Symbol:
Psmc3
Name:
proteasome 26S subunit, ATPase 3
RGD ID:
61905
Description:
Predicted to enable identical protein binding activity and proteasome-activating activity. Predicted to be involved in modulation by host of viral transcription; positive regulation of transcription by RNA polymerase II; and proteasome-mediated ubiquitin-dependent protein catabolic process. Predicted to act upstream of or within blastocyst development. Located in perinuclear region of cytoplasm. Orthologous to human PSMC3 (proteasome 26S subunit, ATPase 3); PARTICIPATES IN ubiquitin/proteasome degradation pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1,2,4-trimethylbenzene; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
26S protease regulatory subunit 6A; 26S proteasome AAA-ATPase subunit RPT5; 26S proteasome regulatory subunit 6A; proteasome (prosome, macropain) 26S subunit, ATPase 3; proteasome 26S subunit ATPase 3; spermatogenic cell/sperm-associated TAT-binding protein homolog SATA; TAT-binding protein 1; TBP-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PSMC3 (proteasome 26S subunit, ATPase 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Psmc3 (proteasome (prosome, macropain) 26S subunit, ATPase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Psmc3 (proteasome 26S subunit, ATPase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PSMC3 (proteasome 26S subunit, ATPase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PSMC3 (proteasome 26S subunit, ATPase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Psmc3 (proteasome 26S subunit, ATPase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PSMC3 (proteasome 26S subunit, ATPase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PSMC3 (proteasome 26S subunit, ATPase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Psmc3 (proteasome 26S subunit, ATPase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Psmc3 (proteasome (prosome, macropain) 26S subunit, ATPase 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PSMC3 (proteasome 26S subunit, ATPase 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
psmc3 (proteasome 26S subunit, ATPase 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
rpt-5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RPT5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Rpt5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
psmc3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 97,487,643 - 97,493,025 (+) NCBI GRCr8 mRatBN7.2 3 77,031,825 - 77,037,207 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 77,031,825 - 77,043,358 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 80,510,318 - 80,515,699 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 89,109,333 - 89,114,714 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 86,960,503 - 86,965,883 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 79,876,938 - 79,882,319 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 79,876,938 - 79,882,319 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 86,585,691 - 86,591,072 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 75,413,567 - 75,418,948 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 75,309,938 - 75,315,317 (+) NCBI Celera 3 76,240,531 - 76,245,912 (+) NCBI Celera Cytogenetic Map 3 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Psmc3 Rat (1->4)-beta-D-glucan multiple interactions ISO Psmc3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PSMC3 mRNA CTD PMID:36331819 Psmc3 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane affects expression EXP 6480464 o and p'-DDT affects the expression of PSMC3 mRNA CTD PMID:17984292 Psmc3 Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of PSMC3 protein CTD PMID:17337753 Psmc3 Rat 1,2-dimethylhydrazine increases expression ISO Psmc3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PSMC3 mRNA CTD PMID:22206623 Psmc3 Rat 1,2-dimethylhydrazine multiple interactions ISO Psmc3 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of PSMC3 mRNA CTD PMID:22206623 Psmc3 Rat 14-Deoxy-11,12-didehydroandrographolide decreases expression ISO PSMC3 (Homo sapiens) 6480464 14-deoxy-11 and 12-didehydroandrographolide results in decreased expression of PSMC3 mRNA CTD PMID:22101062 Psmc3 Rat 17alpha-ethynylestradiol multiple interactions ISO Psmc3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PSMC3 mRNA CTD PMID:17942748 Psmc3 Rat 17beta-estradiol increases expression ISO PSMC3 (Homo sapiens) 6480464 Estradiol results in increased expression of PSMC3 mRNA CTD PMID:19167446 Psmc3 Rat 17beta-estradiol increases expression ISO Psmc3 (Mus musculus) 6480464 Estradiol results in increased expression of PSMC3 mRNA CTD PMID:39298647 Psmc3 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO PSMC3 (Homo sapiens) 6480464 Metribolone results in increased expression of PSMC3 protein CTD PMID:17152098 Psmc3 Rat 1H-pyrazole increases expression ISO Psmc3 (Mus musculus) 6480464 pyrazole results in increased expression of PSMC3 mRNA CTD PMID:17945193 Psmc3 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Psmc3 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Psmc3 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:31826744 Psmc3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Psmc3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PSMC3 mRNA CTD PMID:17942748 Psmc3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PSMC3 mRNA CTD PMID:33387578 Psmc3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PSMC3 mRNA CTD PMID:34747641 Psmc3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Psmc3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PSMC3 mRNA CTD PMID:21570461 Psmc3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PSMC3 mRNA CTD PMID:21215274 Psmc3 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Psmc3 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO Psmc3 (Mus musculus) 6480464 2 more ... CTD PMID:18550172 Psmc3 Rat 2-amino-14,16-dimethyloctadecan-3-ol decreases expression ISO PSMC3 (Homo sapiens) 6480464 2-amino-14 and 16-dimethyloctadecan-3-ol results in decreased expression of PSMC3 protein CTD PMID:32044396 Psmc3 Rat 2-bromohexadecanoic acid multiple interactions ISO PSMC3 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PSMC3 protein] CTD PMID:38195004 Psmc3 Rat 2-hydroxypropanoic acid decreases expression ISO PSMC3 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PSMC3 mRNA CTD PMID:30851411 Psmc3 Rat 2-methoxyethanol decreases expression EXP 6480464 methyl cellosolve results in decreased expression of PSMC3 protein CTD PMID:15928459 Psmc3 Rat 4,4'-sulfonyldiphenol increases expression ISO Psmc3 (Mus musculus) 6480464 bisphenol S results in increased expression of PSMC3 mRNA CTD PMID:39298647 Psmc3 Rat 4,4'-sulfonyldiphenol affects expression ISO PSMC3 (Homo sapiens) 6480464 bisphenol S affects the expression of PSMC3 protein CTD PMID:31945527 Psmc3 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of PSMC3 mRNA CTD PMID:19483382 Psmc3 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of PSMC3 mRNA CTD PMID:19483382 Psmc3 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of PSMC3 mRNA CTD PMID:28959563 Psmc3 Rat all-trans-retinoic acid multiple interactions ISO PSMC3 (Homo sapiens) 6480464 [Tretinoin co-treated with Ascorbic Acid] results in increased expression of PSMC3 mRNA CTD PMID:16443354 Psmc3 Rat all-trans-retinoic acid decreases expression ISO PSMC3 (Homo sapiens) 6480464 Tretinoin results in decreased expression of PSMC3 mRNA CTD PMID:33167477 Psmc3 Rat alpha-hexachlorocyclohexane increases expression EXP 6480464 alpha-hexachlorocyclohexane results in increased expression of PSMC3 mRNA CTD PMID:16940010 Psmc3 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of PSMC3 mRNA CTD PMID:19483382 Psmc3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PSMC3 mRNA CTD PMID:16483693 Psmc3 Rat arsenous acid increases expression ISO PSMC3 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PSMC3 mRNA CTD PMID:29633893 Psmc3 Rat arsenous acid multiple interactions ISO PSMC3 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to PSMC3 protein] CTD PMID:26598702 Psmc3 Rat atrazine decreases expression ISO PSMC3 (Homo sapiens) 6480464 Atrazine results in decreased expression of PSMC3 mRNA CTD PMID:22378314 Psmc3 Rat benzatropine increases expression ISO PSMC3 (Homo sapiens) 6480464 Benztropine results in increased expression of PSMC3 protein CTD PMID:34122009 Psmc3 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of PSMC3 mRNA CTD PMID:19483382 Psmc3 Rat benzo[a]pyrene multiple interactions ISO PSMC3 (Homo sapiens) 6480464 [Soot co-treated with Benzo(a)pyrene] results in decreased expression of PSMC3 protein modified form CTD PMID:24464499 Psmc3 Rat benzo[a]pyrene affects methylation ISO PSMC3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PSMC3 promoter CTD PMID:27901495 Psmc3 Rat benzo[a]pyrene increases methylation ISO Psmc3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of PSMC3 exon and Benzo(a)pyrene results in increased methylation of PSMC3 intron CTD PMID:27901495 Psmc3 Rat beta-lapachone increases expression ISO PSMC3 (Homo sapiens) 6480464 beta-lapachone results in increased expression of PSMC3 mRNA CTD PMID:38218311 Psmc3 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of PSMC3 mRNA CTD PMID:21318169 Psmc3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PSMC3 mRNA CTD PMID:25181051 Psmc3 Rat bisphenol A decreases expression ISO PSMC3 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PSMC3 mRNA and bisphenol A results in decreased expression of PSMC3 protein CTD PMID:29275510 and PMID:34186270 Psmc3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PSMC3 mRNA CTD PMID:30816183 more ... Psmc3 Rat bisphenol AF increases expression ISO PSMC3 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PSMC3 protein CTD PMID:34186270 Psmc3 Rat Bisphenol B increases expression ISO PSMC3 (Homo sapiens) 6480464 bisphenol B results in increased expression of PSMC3 protein CTD PMID:34186270 Psmc3 Rat bromobenzene affects binding EXP 6480464 bromobenzene metabolite binds to PSMC3 protein CTD PMID:17305373 Psmc3 Rat cadmium atom multiple interactions ISO PSMC3 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PSMC3 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PSMC3 protein CTD PMID:38195004 Psmc3 Rat cadmium dichloride decreases expression ISO PSMC3 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of PSMC3 mRNA CTD PMID:12160620 Psmc3 Rat cadmium dichloride multiple interactions ISO PSMC3 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PSMC3 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PSMC3 protein CTD PMID:38195004 Psmc3 Rat caffeine decreases expression ISO PSMC3 (Homo sapiens) 6480464 Caffeine results in decreased expression of PSMC3 protein CTD PMID:31195006 Psmc3 Rat cisplatin increases expression ISO PSMC3 (Homo sapiens) 6480464 Cisplatin results in increased expression of PSMC3 mRNA CTD PMID:27594783 Psmc3 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of PSMC3 mRNA CTD PMID:19483382 Psmc3 Rat clofibrate decreases expression ISO Psmc3 (Mus musculus) 6480464 Clofibrate results in decreased expression of PSMC3 mRNA CTD PMID:17585979 Psmc3 Rat clofibrate multiple interactions ISO Psmc3 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of PSMC3 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of PSMC3 mRNA] CTD PMID:17585979 Psmc3 Rat clozapine increases expression ISO PSMC3 (Homo sapiens) 6480464 Clozapine results in increased expression of PSMC3 protein CTD PMID:34122009 Psmc3 Rat cobalt dichloride decreases expression ISO PSMC3 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PSMC3 mRNA CTD PMID:19376846 Psmc3 Rat coumarin increases phosphorylation ISO PSMC3 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of PSMC3 protein CTD PMID:35688186 Psmc3 Rat coumestrol multiple interactions ISO PSMC3 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Psmc3 Rat coumestrol increases expression ISO PSMC3 (Homo sapiens) 6480464 Coumestrol results in increased expression of PSMC3 mRNA CTD PMID:19167446 Psmc3 Rat cyclosporin A increases expression ISO PSMC3 (Homo sapiens) 6480464 Cyclosporine results in increased expression of PSMC3 mRNA CTD PMID:20106945 and PMID:27989131 Psmc3 Rat diarsenic trioxide multiple interactions ISO PSMC3 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to PSMC3 protein] CTD PMID:26598702 Psmc3 Rat diarsenic trioxide increases expression ISO PSMC3 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PSMC3 mRNA CTD PMID:29633893 Psmc3 Rat Dibutyl phosphate affects expression ISO PSMC3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PSMC3 mRNA CTD PMID:37042841 Psmc3 Rat dibutyl phthalate decreases expression ISO Psmc3 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of PSMC3 mRNA CTD PMID:17361019 Psmc3 Rat doxorubicin increases expression ISO PSMC3 (Homo sapiens) 6480464 Doxorubicin results in increased expression of PSMC3 mRNA CTD PMID:29803840 Psmc3 Rat Enterolactone multiple interactions ISO PSMC3 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of PSMC3 mRNA CTD PMID:19167446 Psmc3 Rat ethanol affects splicing ISO Psmc3 (Mus musculus) 6480464 Ethanol affects the splicing of PSMC3 mRNA CTD PMID:30319688 Psmc3 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of PSMC3 mRNA CTD PMID:24136188 Psmc3 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PSMC3 mRNA CTD PMID:24136188 Psmc3 Rat folic acid multiple interactions ISO Psmc3 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of PSMC3 mRNA CTD PMID:22206623 Psmc3 Rat FR900359 increases phosphorylation ISO PSMC3 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of PSMC3 protein CTD PMID:37730182 Psmc3 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of PSMC3 mRNA CTD PMID:24136188 Psmc3 Rat hydrazine increases expression ISO Psmc3 (Mus musculus) 6480464 hydrazine results in increased expression of PSMC3 mRNA CTD PMID:15282401 Psmc3 Rat hydrogen peroxide decreases expression ISO PSMC3 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of PSMC3 mRNA CTD PMID:12419474 Psmc3 Rat ivermectin decreases expression ISO PSMC3 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PSMC3 protein CTD PMID:32959892 Psmc3 Rat L-ascorbic acid multiple interactions ISO PSMC3 (Homo sapiens) 6480464 [Tretinoin co-treated with Ascorbic Acid] results in increased expression of PSMC3 mRNA CTD PMID:16443354 Psmc3 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of PSMC3 mRNA CTD PMID:19483382 Psmc3 Rat lead(0) affects expression ISO PSMC3 (Homo sapiens) 6480464 Lead affects the expression of PSMC3 mRNA CTD PMID:28903495 Psmc3 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of PSMC3 mRNA CTD PMID:24136188 Psmc3 Rat manganese atom multiple interactions ISO PSMC3 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of PSMC3 mRNA CTD PMID:39836092 Psmc3 Rat manganese(0) multiple interactions ISO PSMC3 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of PSMC3 mRNA CTD PMID:39836092 Psmc3 Rat manganese(II) chloride multiple interactions ISO PSMC3 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of PSMC3 mRNA CTD PMID:39836092 Psmc3 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of PSMC3 protein CTD PMID:19826936 Psmc3 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO PSMC3 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of PSMC3 mRNA CTD PMID:31806706 Psmc3 Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of PSMC3 protein CTD PMID:19716841 Psmc3 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of PSMC3 mRNA CTD PMID:24136188 Psmc3 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of PSMC3 mRNA CTD PMID:24136188 Psmc3 Rat nitrates multiple interactions ISO Psmc3 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PSMC3 mRNA CTD PMID:35964746 Psmc3 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of PSMC3 mRNA CTD PMID:19483382 Psmc3 Rat ozone increases expression ISO PSMC3 (Homo sapiens) 6480464 Ozone results in increased expression of PSMC3 mRNA CTD PMID:23033980 Psmc3 Rat paracetamol multiple interactions ISO Psmc3 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of PSMC3 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of PSMC3 mRNA] CTD PMID:17585979 Psmc3 Rat perfluorooctane-1-sulfonic acid increases expression ISO Psmc3 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of PSMC3 protein CTD PMID:26178269 Psmc3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Psmc3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PSMC3 mRNA CTD PMID:36331819 Psmc3 Rat perfluorooctanoic acid decreases expression ISO PSMC3 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of PSMC3 protein CTD PMID:22609092 Psmc3 Rat phenethyl isothiocyanate affects binding ISO PSMC3 (Homo sapiens) 6480464 PSMC3 protein binds to phenethyl isothiocyanate CTD PMID:21838287 Psmc3 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of PSMC3 mRNA CTD PMID:19162173 and PMID:21318169 Psmc3 Rat picrotoxin decreases expression EXP 6480464 Picrotoxin results in decreased expression of PSMC3 mRNA CTD PMID:15170462 Psmc3 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of PSMC3 mRNA CTD PMID:22484513 Psmc3 Rat pirinixic acid multiple interactions ISO PSMC3 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of PSMC3 mRNA CTD PMID:19710929 Psmc3 Rat pirinixic acid increases expression ISO Psmc3 (Mus musculus) 6480464 pirinixic acid results in increased expression of PSMC3 mRNA CTD PMID:23811191 Psmc3 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of PSMC3 mRNA CTD PMID:19483382 Psmc3 Rat rac-lactic acid decreases expression ISO PSMC3 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PSMC3 mRNA CTD PMID:30851411 Psmc3 Rat resveratrol multiple interactions ISO PSMC3 (Homo sapiens) 6480464 [Coumestrol co-treated with Resveratrol] results in increased expression of PSMC3 mRNA and [Plant Extracts co-treated with Resveratrol] results in increased expression of PSMC3 mRNA CTD PMID:19167446 and PMID:23557933 Psmc3 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of PSMC3 protein CTD PMID:35544339 Psmc3 Rat sodium arsenite affects expression ISO Psmc3 (Mus musculus) 6480464 sodium arsenite affects the expression of PSMC3 mRNA CTD PMID:16507464 Psmc3 Rat sodium arsenite increases expression ISO PSMC3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PSMC3 mRNA CTD PMID:34032870 and PMID:38568856 Psmc3 Rat sunitinib decreases expression ISO PSMC3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of PSMC3 mRNA CTD PMID:31533062 Psmc3 Rat temozolomide increases expression ISO PSMC3 (Homo sapiens) 6480464 Temozolomide results in increased expression of PSMC3 mRNA CTD PMID:31758290 Psmc3 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of PSMC3 mRNA CTD PMID:19483382 Psmc3 Rat thiram decreases expression ISO PSMC3 (Homo sapiens) 6480464 Thiram results in decreased expression of PSMC3 mRNA CTD PMID:38568856 Psmc3 Rat titanium dioxide increases methylation ISO Psmc3 (Mus musculus) 6480464 titanium dioxide results in increased methylation of PSMC3 gene and titanium dioxide results in increased methylation of PSMC3 promoter CTD PMID:35295148 Psmc3 Rat triptonide affects expression ISO Psmc3 (Mus musculus) 6480464 triptonide affects the expression of PSMC3 mRNA CTD PMID:33045310 Psmc3 Rat urethane decreases expression ISO PSMC3 (Homo sapiens) 6480464 Urethane results in decreased expression of PSMC3 mRNA CTD PMID:28818685 Psmc3 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of PSMC3 mRNA CTD PMID:24136188 Psmc3 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of PSMC3 mRNA CTD PMID:21318169 Psmc3 Rat zearalenone decreases expression ISO Psmc3 (Mus musculus) 6480464 Zearalenone results in decreased expression of PSMC3 protein CTD PMID:36252740 Psmc3 Rat zinc atom decreases expression EXP 6480464 Zinc deficiency results in decreased expression of PSMC3 mRNA CTD PMID:11717422 Psmc3 Rat zinc(0) decreases expression EXP 6480464 Zinc deficiency results in decreased expression of PSMC3 mRNA CTD PMID:11717422
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP) 1,2,4-trimethylbenzene (EXP) 1,2-dimethylhydrazine (ISO) 14-Deoxy-11,12-didehydroandrographolide (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 1H-pyrazole (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-amino-14,16-dimethyloctadecan-3-ol (ISO) 2-bromohexadecanoic acid (ISO) 2-hydroxypropanoic acid (ISO) 2-methoxyethanol (EXP) 4,4'-sulfonyldiphenol (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) all-trans-retinoic acid (ISO) alpha-hexachlorocyclohexane (EXP) amiodarone (EXP) ammonium chloride (EXP) arsenous acid (ISO) atrazine (ISO) benzatropine (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bromobenzene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) cisplatin (ISO) clofibrate (EXP,ISO) clozapine (ISO) cobalt dichloride (ISO) coumarin (ISO) coumestrol (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) doxorubicin (ISO) Enterolactone (ISO) ethanol (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) FR900359 (ISO) glafenine (EXP) hydrazine (ISO) hydrogen peroxide (ISO) ivermectin (ISO) L-ascorbic acid (ISO) L-ethionine (EXP) lead(0) (ISO) leflunomide (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methamphetamine (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-nitrosomorpholine (EXP) nefazodone (EXP) nimesulide (EXP) nitrates (ISO) omeprazole (EXP) ozone (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenethyl isothiocyanate (ISO) phenobarbital (EXP) picrotoxin (EXP) piperonyl butoxide (EXP) pirinixic acid (EXP,ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (EXP) sodium arsenite (ISO) sunitinib (ISO) temozolomide (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) triptonide (ISO) urethane (ISO) valdecoxib (EXP) valproic acid (EXP) zearalenone (ISO) zinc atom (EXP) zinc(0) (EXP)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat alpha-synuclein interacts with Tat binding protein 1, a component of the 26S proteasomal complex.
Ghee M, etal., J Neurochem. 2000 Nov;75(5):2221-4.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Structures of the rat proteasomal ATPases: determination of highly conserved structural motifs and rules for their spacing.
Makino Y, etal., Biochem Biophys Res Commun 1996 Mar 27;220(3):1049-54.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
8.
GOA pipeline
RGD automated data pipeline
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
A protein associated with the manchette during rat spermiogenesis is encoded by a gene of the TBP-1-like subfamily with highly conserved ATPase and protease domains.
Rivkin E, etal., Mol Reprod Dev 1997 Sep;48(1):77-89.
11.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
12.
The EARP Complex and Its Interactor EIPR-1 Are Required for Cargo Sorting to Dense-Core Vesicles.
Topalidou I, etal., PLoS Genet. 2016 May 18;12(5):e1006074. doi: 10.1371/journal.pgen.1006074. eCollection 2016 May.
Psmc3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 97,487,643 - 97,493,025 (+) NCBI GRCr8 mRatBN7.2 3 77,031,825 - 77,037,207 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 77,031,825 - 77,043,358 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 80,510,318 - 80,515,699 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 89,109,333 - 89,114,714 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 86,960,503 - 86,965,883 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 79,876,938 - 79,882,319 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 79,876,938 - 79,882,319 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 86,585,691 - 86,591,072 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 75,413,567 - 75,418,948 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 75,309,938 - 75,315,317 (+) NCBI Celera 3 76,240,531 - 76,245,912 (+) NCBI Celera Cytogenetic Map 3 q24 NCBI
PSMC3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 47,418,775 - 47,426,439 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 47,418,769 - 47,426,473 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 47,440,326 - 47,447,990 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 47,396,896 - 47,404,600 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 47,396,895 - 47,404,565 NCBI Celera 11 47,582,015 - 47,589,718 (-) NCBI Celera Cytogenetic Map 11 p11.2 NCBI HuRef 11 47,139,662 - 47,147,028 (-) NCBI HuRef CHM1_1 11 47,439,552 - 47,447,251 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 47,577,679 - 47,585,336 (-) NCBI T2T-CHM13v2.0
Psmc3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 90,884,361 - 90,889,783 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 90,884,354 - 90,896,714 (+) Ensembl GRCm39 Ensembl GRCm38 2 91,054,016 - 91,059,438 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 91,054,009 - 91,066,369 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 90,894,173 - 90,899,595 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 90,854,921 - 90,860,267 (+) NCBI MGSCv36 mm8 Celera 2 92,438,480 - 92,443,912 (+) NCBI Celera Cytogenetic Map 2 E1 NCBI cM Map 2 50.44 NCBI
Psmc3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955422 837,573 - 845,341 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955422 837,934 - 843,161 (+) NCBI ChiLan1.0 ChiLan1.0
PSMC3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 49,621,734 - 49,629,444 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 49,641,522 - 49,649,232 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 47,366,986 - 47,374,677 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 47,920,295 - 47,927,654 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 47,920,295 - 47,927,654 (-) Ensembl panpan1.1 panPan2
PSMC3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 42,212,083 - 42,218,958 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 40,942,640 - 40,949,498 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 42,867,799 - 42,874,682 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 42,867,947 - 42,874,677 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 42,354,412 - 42,361,285 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 41,909,294 - 41,916,243 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 42,638,826 - 42,645,702 (+) NCBI UU_Cfam_GSD_1.0
Psmc3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 19,699,233 - 19,705,397 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936562 1,810,864 - 1,823,077 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936562 1,810,883 - 1,817,040 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PSMC3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 15,166,306 - 15,193,047 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 15,185,482 - 15,191,189 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 16,392,149 - 16,397,835 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PSMC3
Psmc3
.
Predicted Target Of
Count of predictions: 122 Count of miRNA genes: 98 Interacting mature miRNAs: 105 Transcripts: ENSRNOT00000015757 Prediction methods: Microtar, Rnahybrid, Targetscan Result types: miRGate_prediction
1300178 Hrtrt4 Heart rate QTL 4 3.74 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 43827364 90905114 Rat 61377 Edpm3 Estrogen-dependent pituitary mass QTL 3 7.05 0.038 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 53184692 89878207 Rat 2301414 Kidm37 Kidney mass QTL 37 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 70653097 121056321 Rat 1582238 Bw68 Body weight QTL 68 3.2 0.0064 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1331795 Rf30 Renal function QTL 30 3.708 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 3 39454637 89115240 Rat 1582239 Epfw1 Epididymal fat weight QTL 1 4.5 0.0006 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 115665732 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 1354589 Bw31 Body weight QTL 31 3.3 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 78196190 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1582218 Bw74 Body weight QTL 74 3.9 0.0021 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1331777 Bw24 Body weight QTL 24 3.503 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 89115240 Rat 1582221 Kidm30 Kidney mass QTL 30 3.5 0.0008 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 3 64655305 115665732 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1582210 Bw71 Body weight QTL 71 3.3 0.0012 body mass (VT:0001259) body weight (CMO:0000012) 3 64655305 115665732 Rat 1300111 Rf12 Renal function QTL 12 3.78 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 61017749 121056321 Rat 724523 Tsu1 Thymus enlargement suppressive QTL 1 3.84 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 3 50437504 115638231 Rat 1600376 Arunc5 Aerobic running capacity QTL 5 0.21 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 73376539 118376539 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 2292613 Ept16 Estrogen-induced pituitary tumorigenesis QTL 16 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 731180 Bp152 Blood pressure QTL 152 0.03 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 53781112 91609953 Rat 738019 Anxrr10 Anxiety related response QTL 10 3.9 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 3 38517803 83517803 Rat 631200 Cm25 Cardiac mass QTL 25 4.8 0.0001 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 3 61134348 89115068 Rat 61419 Cia11 Collagen induced arthritis QTL 11 5.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 3 30356773 98535386 Rat 12879848 Bw181 Body weght QTL 181 0.015 body mass (VT:0001259) body weight (CMO:0000012) 3 70348525 121056321 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 1354597 Kidm13 Kidney mass QTL 13 2.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 3 41874578 104104347 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 1354604 Bw36 Body weight QTL 36 2.9 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 104104347 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 1358186 Ept2 Estrogen-induced pituitary tumorigenesis QTL 2 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000015757 ⟹ ENSRNOP00000015757
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 77,031,825 - 77,037,206 (+) Ensembl Rnor_6.0 Ensembl 3 79,876,938 - 79,882,319 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103724 ⟹ ENSRNOP00000082627
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 77,031,825 - 77,043,358 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000104701 ⟹ ENSRNOP00000088016
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 77,031,825 - 77,037,206 (+) Ensembl
RefSeq Acc Id:
NM_031595 ⟹ NP_113783
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 97,487,643 - 97,493,024 (+) NCBI mRatBN7.2 3 77,031,825 - 77,037,206 (+) NCBI Rnor_6.0 3 79,876,938 - 79,882,319 (+) NCBI Rnor_5.0 3 86,585,691 - 86,591,072 (+) NCBI RGSC_v3.4 3 75,413,567 - 75,418,948 (+) RGD Celera 3 76,240,531 - 76,245,912 (+) RGD
Sequence:
CATTTCTCCCTCACAAACTGGAGCAACCGGCGAGCCCGGGGCGGGCCCTGTGGCCTCGGTTTGGTTCGTGGAGTCCCAGCGGCAGATTCGCTCGGCAACGCGGACAGGGCCAATTCTGTCGCGTCAGG
hide sequence
RefSeq Acc Id:
XM_039104795 ⟹ XP_038960723
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 97,489,599 - 97,493,025 (+) NCBI mRatBN7.2 3 77,033,781 - 77,037,207 (+) NCBI
RefSeq Acc Id:
NP_113783 ⟸ NM_031595
- UniProtKB:
Q63569 (UniProtKB/Swiss-Prot), P97638 (UniProtKB/Swiss-Prot), Q6P6U2 (UniProtKB/TrEMBL), A6HNA2 (UniProtKB/TrEMBL), F7EY30 (UniProtKB/TrEMBL)
- Sequence:
MQEMNLLPTPESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIVQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNNTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIK
hide sequence
Ensembl Acc Id:
ENSRNOP00000015757 ⟸ ENSRNOT00000015757
RefSeq Acc Id:
XP_038960723 ⟸ XM_039104795
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000088016 ⟸ ENSRNOT00000104701
Ensembl Acc Id:
ENSRNOP00000082627 ⟸ ENSRNOT00000103724
RGD ID: 13692204 Promoter ID: EPDNEW_R2729 Type: initiation region Name: Psmc3_1 Description: proteasome 26S subunit, ATPase 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 79,876,987 - 79,877,047 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-08-19
Psmc3
proteasome 26S subunit, ATPase 3
Psmc3
proteasome (prosome, macropain) 26S subunit, ATPase 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Psmc3
proteasome (prosome, macropain) 26S subunit, ATPase 3
Name updated
70584 APPROVED
