RGSC_v3.4 6 9,878,012 - 9,878,208 UniSTS RGSC3.4 Celera 6 7,911,138 - 7,911,334 UniSTS Cytogenetic Map 6 q12 UniSTS
AL033630
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 7,972,792 - 7,974,085 (-) MAPPER mRatBN7.2 Rnor_6.0 6 9,964,359 - 9,965,651 NCBI Rnor6.0 Rnor_5.0 6 9,874,542 - 9,875,834 UniSTS Rnor5.0 RGSC_v3.4 6 10,088,274 - 10,089,566 UniSTS RGSC3.4 Cytogenetic Map 6 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020959 ⟹ ENSRNOP00000020959
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 7,965,048 - 8,451,319 (-) Ensembl Rnor_6.0 Ensembl 6 9,790,422 - 9,973,396 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000089272 ⟹ ENSRNOP00000070421
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 8,441,785 - 8,451,719 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097902 ⟹ ENSRNOP00000083427
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 7,965,048 - 8,451,319 (-) Ensembl
RefSeq Acc Id:
NM_017171 ⟹ NP_058867
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 13,718,050 - 14,204,288 (-) NCBI mRatBN7.2 6 7,965,048 - 8,451,327 (-) NCBI Rnor_6.0 6 9,483,400 - 9,973,396 (+) NCBI Rnor_5.0 6 9,404,548 - 9,883,579 (+) NCBI RGSC_v3.4 6 9,631,234 - 10,097,311 (+) RGD Celera 6 7,696,161 - 8,179,574 (-) RGD
Sequence:
GAATTCCGGAATCCGGCGAGGAAATACATGCACTCGCTGAGAATCGCCGGCGCCAGGACGCAGCGCCACAAGGTGTAGCGAGTGAGTGGGGTGGGGCAAGAGGGGACCCAGGAGTCCCCCCAGGCTCC
hide sequence
RefSeq Acc Id:
XM_039111827 ⟹ XP_038967755
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 13,718,360 - 14,204,931 (-) NCBI mRatBN7.2 6 7,965,352 - 8,451,966 (-) NCBI
RefSeq Acc Id:
NP_058867 ⟸ NM_017171
- UniProtKB:
P09216 (UniProtKB/Swiss-Prot), F1LMV8 (UniProtKB/TrEMBL), Q6DUV1 (UniProtKB/TrEMBL)
- Sequence:
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTNSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLEPEGKVYVI
hide sequence
Ensembl Acc Id:
ENSRNOP00000020959 ⟸ ENSRNOT00000020959
RefSeq Acc Id:
XP_038967755 ⟸ XM_039111827
- Peptide Label:
isoform X1
- UniProtKB:
P09216 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSRNOP00000083427 ⟸ ENSRNOT00000097902
Ensembl Acc Id:
ENSRNOP00000070421 ⟸ ENSRNOT00000089272
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Prkce
protein kinase C, epsilon
Name updated
70584 APPROVED
2001-12-12
Prkce
protein kinase C, epsilon
Symbol and Name updated to reflect Human and Mouse nomenclature
69665 APPROVED
2001-12-10
Prkce
protein kinase C, epsilon
--select from list or type below--
69665 WITHDRAWN
Note Type
Note
Reference
gene_drugs
activation by the digitalis drug ouabain is linked to Na+/K+-ATPase through Src/EGFR, and is required for the activation of ERK1/2
628493
