Symbol:
Map2k2
Name:
mitogen activated protein kinase kinase 2
RGD ID:
61888
Description:
Enables ATP binding activity and MAP kinase kinase activity. Involved in negative regulation of gene expression; peptidyl-tyrosine phosphorylation; and response to ischemia. Located in cell cortex. Biomarker of hepatocellular carcinoma. Human ortholog(s) of this gene implicated in cardiofaciocutaneous syndrome 4 and small intestine adenocarcinoma. Orthologous to human MAP2K2 (mitogen-activated protein kinase kinase 2); PARTICIPATES IN the extracellular signal-regulated Raf/Mek/Erk signaling pathway; adenosine signaling pathway; ceramide signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol 3-benzoate; 17beta-hydroxy-5alpha-androstan-3-one.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
dual specificity mitogen-activated protein kinase kinase 2; ERK activator kinase 2; MAP kinase kinase 2; MAPK/ERK kinase 2; MAPKK 2; MEK 2; MEK2; Prkmk2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MAP2K2 (mitogen-activated protein kinase kinase 2)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Map2k2 (mitogen-activated protein kinase kinase 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Map2k2 (mitogen-activated protein kinase kinase 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MAP2K2 (mitogen-activated protein kinase kinase 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MAP2K2 (mitogen-activated protein kinase kinase 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Map2k2 (mitogen-activated protein kinase kinase 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MAP2K2 (mitogen-activated protein kinase kinase 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MAP2K2 (mitogen-activated protein kinase kinase 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Map2k2 (mitogen-activated protein kinase kinase 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
MAP2K1 (mitogen-activated protein kinase kinase 1)
HGNC
OrthoDB
Alliance orthologs 3
Mus musculus (house mouse):
Map2k2 (mitogen-activated protein kinase kinase 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MAP2K2 (mitogen-activated protein kinase kinase 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
map2k2b (mitogen-activated protein kinase kinase 2b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
map2k2a (mitogen-activated protein kinase kinase 2a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Dsor1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
mek-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
STE7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 9,241,449 - 9,264,216 (-) NCBI GRCr8 GRCr8 Ensembl 7 9,241,310 - 9,260,940 (-) Ensembl GRCr8 Ensembl mRatBN7.2 7 8,590,729 - 8,610,279 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 8,580,905 - 8,610,243 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 11,475,464 - 11,494,812 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 13,350,953 - 13,370,301 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 11,217,425 - 11,236,805 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 11,458,971 - 11,478,520 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 11,458,967 - 11,478,489 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 11,626,294 - 11,645,884 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 10,074,654 - 10,094,003 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 6,778,257 - 6,797,606 (-) NCBI Celera RGSC_v3.1 7 10,074,657 - 10,094,003 (-) NCBI Cytogenetic Map 7 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Map2k2 Rat (+)-catechin multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 Catechin inhibits the reaction [[4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone co-treated with Benzo(a)pyrene] results in increased phosphorylation of MAP2K2 protein] CTD PMID:21882252 Map2k2 Rat (Z)-PUGNAc multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [N-acetylglucosaminono-1,5-lactone O-(phenylcarbamoyl)oxime co-treated with 2-(1H-indazol-4-yl)-6-(4-methanesulfonylpiperazin-1-ylmethyl)-4-morpholin-4-ylthieno(3,2-d)pyrimidine] results in decreased phosphorylation of MAP2K2 protein CTD PMID:23029544 Map2k2 Rat 1,2-dimethylhydrazine multiple interactions ISO Map2k2 (Mus musculus) 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MAP2K2 mRNA CTD PMID:22206623 Map2k2 Rat 1-(5-isoquinolinesulfonyl)-2-methylpiperazine multiple interactions ISO Map2k2 (Mus musculus) 6480464 [1-(5-Isoquinolinesulfonyl)-2-Methylpiperazine co-treated with TNF protein] results in decreased phosphorylation of MAP2K2 protein CTD PMID:14654170 Map2k2 Rat 1-(5-isoquinolinesulfonyl)-2-methylpiperazine decreases phosphorylation ISO Map2k2 (Mus musculus) 6480464 1-(5-Isoquinolinesulfonyl)-2-Methylpiperazine results in decreased phosphorylation of MAP2K2 protein CTD PMID:14654170 Map2k2 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO MAP2K2 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to MAP2K2 protein CTD PMID:32991956 Map2k2 Rat 17alpha-ethynylestradiol increases expression ISO Map2k2 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of MAP2K2 mRNA CTD PMID:16174780|PMID:17942748 Map2k2 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of MAP2K2 mRNA CTD PMID:16174780|PMID:17351261 Map2k2 Rat 17alpha-ethynylestradiol multiple interactions ISO Map2k2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MAP2K2 mRNA CTD PMID:17942748 Map2k2 Rat 17beta-estradiol multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 IGF1R mutant form inhibits the reaction [Estradiol results in increased expression of MAP2K2 mRNA] CTD PMID:23094148 Map2k2 Rat 17beta-estradiol increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 Estradiol results in increased phosphorylation of MAP2K2 protein CTD PMID:27026707 Map2k2 Rat 17beta-estradiol increases expression ISO MAP2K2 (Homo sapiens) 6480464 Estradiol results in increased expression of MAP2K2 mRNA CTD PMID:23094148 Map2k2 Rat 17beta-estradiol 3-benzoate decreases phosphorylation EXP 6480464 estradiol 3-benzoate results in decreased phosphorylation of MAP2K2 protein CTD PMID:15778002 Map2k2 Rat 17beta-hydroxy-5alpha-androstan-3-one multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Dihydrotestosterone results in increased phosphorylation of and results in increased activity more ... CTD PMID:15466214 Map2k2 Rat 17beta-hydroxy-5alpha-androstan-3-one multiple interactions EXP 6480464 1-hexadecyl-2-acetyl-glycero-3-phosphocholine inhibits the reaction [Dihydrotestosterone inhibits the reaction [Ovalbumin results in increased expression of MAP2K2 more ... CTD PMID:35982617 Map2k2 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO MAP2K2 (Homo sapiens) 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of MAP2K2 protein CTD PMID:31675489 Map2k2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Map2k2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MAP2K2 mRNA; MAP2K2 protein promotes more ... CTD PMID:17942748|PMID:20450880 Map2k2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MAP2K2 mRNA CTD PMID:33387578 Map2k2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MAP2K2 mRNA CTD PMID:32109520 Map2k2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Map2k2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MAP2K2 mRNA CTD PMID:21570461 Map2k2 Rat 2,4,6-tribromophenol decreases expression ISO MAP2K2 (Homo sapiens) 6480464 2,4,6-tribromophenol results in decreased expression of MAP2K2 mRNA CTD PMID:31675489 Map2k2 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of MAP2K2 mRNA CTD PMID:21346803 Map2k2 Rat 2,5-dimethylcelecoxib decreases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 2,5-dimethylcelecoxib results in decreased phosphorylation of MAP2K2 protein CTD PMID:16123214 Map2k2 Rat 2,5-dimethylcelecoxib multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 2,5-dimethylcelecoxib inhibits the reaction [IL6 protein results in increased phosphorylation of MAP2K2 protein] CTD PMID:16123214 Map2k2 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of MAP2K2 mRNA CTD PMID:21346803 Map2k2 Rat 2-arachidonoylglycerol multiple interactions EXP 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [glyceryl 2-arachidonate results in increased phosphorylation of and results in increased more ... CTD PMID:12657697 Map2k2 Rat 3',5'-cyclic GMP decreases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 Cyclic GMP results in decreased phosphorylation of MAP2K2 protein CTD PMID:18225537 Map2k2 Rat 3',5'-cyclic GMP multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 Cyclic GMP affects the reaction [NPPA protein alternative form results in decreased phosphorylation of and more ... CTD PMID:18225537 Map2k2 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Map2k2 (Mus musculus) 6480464 3,4,3',4'-tetrachlorobiphenyl inhibits the reaction [Dietary Fats results in increased expression of MAP2K2 mRNA] CTD PMID:19467301 Map2k2 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO MAP2K2 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of MAP2K2 protein CTD PMID:31675489 Map2k2 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Map2k2 (Mus musculus) 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of MAP2K2 mRNA CTD PMID:19285098 Map2k2 Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 bisindolylmaleimide I inhibits the reaction [lead acetate results in increased phosphorylation of and results in more ... CTD PMID:11861786 Map2k2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Map2k2 (Mus musculus) 6480464 [Colforsin co-treated with 1-Methyl-3-isobutylxanthine] results in increased phosphorylation of MAP2K2 protein; alisol B promotes the more ... CTD PMID:28051915 Map2k2 Rat 3-phenylprop-2-enal decreases expression ISO MAP2K2 (Homo sapiens) 6480464 cinnamaldehyde results in decreased expression of MAP2K2 mRNA CTD PMID:17178418 Map2k2 Rat 4,4'-sulfonyldiphenol increases expression ISO Map2k2 (Mus musculus) 6480464 bisphenol S results in increased expression of MAP2K2 mRNA CTD PMID:39298647 Map2k2 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Map2k2 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone co-treated with Benzo(a)pyrene] results in increased phosphorylation of MAP2K2 protein; Catechin inhibits the reaction more ... CTD PMID:21882252 Map2k2 Rat 5-(2-methylpiperazine-1-sulfonyl)isoquinoline multiple interactions ISO Map2k2 (Mus musculus) 6480464 [1-(5-Isoquinolinesulfonyl)-2-Methylpiperazine co-treated with TNF protein] results in decreased phosphorylation of MAP2K2 protein CTD PMID:14654170 Map2k2 Rat 5-(2-methylpiperazine-1-sulfonyl)isoquinoline decreases phosphorylation ISO Map2k2 (Mus musculus) 6480464 1-(5-Isoquinolinesulfonyl)-2-Methylpiperazine results in decreased phosphorylation of MAP2K2 protein CTD PMID:14654170 Map2k2 Rat 5-fluorouracil multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [U 0126 results in decreased activity of MAP2K2 protein] results in increased susceptibility to [Fluorouracil more ... CTD PMID:21444628 Map2k2 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of MAP2K2 mRNA CTD PMID:19483382 Map2k2 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of MAP2K2 mRNA CTD PMID:19483382 Map2k2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of MAP2K2 mRNA CTD PMID:30047161 Map2k2 Rat acetylsalicylic acid decreases expression ISO MAP2K2 (Homo sapiens) 6480464 Aspirin results in decreased expression of MAP2K2 mRNA CTD PMID:15928584 Map2k2 Rat acrolein multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased oxidation of MAP2K2 mRNA CTD PMID:32845096 Map2k2 Rat adenosine increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 Adenosine results in increased phosphorylation of MAP2K2 protein CTD PMID:34070360 Map2k2 Rat afimoxifene decreases response to substance ISO MAP2K2 (Homo sapiens) 6480464 MAP2K2 results in decreased susceptibility to afimoxifene CTD PMID:21233418 Map2k2 Rat aflatoxin B1 decreases methylation ISO MAP2K2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of MAP2K2 intron CTD PMID:30157460 Map2k2 Rat Alisol B multiple interactions ISO Map2k2 (Mus musculus) 6480464 alisol B promotes the reaction [[Colforsin co-treated with 1-Methyl-3-isobutylxanthine] results in increased phosphorylation of MAP2K2 more ... CTD PMID:28051915 Map2k2 Rat all-trans-retinoic acid increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 Tretinoin results in increased phosphorylation of MAP2K2 protein CTD PMID:19038232 Map2k2 Rat all-trans-retinoic acid multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [arsenic trioxide promotes the reaction [Tretinoin results in increased phosphorylation of more ... CTD PMID:20615082 Map2k2 Rat all-trans-retinol multiple interactions EXP 6480464 6-hydroxy-2,5,7,8-tetramethylchroman-2-carboxylic acid inhibits the reaction [Vitamin A results in increased phosphorylation of MAP2K2 protein]; AG more ... CTD PMID:16510265 Map2k2 Rat all-trans-retinol increases phosphorylation EXP 6480464 Vitamin A results in increased phosphorylation of MAP2K2 protein CTD PMID:16510265 Map2k2 Rat alpha-mangostin increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 mangostin analog results in increased phosphorylation of MAP2K2 protein CTD PMID:28722351 Map2k2 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of MAP2K2 mRNA CTD PMID:19483382 Map2k2 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of MAP2K2 mRNA CTD PMID:30047161 Map2k2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MAP2K2 mRNA CTD PMID:16483693 Map2k2 Rat ammonium chloride increases expression EXP 6480464 Ammonium Chloride results in increased expression of MAP2K2 mRNA; Ammonium Chloride results in increased expression more ... CTD PMID:12420312|PMID:16483693 Map2k2 Rat anandamide multiple interactions EXP 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [anandamide results in increased phosphorylation of and results in increased activity more ... CTD PMID:12657697 Map2k2 Rat Antrocin decreases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 antrocin analog results in decreased phosphorylation of MAP2K2 protein CTD PMID:36565974 Map2k2 Rat aristolochic acid A increases expression ISO MAP2K2 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of MAP2K2 mRNA CTD PMID:33212167 Map2k2 Rat arsenic acid increases activity ISO MAP2K2 (Homo sapiens) 6480464 arsenic acid results in increased activity of MAP2K2 protein CTD PMID:14674888 Map2k2 Rat arsenite(3-) increases activity ISO MAP2K2 (Homo sapiens) 6480464 arsenite results in increased activity of MAP2K2 protein CTD PMID:14674888 Map2k2 Rat arsenous acid multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Arsenic Trioxide promotes the reaction [Tretinoin results in increased phosphorylation of more ... CTD PMID:20615082|PMID:26598702 Map2k2 Rat arsenous acid decreases activity ISO MAP2K2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased activity of MAP2K2 protein CTD PMID:11304686 Map2k2 Rat arsenous acid increases expression ISO MAP2K2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of MAP2K2 protein CTD PMID:25419056 Map2k2 Rat atrazine affects expression EXP 6480464 Atrazine affects the expression of MAP2K2 mRNA CTD PMID:30580161 Map2k2 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of MAP2K2 mRNA CTD PMID:19483382 Map2k2 Rat benzo[a]pyrene multiple interactions ISO Map2k2 (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of MAP2K2 mRNA]; Benzo(a)pyrene promotes the more ... CTD PMID:19654925|PMID:22228805 Map2k2 Rat benzo[a]pyrene affects methylation ISO MAP2K2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MAP2K2 intron; Benzo(a)pyrene affects the methylation of MAP2K2 promoter CTD PMID:27901495|PMID:30157460 Map2k2 Rat benzo[a]pyrene multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone co-treated with Benzo(a)pyrene] results in increased phosphorylation of MAP2K2 protein; Catechin inhibits the reaction more ... CTD PMID:21882252 Map2k2 Rat benzo[a]pyrene increases expression ISO Map2k2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MAP2K2 mRNA CTD PMID:22228805 Map2k2 Rat beta-lapachone increases expression ISO MAP2K2 (Homo sapiens) 6480464 beta-lapachone results in increased expression of MAP2K2 mRNA CTD PMID:38218311 Map2k2 Rat bicalutamide multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [bicalutamide results in increased phosphorylation of and results in increased activity more ... CTD PMID:15466214 Map2k2 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 Zinc inhibits the reaction [Diethylhexyl Phthalate results in decreased phosphorylation of MAP2K2 protein] CTD PMID:35841924 Map2k2 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of MAP2K2 mRNA CTD PMID:35810816 Map2k2 Rat bis(2-ethylhexyl) phthalate decreases phosphorylation EXP 6480464 Diethylhexyl Phthalate results in decreased phosphorylation of MAP2K2 protein CTD PMID:35841924 Map2k2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MAP2K2 mRNA CTD PMID:25181051 Map2k2 Rat bisphenol A increases expression ISO MAP2K2 (Homo sapiens) 6480464 bisphenol A results in increased expression of MAP2K2 mRNA; bisphenol A results in increased expression more ... CTD PMID:36232920|PMID:37567409 Map2k2 Rat bisphenol A decreases expression ISO MAP2K2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of MAP2K2 protein CTD PMID:34186270 Map2k2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Map2k2 Rat bisphenol A multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of MAP2K2 gene CTD PMID:31601247 Map2k2 Rat bisphenol A increases expression ISO Map2k2 (Mus musculus) 6480464 bisphenol A results in increased expression of MAP2K2 mRNA CTD PMID:33221593 Map2k2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MAP2K2 mRNA CTD PMID:33296240 Map2k2 Rat bisphenol A affects expression ISO MAP2K2 (Homo sapiens) 6480464 bisphenol A affects the expression of MAP2K2 mRNA CTD PMID:30903817 Map2k2 Rat Bisphenol B increases expression ISO MAP2K2 (Homo sapiens) 6480464 bisphenol B results in increased expression of MAP2K2 protein CTD PMID:34186270 Map2k2 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Map2k2 Rat bortezomib decreases expression ISO MAP2K2 (Homo sapiens) 6480464 Bortezomib results in decreased expression of MAP2K2 mRNA CTD PMID:20977926 Map2k2 Rat cadmium acetate affects expression EXP 6480464 cadmium acetate affects the expression of MAP2K2 mRNA CTD PMID:16249259 Map2k2 Rat cadmium atom increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 Cadmium results in increased phosphorylation of MAP2K2 protein CTD PMID:14499349 Map2k2 Rat cadmium dichloride multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased phosphorylation of MAP2K2 protein] CTD PMID:18703135 Map2k2 Rat cadmium dichloride multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased phosphorylation of MAP2K2 protein] CTD PMID:18703135 Map2k2 Rat cadmium dichloride increases phosphorylation EXP 6480464 Cadmium Chloride results in increased phosphorylation of MAP2K2 protein CTD PMID:18703135 Map2k2 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of MAP2K2 promoter CTD PMID:22457795 Map2k2 Rat cadmium dichloride increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 Cadmium Chloride results in increased phosphorylation of MAP2K2 protein CTD PMID:18703135 Map2k2 Rat caffeine affects phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of MAP2K2 protein CTD PMID:35688186 Map2k2 Rat calciol increases expression ISO Map2k2 (Mus musculus) 6480464 Cholecalciferol results in increased expression of MAP2K2 mRNA CTD PMID:17170073 Map2k2 Rat calcium atom affects expression EXP 6480464 Calcium affects the expression of MAP2K2 mRNA CTD PMID:15913539 Map2k2 Rat calcium(0) affects expression EXP 6480464 Calcium affects the expression of MAP2K2 mRNA CTD PMID:15913539 Map2k2 Rat cannabidiol increases expression ISO MAP2K2 (Homo sapiens) 6480464 Cannabidiol results in increased expression of MAP2K2 mRNA CTD PMID:32992648 Map2k2 Rat cannabidiol multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of MAP2K2 mRNA; [Oxygen more ... CTD PMID:32992648 Map2k2 Rat carbon nanotube increases expression ISO Map2k2 (Mus musculus) 6480464 Nanotubes, Carbon analog results in increased expression of MAP2K2 mRNA CTD PMID:25554681 Map2k2 Rat celecoxib decreases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 Celecoxib results in decreased phosphorylation of MAP2K2 protein CTD PMID:16123214 Map2k2 Rat chenodeoxycholic acid multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650|PMID:33819548 Map2k2 Rat chlorpyrifos increases expression ISO Map2k2 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of MAP2K2 mRNA CTD PMID:37019170 Map2k2 Rat cisplatin multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [U 0126 results in decreased activity of MAP2K2 protein] results in increased susceptibility to [Fluorouracil more ... CTD PMID:21444628 Map2k2 Rat cisplatin decreases response to substance ISO MAP2K2 (Homo sapiens) 6480464 MAP2K2 results in decreased susceptibility to Cisplatin CTD PMID:21849418 Map2k2 Rat cisplatin increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 Cisplatin results in increased phosphorylation of MAP2K2 protein CTD PMID:21444628 Map2k2 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of MAP2K2 mRNA CTD PMID:19483382 Map2k2 Rat clozapine increases expression ISO Map2k2 (Mus musculus) 6480464 Clozapine results in increased expression of MAP2K2 mRNA CTD PMID:14647396 Map2k2 Rat clozapine decreases expression EXP 6480464 Clozapine results in decreased expression of MAP2K2 mRNA CTD PMID:15860345 Map2k2 Rat cobalt dichloride increases expression ISO MAP2K2 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of MAP2K2 mRNA CTD PMID:19376846 Map2k2 Rat cocaine multiple interactions ISO Map2k2 (Mus musculus) 6480464 CDK5R1 protein inhibits the reaction [Cocaine results in increased phosphorylation of MAP2K2 protein] CTD PMID:15665076 Map2k2 Rat cocaine increases phosphorylation ISO Map2k2 (Mus musculus) 6480464 Cocaine results in increased phosphorylation of MAP2K2 protein CTD PMID:15665076 Map2k2 Rat colforsin daropate hydrochloride multiple interactions ISO Map2k2 (Mus musculus) 6480464 [Colforsin co-treated with 1-Methyl-3-isobutylxanthine] results in increased phosphorylation of MAP2K2 protein; alisol B promotes the more ... CTD PMID:28051915 Map2k2 Rat copper atom multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which affects the expression of MAP2K2 mRNA CTD PMID:30911355 Map2k2 Rat copper(0) multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which affects the expression of MAP2K2 mRNA CTD PMID:30911355 Map2k2 Rat copper(II) sulfate multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 4-((3-bromophenyl)amino)-6,7-dimethoxyquinazoline inhibits the reaction [Copper Sulfate results in increased phosphorylation of MAP2K2 protein]; Copper Sulfate more ... CTD PMID:10564177 Map2k2 Rat cordycepin increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 cordycepin results in increased phosphorylation of MAP2K2 protein CTD PMID:34070360 Map2k2 Rat crocidolite asbestos increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 Asbestos, Crocidolite results in increased phosphorylation of MAP2K2 protein CTD PMID:18314537 Map2k2 Rat curcumin multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 MAP2K2 protein inhibits the reaction [Curcumin inhibits the reaction [Mitomycin results in increased expression of more ... CTD PMID:21810436 Map2k2 Rat cyclosporin A increases expression ISO MAP2K2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of MAP2K2 mRNA CTD PMID:32152650 Map2k2 Rat cyclosporin A multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650 Map2k2 Rat D-mannitol multiple interactions EXP 6480464 Mannitol inhibits the reaction [Vitamin A results in increased phosphorylation of MAP2K2 protein] CTD PMID:16510265 Map2k2 Rat dabrafenib decreases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 dabrafenib results in decreased phosphorylation of MAP2K2 protein CTD PMID:38641160 Map2k2 Rat dabrafenib multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 decabromobiphenyl ether inhibits the reaction [dabrafenib results in decreased phosphorylation of MAP2K2 protein] CTD PMID:38641160 Map2k2 Rat decabromodiphenyl ether multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 decabromobiphenyl ether inhibits the reaction [dabrafenib results in decreased phosphorylation of MAP2K2 protein] CTD PMID:38641160 Map2k2 Rat decabromodiphenyl ether decreases expression ISO MAP2K2 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of MAP2K2 protein CTD PMID:31675489 Map2k2 Rat decabromodiphenyl ether increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased phosphorylation of MAP2K2 protein CTD PMID:38641160 Map2k2 Rat deguelin decreases expression ISO MAP2K2 (Homo sapiens) 6480464 deguelin results in decreased expression of MAP2K2 protein CTD PMID:19336726 Map2k2 Rat deoxycholic acid multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650|PMID:33819548 Map2k2 Rat diarsenic trioxide multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Arsenic Trioxide promotes the reaction [Tretinoin results in increased phosphorylation of more ... CTD PMID:20615082|PMID:26598702 Map2k2 Rat diarsenic trioxide increases expression ISO MAP2K2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of MAP2K2 protein CTD PMID:25419056 Map2k2 Rat diarsenic trioxide decreases activity ISO MAP2K2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased activity of MAP2K2 protein CTD PMID:11304686 Map2k2 Rat dibutyl phthalate decreases expression ISO Map2k2 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of MAP2K2 mRNA; Dibutyl Phthalate results in decreased expression more ... CTD PMID:17361019|PMID:34864091 Map2k2 Rat dibutyl phthalate multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [Dibutyl Phthalate co-treated with Tetradecanoylphorbol Acetate] results in decreased expression of MAP2K2 protein CTD PMID:30218697 Map2k2 Rat dieldrin multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 Dieldrin results in increased phosphorylation of and results in increased activity of MAP2K2 protein CTD PMID:15888667 Map2k2 Rat dieldrin affects methylation ISO Map2k2 (Mus musculus) 6480464 Dieldrin affects the methylation of MAP2K2 gene CTD PMID:38995845 Map2k2 Rat dimethyl sulfoxide multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 cucurbitacin IIa inhibits the reaction [Dimethyl Sulfoxide results in increased expression of MAP2K2 mRNA] CTD PMID:31265865 Map2k2 Rat dimethyl sulfoxide increases expression ISO MAP2K2 (Homo sapiens) 6480464 Dimethyl Sulfoxide results in increased expression of MAP2K2 mRNA CTD PMID:31265865 Map2k2 Rat dioxygen multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of MAP2K2 mRNA; [Oxygen more ... CTD PMID:32992648 Map2k2 Rat disodium selenite increases expression ISO MAP2K2 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of MAP2K2 mRNA CTD PMID:18175754 Map2k2 Rat doxorubicin increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 Doxorubicin results in increased phosphorylation of MAP2K2 protein CTD PMID:17974986 Map2k2 Rat doxorubicin increases phosphorylation ISO Map2k2 (Mus musculus) 6480464 Doxorubicin results in increased phosphorylation of MAP2K2 protein CTD PMID:17974986 Map2k2 Rat elemental selenium increases expression ISO MAP2K2 (Homo sapiens) 6480464 Selenium results in increased expression of MAP2K2 mRNA CTD PMID:19244175 Map2k2 Rat emodin multiple interactions EXP 6480464 Emodin inhibits the reaction [PDGFB protein results in increased phosphorylation of MAP2K2 protein] CTD PMID:15288473 Map2k2 Rat endosulfan multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 Endosulfan results in increased phosphorylation of and results in increased activity of MAP2K2 protein CTD PMID:15888667 Map2k2 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of MAP2K2 mRNA CTD PMID:31464424 Map2k2 Rat epoxiconazole decreases expression ISO Map2k2 (Mus musculus) 6480464 epoxiconazole results in decreased expression of MAP2K2 mRNA CTD PMID:35436446 Map2k2 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of MAP2K2 mRNA CTD PMID:20655511 Map2k2 Rat fenthion decreases expression ISO Map2k2 (Mus musculus) 6480464 Fenthion results in decreased expression of MAP2K2 mRNA CTD PMID:34813904 Map2k2 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of MAP2K2 mRNA CTD PMID:24136188 Map2k2 Rat fipronil decreases activity ISO Map2k2 (Mus musculus) 6480464 fipronil results in decreased activity of MAP2K2 protein CTD PMID:21167920 Map2k2 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of MAP2K2 mRNA CTD PMID:34044035 Map2k2 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of MAP2K2 mRNA CTD PMID:24136188 Map2k2 Rat folic acid multiple interactions ISO Map2k2 (Mus musculus) 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MAP2K2 mRNA CTD PMID:22206623 Map2k2 Rat FR900359 decreases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of MAP2K2 protein CTD PMID:37730182 Map2k2 Rat fulvestrant multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of MAP2K2 gene CTD PMID:31601247 Map2k2 Rat gamma-hexachlorocyclohexane multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 Hexachlorocyclohexane results in increased phosphorylation of and results in increased activity of MAP2K2 protein CTD PMID:15888667 Map2k2 Rat geldanamycin decreases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 geldanamycin results in decreased phosphorylation of MAP2K2 protein CTD PMID:19167484 Map2k2 Rat genistein decreases phosphorylation EXP 6480464 Genistein results in decreased phosphorylation of MAP2K2 protein CTD PMID:15781664 Map2k2 Rat genistein increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 Genistein results in increased phosphorylation of MAP2K2 protein CTD PMID:19038232 Map2k2 Rat glycochenodeoxycholic acid multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650|PMID:33819548 Map2k2 Rat glycocholic acid multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650|PMID:33819548 Map2k2 Rat glycodeoxycholic acid multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650|PMID:33819548 Map2k2 Rat GSK-J4 increases expression ISO MAP2K2 (Homo sapiens) 6480464 GSK-J4 results in increased expression of MAP2K2 mRNA CTD PMID:29301935 Map2k2 Rat haloperidol decreases expression EXP 6480464 Haloperidol results in decreased expression of MAP2K2 mRNA CTD PMID:15860345 Map2k2 Rat haloperidol increases expression ISO Map2k2 (Mus musculus) 6480464 Haloperidol results in increased expression of MAP2K2 mRNA CTD PMID:14647396 Map2k2 Rat heparin multiple interactions EXP 6480464 Heparin inhibits the reaction [FGF1 protein results in increased phosphorylation of MAP2K2 protein]; Heparin inhibits more ... CTD PMID:14966081 Map2k2 Rat heptachlor multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 Heptachlor results in increased phosphorylation of and results in increased activity of MAP2K2 protein CTD PMID:15888667 Map2k2 Rat hyaluronic acid increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 Hyaluronic Acid analog results in increased phosphorylation of MAP2K2 protein CTD PMID:12402308 Map2k2 Rat hydrogen peroxide increases activity ISO MAP2K2 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased activity of MAP2K2 protein CTD PMID:19038233 Map2k2 Rat ionomycin multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of MAP2K2 mRNA; pyrrolidine dithiocarbamic acid more ... CTD PMID:15477007 Map2k2 Rat ivermectin decreases expression ISO MAP2K2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of MAP2K2 protein CTD PMID:32959892 Map2k2 Rat ketamine multiple interactions ISO Map2k2 (Mus musculus) 6480464 Ketamine inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity more ... CTD PMID:19540866 Map2k2 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of MAP2K2 mRNA CTD PMID:19483382 Map2k2 Rat lead diacetate multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 bisindolylmaleimide I inhibits the reaction [lead acetate results in increased phosphorylation of and results in more ... CTD PMID:11861786 Map2k2 Rat lead(0) increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 Lead results in increased phosphorylation of MAP2K2 protein CTD PMID:19133285 Map2k2 Rat letrozole increases expression ISO Map2k2 (Mus musculus) 6480464 letrozole results in increased expression of MAP2K2 protein CTD PMID:15967659 Map2k2 Rat lipopolysaccharide increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 Lipopolysaccharides results in increased phosphorylation of MAP2K2 protein CTD PMID:19010997 Map2k2 Rat lipopolysaccharide multiple interactions EXP 6480464 rosiglitazone inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of MAP2K2 protein] CTD PMID:21247645 Map2k2 Rat lipopolysaccharide increases phosphorylation EXP 6480464 Lipopolysaccharides results in increased phosphorylation of MAP2K2 protein CTD PMID:21247645 Map2k2 Rat lipopolysaccharide multiple interactions ISO Map2k2 (Mus musculus) 6480464 [Lipopolysaccharides co-treated with IFNG protein] results in increased phosphorylation of MAP2K2 protein; Ketamine inhibits the more ... CTD PMID:19540866|PMID:23362215 Map2k2 Rat lipoteichoic acid increases phosphorylation ISO Map2k2 (Mus musculus) 6480464 lipoteichoic acid results in increased phosphorylation of MAP2K2 protein CTD PMID:19573522 Map2k2 Rat lipoteichoic acid multiple interactions ISO Map2k2 (Mus musculus) 6480464 Propofol inhibits the reaction [lipoteichoic acid results in increased phosphorylation of MAP2K2 protein] CTD PMID:19573522 Map2k2 Rat lycopene decreases expression ISO MAP2K2 (Homo sapiens) 6480464 lycopene results in decreased expression of MAP2K2 protein CTD PMID:17337101 Map2k2 Rat mercury atom increases expression ISO MAP2K2 (Homo sapiens) 6480464 Mercury results in increased expression of MAP2K2 mRNA CTD PMID:16823088 Map2k2 Rat mercury(0) increases expression ISO MAP2K2 (Homo sapiens) 6480464 Mercury results in increased expression of MAP2K2 mRNA CTD PMID:16823088 Map2k2 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of MAP2K2 mRNA CTD PMID:30047161 Map2k2 Rat methotrexate affects response to substance ISO MAP2K2 (Homo sapiens) 6480464 MAP2K2 protein affects the susceptibility to Methotrexate CTD PMID:16217747 Map2k2 Rat mitomycin C multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 MAP2K2 protein inhibits the reaction [Curcumin inhibits the reaction [Mitomycin results in increased expression of more ... CTD PMID:21810436 Map2k2 Rat mono(2-ethylhexyl) phthalate decreases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased phosphorylation of MAP2K2 protein CTD PMID:35841924 Map2k2 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 Zinc inhibits the reaction [mono-(2-ethylhexyl)phthalate results in decreased phosphorylation of MAP2K2 protein] CTD PMID:35841924 Map2k2 Rat monosodium L-glutamate decreases expression EXP 6480464 Sodium Glutamate results in decreased expression of MAP2K2 mRNA CTD PMID:28954212 Map2k2 Rat N-acetyl-L-cysteine multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased phosphorylation of MAP2K2 protein] CTD PMID:18703135 Map2k2 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased phosphorylation of MAP2K2 protein] CTD PMID:18703135 Map2k2 Rat N-nitrosodiethylamine affects phosphorylation ISO Map2k2 (Mus musculus) 6480464 Diethylnitrosamine affects the phosphorylation of MAP2K2 protein CTD PMID:24535843 Map2k2 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of MAP2K2 mRNA CTD PMID:24136188 Map2k2 Rat ochratoxin A increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 ochratoxin A results in increased phosphorylation of MAP2K2 protein CTD PMID:25002221 Map2k2 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of MAP2K2 mRNA CTD PMID:19483382 Map2k2 Rat ozone multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased oxidation of MAP2K2 mRNA; [Air more ... CTD PMID:32845096|PMID:32992648|PMID:35430440 Map2k2 Rat paracetamol affects expression ISO Map2k2 (Mus musculus) 6480464 Acetaminophen affects the expression of MAP2K2 mRNA CTD PMID:17562736 Map2k2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of MAP2K2 mRNA CTD PMID:33387578 Map2k2 Rat paracetamol multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Map2k2 Rat PD 0325901 multiple interactions EXP 6480464 mirdametinib inhibits the reaction [polyphyllin I inhibits the reaction [Dietary Fats results in decreased expression more ... CTD PMID:36120828 Map2k2 Rat perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of MAP2K2 mRNA CTD PMID:20136073 Map2k2 Rat PhIP increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in increased phosphorylation of MAP2K2 protein CTD PMID:22307971 Map2k2 Rat phlorizin increases expression ISO Map2k2 (Mus musculus) 6480464 Phlorhizin results in increased expression of MAP2K2 mRNA CTD PMID:22538082 Map2k2 Rat phorbol 13-acetate 12-myristate multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [Dibutyl Phthalate co-treated with Tetradecanoylphorbol Acetate] results in decreased expression of MAP2K2 protein; [Tetradecanoylphorbol Acetate more ... CTD PMID:11861786|PMID:15477007|PMID:20479004|PMID:30218697 Map2k2 Rat phorbol 13-acetate 12-myristate increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased phosphorylation of MAP2K2 protein CTD PMID:20479004 Map2k2 Rat pirinixic acid multiple interactions ISO Map2k2 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Map2k2 Rat pirinixic acid increases expression ISO Map2k2 (Mus musculus) 6480464 pirinixic acid results in increased expression of MAP2K2 mRNA CTD PMID:23811191 Map2k2 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of MAP2K2 mRNA CTD PMID:19483382 Map2k2 Rat prednisone decreases expression ISO Map2k2 (Mus musculus) 6480464 Prednisone results in decreased expression of MAP2K2 mRNA CTD PMID:38439560 Map2k2 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of MAP2K2 mRNA CTD PMID:19162173 Map2k2 Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of MAP2K2 mRNA CTD PMID:30047161 Map2k2 Rat propofol multiple interactions ISO Map2k2 (Mus musculus) 6480464 Propofol inhibits the reaction [lipoteichoic acid results in increased phosphorylation of MAP2K2 protein] CTD PMID:19573522 Map2k2 Rat prostaglandin F2alpha increases phosphorylation ISO Map2k2 (Mus musculus) 6480464 Dinoprost results in increased phosphorylation of MAP2K2 protein CTD PMID:24333336 Map2k2 Rat prostaglandin F2alpha multiple interactions ISO Map2k2 (Mus musculus) 6480464 Resveratrol inhibits the reaction [Dinoprost results in increased phosphorylation of MAP2K2 protein]; SRT1720 inhibits the more ... CTD PMID:24333336 Map2k2 Rat pyocyanine increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 Pyocyanine results in increased phosphorylation of MAP2K2 protein CTD PMID:24015256 Map2k2 Rat pyrrolidine dithiocarbamate multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 pyrrolidine dithiocarbamic acid inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression more ... CTD PMID:15477007 Map2k2 Rat quercetin decreases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 Quercetin results in decreased phosphorylation of MAP2K2 protein CTD PMID:35688186 Map2k2 Rat resveratrol increases expression ISO Map2k2 (Mus musculus) 6480464 resveratrol results in increased expression of MAP2K2 protein CTD PMID:25505154 Map2k2 Rat resveratrol multiple interactions ISO Map2k2 (Mus musculus) 6480464 resveratrol inhibits the reaction [Dinoprost results in increased phosphorylation of MAP2K2 protein] CTD PMID:24333336 Map2k2 Rat sarin decreases expression ISO MAP2K2 (Homo sapiens) 6480464 Sarin results in decreased expression of MAP2K2 mRNA CTD PMID:19522546 Map2k2 Rat SB 431542 multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of MAP2K2 more ... CTD PMID:37664457 Map2k2 Rat SCH772984 increases phosphorylation EXP 6480464 SCH772984 results in increased phosphorylation of MAP2K2 protein CTD PMID:28087833 Map2k2 Rat selenium atom increases expression ISO MAP2K2 (Homo sapiens) 6480464 Selenium results in increased expression of MAP2K2 mRNA CTD PMID:19244175 Map2k2 Rat silver atom decreases expression ISO Map2k2 (Mus musculus) 6480464 Silver results in decreased expression of MAP2K2 mRNA CTD PMID:27131904 Map2k2 Rat silver(0) decreases expression ISO Map2k2 (Mus musculus) 6480464 Silver results in decreased expression of MAP2K2 mRNA CTD PMID:27131904 Map2k2 Rat sirolimus multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [7-hydroxystaurosporine co-treated with Sirolimus] results in decreased phosphorylation of MAP2K2 protein CTD PMID:15767555 Map2k2 Rat sodium arsenite multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 4-((3-bromophenyl)amino)-6,7-dimethoxyquinazoline inhibits the reaction [sodium arsenite results in increased phosphorylation of MAP2K2 protein]; MRAS mutant more ... CTD PMID:10564177|PMID:11943669 Map2k2 Rat sodium arsenite increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 sodium arsenite results in increased phosphorylation of MAP2K2 protein CTD PMID:11943669 Map2k2 Rat sodium arsenite increases expression ISO MAP2K2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of MAP2K2 mRNA CTD PMID:24431212 Map2k2 Rat sodium arsenite affects expression ISO MAP2K2 (Homo sapiens) 6480464 sodium arsenite affects the expression of MAP2K2 protein modified form CTD PMID:17384772 Map2k2 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of MAP2K2 mRNA CTD PMID:12325037 Map2k2 Rat sodium fluoride increases phosphorylation EXP 6480464 Sodium Fluoride results in increased phosphorylation of MAP2K2 protein CTD PMID:19900517 Map2k2 Rat sorafenib multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [sorafenib co-treated with PI103] inhibits the reaction [EGF protein results in increased phosphorylation of MAP2K2 more ... CTD PMID:21187475 Map2k2 Rat sorafenib decreases phosphorylation EXP 6480464 sorafenib results in decreased phosphorylation of MAP2K2 protein CTD PMID:17341847 Map2k2 Rat sorafenib decreases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 sorafenib results in decreased phosphorylation of MAP2K2 protein CTD PMID:17341847|PMID:18200035 Map2k2 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of MAP2K2 mRNA CTD PMID:30047161 Map2k2 Rat tartrazine multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Map2k2 Rat tetrahydropalmatine decreases expression ISO MAP2K2 (Homo sapiens) 6480464 tetrahydropalmatine results in decreased expression of MAP2K2 protein CTD PMID:20109541 Map2k2 Rat Theaflavin 3,3'-digallate decreases expression EXP 6480464 theaflavin-3,3'-digallate results in decreased expression of MAP2K2 mRNA; theaflavin-3,3'-digallate results in decreased expression of MAP2K2 more ... CTD PMID:32964953 Map2k2 Rat thimerosal decreases expression ISO MAP2K2 (Homo sapiens) 6480464 Thimerosal results in decreased expression of MAP2K2 mRNA CTD PMID:27188386 Map2k2 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of MAP2K2 mRNA CTD PMID:19483382 Map2k2 Rat titanium dioxide increases phosphorylation ISO Map2k2 (Mus musculus) 6480464 titanium dioxide analog results in increased phosphorylation of MAP2K2 protein CTD PMID:25111187 Map2k2 Rat titanium dioxide decreases methylation ISO Map2k2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MAP2K2 gene CTD PMID:35295148 Map2k2 Rat toluene affects expression EXP 6480464 Toluene affects the expression of MAP2K2 mRNA CTD PMID:21827849 Map2k2 Rat trichloroethene increases expression ISO Map2k2 (Mus musculus) 6480464 Trichloroethylene results in increased expression of MAP2K2 mRNA CTD PMID:19448997 Map2k2 Rat triphenyl phosphate affects expression ISO MAP2K2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MAP2K2 mRNA CTD PMID:37042841 Map2k2 Rat triptonide increases expression ISO Map2k2 (Mus musculus) 6480464 triptonide results in increased expression of MAP2K2 mRNA CTD PMID:33045310 Map2k2 Rat tyrphostin AG 1478 multiple interactions EXP 6480464 RTKI cpd inhibits the reaction [Oleylethanolamide results in increased phosphorylation of MAP2K2 protein] CTD PMID:16269455 Map2k2 Rat urethane increases expression ISO MAP2K2 (Homo sapiens) 6480464 Urethane results in increased expression of MAP2K2 mRNA CTD PMID:28818685 Map2k2 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of MAP2K2 mRNA CTD PMID:24136188 Map2k2 Rat valproic acid affects expression ISO Map2k2 (Mus musculus) 6480464 Valproic Acid affects the expression of MAP2K2 mRNA CTD PMID:17292431 Map2k2 Rat vanadyl sulfate multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 4-((3-bromophenyl)amino)-6,7-dimethoxyquinazoline inhibits the reaction [vanadyl sulfate results in increased phosphorylation of MAP2K2 protein]; MRAS mutant more ... CTD PMID:10564177|PMID:11943669 Map2k2 Rat vanadyl sulfate increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 vanadyl sulfate results in increased phosphorylation of MAP2K2 protein CTD PMID:11943669 Map2k2 Rat vanillin decreases expression ISO MAP2K2 (Homo sapiens) 6480464 vanillin results in decreased expression of MAP2K2 mRNA CTD PMID:17178418 Map2k2 Rat wogonin multiple interactions ISO Map2k2 (Mus musculus) 6480464 wogonin inhibits the reaction [[Lipopolysaccharides co-treated with IFNG protein] results in increased phosphorylation of MAP2K2 more ... CTD PMID:23362215 Map2k2 Rat zinc atom multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 Zinc inhibits the reaction [mono-(2-ethylhexyl)phthalate results in decreased phosphorylation of MAP2K2 protein] CTD PMID:35841924 Map2k2 Rat zinc atom multiple interactions EXP 6480464 Zinc inhibits the reaction [Diethylhexyl Phthalate results in decreased phosphorylation of MAP2K2 protein] CTD PMID:35841924 Map2k2 Rat zinc sulfate multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 4-((3-bromophenyl)amino)-6,7-dimethoxyquinazoline inhibits the reaction [Zinc Sulfate results in increased phosphorylation of MAP2K2 protein]; MRAS mutant more ... CTD PMID:10564177|PMID:11943669 Map2k2 Rat zinc sulfate increases phosphorylation ISO MAP2K2 (Homo sapiens) 6480464 Zinc Sulfate results in increased phosphorylation of MAP2K2 protein CTD PMID:11943669 Map2k2 Rat zinc(0) multiple interactions ISO MAP2K2 (Homo sapiens) 6480464 Zinc inhibits the reaction [mono-(2-ethylhexyl)phthalate results in decreased phosphorylation of MAP2K2 protein] CTD PMID:35841924 Map2k2 Rat zinc(0) multiple interactions EXP 6480464 Zinc inhibits the reaction [Diethylhexyl Phthalate results in decreased phosphorylation of MAP2K2 protein] CTD PMID:35841924
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Map2k2 Rat ATP binding enables IEA UniRule:UR001503341 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Map2k2 Rat ATP binding IDA 2298674 RGD Map2k2 Rat ATP binding enables IEA InterPro:IPR000719|InterPro:IPR017441 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Map2k2 Rat ATP binding enables IEA UniProtKB-KW:KW-0067 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Map2k2 Rat kinase activity enables IEA UniProtKB-KW:KW-0418 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Map2k2 Rat MAP kinase kinase activity enables ISO MAP2K2 (Homo sapiens) 1624291 PMID:8388392 RGD PMID:8388392 Map2k2 Rat MAP kinase kinase activity IDA 61657 RGD Map2k2 Rat MAP kinase kinase activity IDA 2298674 RGD Map2k2 Rat MAP kinase kinase activity enables IEA EC:2.7.12.2 1600115 GO_REF:0000003 UniProt GO_REF:0000003 Map2k2 Rat MAP kinase kinase activity enables ISO Map2k2 (Mus musculus) 1624291 PMID:8297798 RGD PMID:8297798 Map2k2 Rat MAP kinase kinase activity enables IBA CGD:CAL0000184846|FB:FBgn0010269|FB:FBgn0261524|MGI:1346345|MGI:1346866|MGI:1346867|MGI:1346868|MGI:1346870|MGI:1346871|PANTHER:PTN000684494|PomBase:SPAC1D4.13|PomBase:SPBC409.07c|PomBase:SPBC543.07|RGD:1560043|RGD:61888|RGD:620666|RGD:70495|SGD:S000002318|SGD:S000003664|TAIR:locus:2170578|UniProtKB:O14733|UniProtKB:P36507|UniProtKB:P46734|UniProtKB:P52564|UniProtKB:Q02750|UniProtKB:Q5BEU9|WB:WBGene00002177|WB:WBGene00003185|WB:WBGene00004758 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Map2k2 Rat MAP kinase kinase activity enables IEA UniProtKB:P36507|ensembl:ENSP00000262948 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Map2k2 Rat MAP kinase kinase activity enables IEA UniProtKB:Q63932|ensembl:ENSMUSP00000121111 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Map2k2 Rat MAP kinase kinase activity enables IEA ARBA:ARBA00043555 1600115 GO_REF:0000117 UniProt GO_REF:0000117 Map2k2 Rat MAP-kinase scaffold activity enables IEA UniProtKB:P36507|ensembl:ENSP00000262948 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Map2k2 Rat MAP-kinase scaffold activity enables ISO MAP2K2 (Homo sapiens) 1624291 PMID:29433126 RGD PMID:29433126 Map2k2 Rat metal ion binding enables IEA UniProtKB-KW:KW-0479 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Map2k2 Rat molecular adaptor activity enables IEA UniProtKB:Q63932|ensembl:ENSMUSP00000121111 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Map2k2 Rat molecular adaptor activity enables ISO Map2k2 (Mus musculus) 1624291 PMID:20179103 RGD PMID:20179103 Map2k2 Rat nucleotide binding enables IEA UniRule:UR001503341 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Map2k2 Rat nucleotide binding enables IEA UniProtKB-KW:KW-0547 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Map2k2 Rat PDZ domain binding enables IEA UniProtKB:P36507|ensembl:ENSP00000262948 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Map2k2 Rat PDZ domain binding enables ISO MAP2K2 (Homo sapiens) 1624291 PMID:21615688 RGD PMID:21615688 Map2k2 Rat protein binding enables ISO Map2k2 (Mus musculus) 1624291 UniProtKB:P85298-4|UniProtKB:Q13526|UniProtKB:Q8CGE9 PMID:17380122, PMID:20179103 RGD PMID:17380122|PMID:20179103 Map2k2 Rat protein binding IPI Ksr1 (Rattus norvegicus) 2298675 RGD Map2k2 Rat protein binding enables ISO MAP2K2 (Homo sapiens) 1624291 UniProtKB:O95273|UniProtKB:P00540|UniProtKB:P04049|UniProtKB:P05067|UniProtKB:P10398|UniProtKB:P15056|UniProtKB:P61978-2|UniProtKB:Q12959|UniProtKB:Q8IVT5|UniProtKB:Q96II5 PMID:11909642, PMID:17979178, PMID:21615688, PMID:21988832, PMID:24746704, PMID:25416956, PMID:25600339, PMID:25852190, PMID:27086506, PMID:28514442, PMID:29433126, PMID:31980649, PMID:32296183, more ... RGD PMID:11909642|PMID:17979178|PMID:21615688|PMID:21988832|PMID:24746704|PMID:25416956|PMID:25600339|PMID:25852190|PMID:27086506|PMID:28514442|PMID:29433126|PMID:31980649|PMID:32296183|PMID:32707033|PMID:32814053|PMID:33961781|PMID:35271311|PMID:35512704 Map2k2 Rat protein binding enables ISO MAP2K2 (Sus scrofa) 1624291 UniProtKB:Q5U8X5 PMID:27605672 RGD PMID:27605672 Map2k2 Rat protein kinase activity enables IEA InterPro:IPR000719|InterPro:IPR008271 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Map2k2 Rat protein serine kinase activity enables IEA RHEA:17989 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Map2k2 Rat protein serine/threonine kinase activator activity enables ISO MAP2K2 (Homo sapiens) 1624291 PMID:8388392 RGD PMID:8388392 Map2k2 Rat protein serine/threonine kinase activator activity enables IEA UniProtKB:P36507|ensembl:ENSP00000262948 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Map2k2 Rat protein serine/threonine kinase activity enables IEA UniProtKB-KW:KW-0723 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Map2k2 Rat protein serine/threonine/tyrosine kinase activity enables TAS 8553538 PMID:19565474 UniProt Map2k2 Rat protein tyrosine kinase activity enables IEA UniProtKB-KW:KW-0829 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Map2k2 Rat protein tyrosine kinase activity enables IEA RHEA:10596 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Map2k2 Rat scaffold protein binding enables IEA UniProtKB:P36507|ensembl:ENSP00000262948 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Map2k2 Rat scaffold protein binding enables ISO MAP2K2 (Homo sapiens) 1624291 UniProtKB:Q12959|UniProtKB:Q61097 PMID:10409742, PMID:21615688 RGD PMID:10409742|PMID:21615688 Map2k2 Rat transferase activity enables IEA UniProtKB-KW:KW-0808 1600115 GO_REF:0000043 UniProt GO_REF:0000043
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-catechin (ISO) (Z)-PUGNAc (ISO) 1,2-dimethylhydrazine (ISO) 1-(5-isoquinolinesulfonyl)-2-methylpiperazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 17beta-estradiol 3-benzoate (EXP) 17beta-hydroxy-5alpha-androstan-3-one (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4,6-trinitrotoluene (EXP) 2,5-dimethylcelecoxib (ISO) 2,6-dinitrotoluene (EXP) 2-arachidonoylglycerol (EXP) 3',5'-cyclic GMP (ISO) 3,3',4,4'-tetrachlorobiphenyl (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-phenylprop-2-enal (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (ISO) 5-(2-methylpiperazine-1-sulfonyl)isoquinoline (ISO) 5-fluorouracil (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acetylsalicylic acid (ISO) acrolein (ISO) adenosine (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) Alisol B (ISO) all-trans-retinoic acid (ISO) all-trans-retinol (EXP) alpha-mangostin (ISO) amiodarone (EXP) amitrole (EXP) ammonium chloride (EXP) anandamide (EXP) Antrocin (ISO) aristolochic acid A (ISO) arsenic acid (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (EXP) benzbromarone (EXP) benzo[a]pyrene (ISO) beta-lapachone (ISO) bicalutamide (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (EXP) bortezomib (ISO) cadmium acetate (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) calciol (ISO) calcium atom (EXP) calcium(0) (EXP) cannabidiol (ISO) carbon nanotube (ISO) celecoxib (ISO) chenodeoxycholic acid (ISO) chlorpyrifos (ISO) cisplatin (ISO) clofibrate (EXP) clozapine (EXP,ISO) cobalt dichloride (ISO) cocaine (ISO) colforsin daropate hydrochloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) cordycepin (ISO) crocidolite asbestos (ISO) curcumin (ISO) cyclosporin A (ISO) D-mannitol (EXP) dabrafenib (ISO) decabromodiphenyl ether (ISO) deguelin (ISO) deoxycholic acid (ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) dieldrin (ISO) dimethyl sulfoxide (ISO) dioxygen (ISO) disodium selenite (ISO) doxorubicin (ISO) elemental selenium (ISO) emodin (EXP) endosulfan (EXP,ISO) epoxiconazole (ISO) ethanol (EXP) fenthion (ISO) finasteride (EXP) fipronil (EXP,ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) gamma-hexachlorocyclohexane (ISO) geldanamycin (ISO) genistein (EXP,ISO) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) GSK-J4 (ISO) haloperidol (EXP,ISO) heparin (EXP) heptachlor (ISO) hyaluronic acid (ISO) hydrogen peroxide (ISO) ionomycin (ISO) ivermectin (ISO) ketamine (ISO) L-ethionine (EXP) lead diacetate (ISO) lead(0) (ISO) letrozole (ISO) lipopolysaccharide (EXP,ISO) lipoteichoic acid (ISO) lycopene (ISO) mercury atom (ISO) mercury(0) (ISO) methimazole (EXP) methotrexate (ISO) mitomycin C (ISO) mono(2-ethylhexyl) phthalate (ISO) monosodium L-glutamate (EXP) N-acetyl-L-cysteine (EXP,ISO) N-nitrosodiethylamine (ISO) nefazodone (EXP) ochratoxin A (ISO) omeprazole (EXP) ozone (ISO) paracetamol (EXP,ISO) PD 0325901 (EXP) perfluorooctane-1-sulfonic acid (EXP) PhIP (ISO) phlorizin (ISO) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (EXP,ISO) prednisone (ISO) pregnenolone 16alpha-carbonitrile (EXP) propiconazole (EXP) propofol (ISO) prostaglandin F2alpha (ISO) pyocyanine (ISO) pyrrolidine dithiocarbamate (ISO) quercetin (ISO) resveratrol (ISO) sarin (ISO) SB 431542 (ISO) SCH772984 (EXP) selenium atom (ISO) silver atom (ISO) silver(0) (ISO) sirolimus (ISO) sodium arsenite (ISO) sodium dichromate (EXP) sodium fluoride (EXP) sorafenib (EXP,ISO) sulfadimethoxine (EXP) tartrazine (ISO) tetrahydropalmatine (ISO) Theaflavin 3,3'-digallate (EXP) thimerosal (ISO) thioacetamide (EXP) titanium dioxide (ISO) toluene (EXP) trichloroethene (ISO) triphenyl phosphate (ISO) triptonide (ISO) tyrphostin AG 1478 (EXP) urethane (ISO) valdecoxib (EXP) valproic acid (ISO) vanadyl sulfate (ISO) vanillin (ISO) wogonin (ISO) zinc atom (EXP,ISO) zinc sulfate (ISO) zinc(0) (EXP,ISO)
Biological Process
epithelial cell proliferation involved in lung morphogenesis (IEA,ISO) ERBB2-ERBB3 signaling pathway (IEA,ISO) ERK1 and ERK2 cascade (IEA,ISO) face development (IEA,ISO) heart development (IEA,ISO) insulin-like growth factor receptor signaling pathway (IEA,ISO) lung morphogenesis (IEA,ISO) MAPK cascade (IBA,IEA,ISO) myelination (IEA,ISO) negative regulation of gene expression (IEA,IGI) peptidyl-serine autophosphorylation (ISO) peptidyl-tyrosine phosphorylation (IDA) positive regulation of axonogenesis (IEA,ISO) positive regulation of cell motility (IEA,ISO) positive regulation of DNA-templated transcription (IEA,ISO) positive regulation of gene expression (IEA,ISO) positive regulation of protein serine/threonine kinase activity (ISO) protein phosphorylation (IDA,ISO) regulation of axon regeneration (IEA,ISO) regulation of early endosome to late endosome transport (IEA,TAS) regulation of Golgi inheritance (IEA,TAS) regulation of stress-activated MAPK cascade (IEA,TAS) response to ischemia (IDA) Schwann cell development (IEA,ISO) thymus development (IEA,ISO) thyroid gland development (IEA,ISO) trachea formation (IEA,ISO)
Cellular Component
cell cortex (IDA,IEA) cell-cell junction (IEA,ISO) cytoplasm (IEA,ISO) cytoplasmic side of plasma membrane (IEA,ISO) cytosol (IEA,ISO,TAS) early endosome (IEA,TAS) endoplasmic reticulum (IEA,ISO) focal adhesion (IEA,TAS) Golgi apparatus (IEA,ISO,TAS) late endosome (IEA,TAS) membrane (IEA) microtubule (IEA,ISO) mitochondrion (IEA,TAS) nucleus (TAS) perinuclear region of cytoplasm (IEA,ISO)
Molecular Function
ATP binding (IDA,IEA) kinase activity (IEA) MAP kinase kinase activity (IBA,IDA,IEA,ISO) MAP-kinase scaffold activity (IEA,ISO) metal ion binding (IEA) molecular adaptor activity (IEA,ISO) nucleotide binding (IEA) PDZ domain binding (IEA,ISO) protein binding (IPI,ISO) protein kinase activity (IEA) protein serine kinase activity (IEA) protein serine/threonine kinase activator activity (IEA,ISO) protein serine/threonine kinase activity (IEA) protein serine/threonine/tyrosine kinase activity (TAS) protein tyrosine kinase activity (IEA) scaffold protein binding (IEA,ISO) transferase activity (IEA)
1.
c-Raf, but not B-Raf, is essential for development of K-Ras oncogene-driven non-small cell lung carcinoma.
Blasco RB, etal., Cancer Cell. 2011 May 17;19(5):652-63. doi: 10.1016/j.ccr.2011.04.002. Epub 2011 Apr 21.
2.
MiR-339 inhibits proliferation of pulmonary artery smooth muscle cell by targeting FGF signaling.
Chen J, etal., Physiol Rep. 2017 Sep;5(18). pii: 5/18/e13441. doi: 10.14814/phy2.13441.
3.
Activation of MAP kinase kinase (MEK) and Ras by cholecystokinin in rat pancreatic acini.
Duan RD, etal., Am J Physiol. 1995 Jun;268(6 Pt 1):G1060-5.
4.
Mutation analysis of BRAF, MEK1 and MEK2 in 15 ovarian cancer cell lines: implications for therapy.
Estep AL, etal., PLoS ONE. 2007 Dec 5;2(12):e1279.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
MEK2 is a prognostic marker and potential chemo-sensitizing target for glioma patients undergoing temozolomide treatment.
He H, etal., Cell Mol Immunol. 2016 Sep;13(5):658-68. doi: 10.1038/cmi.2015.46. Epub 2015 Jul 20.
7.
Altered expression of mitogen-activated protein kinases in a rat model of experimental hepatocellular carcinoma.
McKillop IH, etal., Hepatology. 1997 Dec;26(6):1484-91. doi: 10.1002/hep.510260615.
8.
Mitogen-activated protein kinase translocates to the nucleus during ischaemia and is activated during reperfusion.
Mizukami Y and Yoshida Ki, Biochem J. 1997 May 1;323 ( Pt 3)(Pt 3):785-90. doi: 10.1042/bj3230785.
9.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
11.
Isolation of two members of the rat MAP kinase kinase gene family.
Otsu M, etal., FEBS Lett 1993 Apr 12;320(3):246-50.
12.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
13.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
14.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
15.
Molecular and functional analysis of a novel MEK2 mutation in cardio-facio-cutaneous syndrome: transmission through four generations.
Rauen KA, etal.
16.
GOA pipeline
RGD automated data pipeline
17.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
18.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
19.
Investigation of the Mek-MAP kinase-Rsk pathway in human breast cancer.
Salh B, etal., Anticancer Res. 1999 Jan-Feb;19(1B):731-40.
20.
Growth factor-induced MAPK network topology shapes Erk response determining PC-12 cell fate.
Santos SD, etal., Nat Cell Biol. 2007 Mar;9(3):324-30. Epub 2007 Feb 18.
21.
Evidence for elevated (LIMK2 and CFL1) and suppressed (ICAM1, EZR, MAP2K2, and NOS3) gene expressions in metabolic syndrome.
Tabur S, etal., Endocrine. 2016 Aug;53(2):465-70. doi: 10.1007/s12020-016-0910-0. Epub 2016 Mar 8.
22.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
23.
Activation of MEK1 or MEK2 isoform is sufficient to fully transform intestinal epithelial cells and induce the formation of metastatic tumors.
Voisin L, etal., BMC Cancer. 2008 Nov 17;8:337. doi: 10.1186/1471-2407-8-337.
24.
Renaturation and partial peptide sequencing of mitogen-activated protein kinase (MAP kinase) activator from rabbit skeletal muscle.
Wu J, etal., Biochem J 1992 Aug 1;285 ( Pt 3):701-5.
25.
Identification and characterization of a new mammalian mitogen-activated protein kinase kinase, MKK2.
Wu J, etal., Mol Cell Biol 1993 Aug;13(8):4539-48.
26.
Molecular structure of a protein-tyrosine/threonine kinase activating p42 mitogen-activated protein (MAP) kinase: MAP kinase kinase.
Wu J, etal., Proc Natl Acad Sci U S A 1993 Jan 1;90(1):173-7.
27.
Insulin enhances growth hormone induction of the MEK/ERK signaling pathway.
Xu J, etal., J Biol Chem. 2006 Jan 13;281(2):982-92. Epub 2005 Nov 4.
28.
The ERK signaling cascade--views from different subcellular compartments.
Yao Z and Seger R, Biofactors. 2009 Sep-Oct;35(5):407-16. doi: 10.1002/biof.52.
29.
Development and External Validation of a Novel Immune Checkpoint-Related Gene Signature for Prediction of Overall Survival in Hepatocellular Carcinoma.
Zhao E, etal., Front Mol Biosci. 2021 Jan 21;7:620765. doi: 10.3389/fmolb.2020.620765. eCollection 2020.
Map2k2 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 9,241,449 - 9,264,216 (-) NCBI GRCr8 GRCr8 Ensembl 7 9,241,310 - 9,260,940 (-) Ensembl GRCr8 Ensembl mRatBN7.2 7 8,590,729 - 8,610,279 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 8,580,905 - 8,610,243 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 11,475,464 - 11,494,812 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 13,350,953 - 13,370,301 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 11,217,425 - 11,236,805 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 11,458,971 - 11,478,520 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 11,458,967 - 11,478,489 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 11,626,294 - 11,645,884 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 10,074,654 - 10,094,003 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 6,778,257 - 6,797,606 (-) NCBI Celera RGSC_v3.1 7 10,074,657 - 10,094,003 (-) NCBI Cytogenetic Map 7 q11 NCBI
MAP2K2 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 4,090,321 - 4,124,122 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 4,090,321 - 4,124,122 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 4,090,319 - 4,124,119 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 4,041,319 - 4,075,126 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 4,041,321 - 4,075,126 NCBI Celera 19 4,029,762 - 4,063,598 (-) NCBI Celera Cytogenetic Map 19 p13.3 NCBI HuRef 19 3,854,052 - 3,888,086 (-) NCBI HuRef CHM1_1 19 4,089,923 - 4,123,692 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 4,073,480 - 4,107,423 (-) NCBI T2T-CHM13v2.0
Map2k2 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 80,941,749 - 80,960,531 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 80,941,749 - 80,969,809 (+) Ensembl GRCm39 Ensembl GRCm38 10 81,105,913 - 81,124,697 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 81,105,915 - 81,133,975 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 80,568,692 - 80,587,442 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 80,509,092 - 80,527,465 (+) NCBI MGSCv36 mm8 Celera 10 82,126,303 - 82,145,053 (+) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 39.72 NCBI
Map2k2 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955495 4,695,768 - 4,722,098 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955495 4,695,239 - 4,718,380 (+) NCBI ChiLan1.0 ChiLan1.0
MAP2K2 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 8,488,392 - 8,523,027 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 7,718,541 - 7,752,382 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 3,114,445 - 3,148,619 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 4,064,626 - 4,097,933 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 4,064,626 - 4,097,933 (-) Ensembl panpan1.1 panPan2
MAP2K2 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 55,465,460 - 55,487,629 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 55,465,212 - 55,487,641 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 55,191,875 - 55,213,954 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 56,128,646 - 56,148,204 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 20 55,182,690 - 55,204,761 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 55,664,143 - 55,686,194 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 55,862,931 - 55,885,022 (+) NCBI UU_Cfam_GSD_1.0
Map2k2 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 215,457,693 - 215,496,652 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936588 2,336,858 - 2,377,090 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936588 2,338,127 - 2,377,090 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MAP2K2 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 74,626,783 - 74,651,348 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 74,626,739 - 74,651,352 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 75,170,854 - 75,195,463 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MAP2K2 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 3,848,441 - 3,881,367 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 3,848,401 - 3,881,412 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666081 4,347,082 - 4,394,579 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Map2k2 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 92 Count of miRNA genes: 84 Interacting mature miRNAs: 88 Transcripts: ENSRNOT00000027272 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1300176 Hrtrt10 Heart rate QTL 10 3.19 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 664270 26029351 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 2298550 Neuinf6 Neuroinflammation QTL 6 3.3 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 7 1 27829089 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat
RH143912
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 8,590,487 - 8,590,707 (+) MAPPER mRatBN7.2 Rnor_6.0 7 11,458,732 - 11,458,951 NCBI Rnor6.0 Rnor_5.0 7 11,626,096 - 11,626,315 UniSTS Rnor5.0 RGSC_v3.4 7 10,074,404 - 10,074,623 UniSTS RGSC3.4 Celera 7 6,778,007 - 6,778,226 UniSTS RH 3.4 Map 7 16.4 UniSTS Cytogenetic Map 7 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000027272 ⟹ ENSRNOP00000027272
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 Ensembl 7 9,241,453 - 9,260,940 (-) Ensembl mRatBN7.2 Ensembl 7 8,580,905 - 8,610,243 (-) Ensembl Rnor_6.0 Ensembl 7 11,458,967 - 11,478,489 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096038 ⟹ ENSRNOP00000085974
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 Ensembl 7 9,241,310 - 9,260,940 (-) Ensembl mRatBN7.2 Ensembl 7 8,590,856 - 8,610,231 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000102006 ⟹ ENSRNOP00000092750
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 Ensembl 7 9,242,981 - 9,260,940 (-) Ensembl mRatBN7.2 Ensembl 7 8,590,740 - 8,610,206 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000102029 ⟹ ENSRNOP00000080213
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 8,591,413 - 8,610,243 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000107951 ⟹ ENSRNOP00000092716
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 8,590,599 - 8,607,875 (-) Ensembl
RefSeq Acc Id:
NM_133283 ⟹ NP_579817
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,241,449 - 9,260,798 (-) NCBI mRatBN7.2 7 8,590,738 - 8,610,090 (-) NCBI Rnor_6.0 7 11,458,982 - 11,478,331 (-) NCBI Rnor_5.0 7 11,626,294 - 11,645,884 (-) NCBI RGSC_v3.4 7 10,074,654 - 10,094,003 (-) RGD Celera 7 6,778,257 - 6,797,606 (-) RGD
Sequence:
GGGGGTGCCGCGCCGGCCGCAGAGCCCTGATGCTGGCCCGGAGGAAGCCGGTGTTACCGGCACTCACCATCAACCCTACCATCGCTGAGGGCCCGTCCCCCACCAGCGAGGGCGCCTCCGAGGCACAC CTGGTGGACCTCCAGAAGAAGTTGGAAGAGCTGGACCTGGATGAACAGCAGAGGAAGCGGCTGGAGGCCTTCCTTACCCAGAAGGCCAAGGTTGGTGAGCTCAAGGACGACGACTTTGAGAGAATCTC AGAACTGGGTGCAGGCAATGGCGGCGTGGTCACAAAGGCCCGGCATAGGCCCTCTGGCCTCATCATGGCCAGAAAGCTGATCCACCTGGAGATCAAGCCAGCTGTCCGCAACCAGATCATCCGGGAGC TGCAGGTGCTGCATGAGTGCAACTCACCGTACATCGTGGGCTTTTATGGGGCCTTCTACAGCGACGGCGAGATCAGCATCTGCATGGAGCACATGGACGGTGGCTCACTGGACCAGGTACTGAAGGAG GCCAAGCGCATTCCCGAGGACATCTTAGGGAAGGTCAGCATTGCGGTGCTCCGGGGCCTGGCGTACCTCCGCGAGAAGCACCAGATCATGCATAGAGATGTGAAGCCCTCCAACATTCTGGTGAACTC TCGTGGAGAGATTAAGCTGTGCGACTTCGGAGTGAGCGGCCAGTTGATTGACTCCATGGCCAACTCATTTGTAGGGACACGCTCCTACATGTCCCCAGAACGGCTGCAGGGCACCCACTACTCTGTGC AGTCGGACATCTGGAGCATGGGGCTGTCGCTGGTGGAGCTGGCCATCGGGAGGTACCCCATCCCCCCACCTGATGCCAAGGAACTAGAGGCCAGCTTTGGCCGGCCTGTGGTGGACGGGGCAGATGGA GAGCCCCATAGTGTCTCACCGCGGCCCCGGCCCCCTGGACGCCCCATCAGTGGTCATGGGATGGACAGCCGACCAGCCATGGCCATCTTTGAGCTGCTGGACTACATAGTGAATGAGCCACCTCCCAA GCTGCCCAGTGGTGTGTTCAGCTCAGACTTCCAGGAGTTTGTGAATAAATGTCTCATTAAGAACCCAGCAGAGCGTGCAGACCTCAAGCTGCTGACGAACCATGCCTTCATCAAACGCTCTGAGGGGG AGGACGTGGACTTCGCTGGCTGGCTATGCAGAACCCTGCGGCTGAAGCAGCCCAGCACACCCACGCGTACTGCAGTGTGACAGCCATCGCTCAGCAGTCTGTGTCCTTGTCCTGTGGCACAGCGGCCG CCTTTGGGGACAGCAGTGGTGTGTGTTGTGGCAGGGGACCTGTGCCTGTGCATTTGGAAAAGCAAACAAAGTGGAGAAAGAGAGAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_006240987 ⟹ XP_006241049
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,241,449 - 9,264,216 (-) NCBI mRatBN7.2 7 8,590,733 - 8,610,269 (-) NCBI Rnor_6.0 7 11,458,971 - 11,478,520 (-) NCBI Rnor_5.0 7 11,626,294 - 11,645,884 (-) NCBI
Sequence:
GCGAGAGCCCGGCCTGCGATCTTGTGGCCGCCCCCTGTTCCCGACCTCCGGACTGCGCTGCAGCGTCAGCTTCACTCTGTCTCGGTCTTCTCTCGCCGGCGCTCCCGGCTTTGCCGCCTTCCACCTTC TGCCCGGCCTAGGCCGCAGCCCCGGGCCCGGTTCGCGCTGCCCCCTATGGGCCCCGGCTGAGGTGCCGCCGCCGGCCGCAGAGCCCTGATGCTGGCCCGGAGGAAGCCGGTGTTACCGGCGCTCACCA TCAACCCTACCATCGCTGAGGGCCCGTCCCCCACCAGCGAGGGCGCCTCCGAGGCACACCTGGTGGACCTCCAGAAGAAGTTGGAAGAGCTGGACCTGGATGAACAGCAGAGGAAGCGGCTGGAGGCC TTCCTTACCCAGAAGGCCAAGGTTGGTGAGCTCAAGGACGACGACTTTGAGAGAATCTCAGAACTGGGTGCAGGCAATGGCGGCGTGGTCACAAAGGCCCGGCATAGGCCCTCTGGCCTCATCATGGC CAGAAAGCTGATCCACCTGGAGATCAAGCCAGCTGTCCGCAACCAGATCATCCGGGAGCTGCAGGTGCTGCATGAGTGCAACTCACCGTACATCGTGGGCTTTTATGGGGCCTTCTACAGCGACGGCG AGATCAGCATCTGCATGGAGCACATGGACGGTGGCTCACTGGACCAGGTACTGAAGGAGGCCAAGCGCATTCCCGAGGACATCTTAGGGAAGGTCAGCATTGCGGTGCTCCGGGGCCTGGCGTACCTC CGCGAGAAGCACCAGATCATGCATAGAGATGTGAAGCCCTCCAACATTCTGGTGAACTCTCGTGGAGAGATTAAGCTGTGCGACTTCGGAGTGAGCGGCCAGTTGATTGACTCCATGGCCAACTCATT TGTAGGGACACGCTCCTACATGTCCCCAGAACGGCTGCAGGGCACCCACTACTCTGTGCAGTCGGACATCTGGAGCATGGGGCTGTCGCTGGTGGAGCTGGCCATCGGGAGGTACCCCATCCCCCCAC CTGATGCCAAGGAACTAGAGGCCAGCTTTGGCCGGCCTGTGGTGGACGGGGCAGATGGAGAGCCCCATAGTGTCTCACCGCGGCCCCGGCCCCCTGGACGCCCCATCAGTGTAGGTCATGGGATGGAC AGCCGACCAGCCATGGCCATCTTTGAGCTGCTGGACTACATAGTGAATGAGCCACCTCCCAAGCTGCCCAGTGGTGTGTTCAGCTCAGACTTCCAGGAGTTTGTGAATAAATGTCTCATTAAGAACCC AGCAGAGCGTGCAGACCTCAAGCTGCTGACGAACCATGCCTTCATCAAACGCTCTGAGGGGGAGGACGTGGACTTCGCTGGCTGGCTATGCAGAACCCTGCGGCTGAAGCAGCCCAGCACACCCACGC GTACTGCAGTGTGACAGCCATCGCTCAGCAGTCTGTGTCCTTGTCCCTGTGGGCACAGCGGCCGCCTTTGGGGACAGCAGTGGTGTGTGTTGTGGCAGGGGACCTGTGCCTGTGCATTTGGAAAAGCA AACAAAGTGGAGAAAGAGAGAAAACTGCTGCTGTG
hide sequence
RefSeq Acc Id:
XM_039079809 ⟹ XP_038935737
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,241,581 - 9,264,216 (-) NCBI mRatBN7.2 7 8,590,729 - 8,610,279 (-) NCBI
RefSeq Acc Id:
XM_063264176 ⟹ XP_063120246
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,242,251 - 9,264,216 (-) NCBI
RefSeq Acc Id:
XM_063264177 ⟹ XP_063120247
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,242,251 - 9,264,216 (-) NCBI
RefSeq Acc Id:
NP_579817 ⟸ NM_133283
- UniProtKB:
A0JN15 (UniProtKB/Swiss-Prot), P36506 (UniProtKB/Swiss-Prot), A6K8C5 (UniProtKB/TrEMBL), A0A8I6A1A4 (UniProtKB/TrEMBL)
- Sequence:
MLARRKPVLPALTINPTIAEGPSPTSEGASEAHLVDLQKKLEELDLDEQQRKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKARHRPSGLIMARKLIHLEIKPAVRNQIIRELQVLHECNSP YIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEDILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLS LVELAIGRYPIPPPDAKELEASFGRPVVDGADGEPHSVSPRPRPPGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPSGVFSSDFQEFVNKCLIKNPAERADLKLLTNHAFIKRSEGEDVDFAGWLC RTLRLKQPSTPTRTAV
hide sequence
RefSeq Acc Id:
XP_006241049 ⟸ XM_006240987
- Peptide Label:
isoform X3
- UniProtKB:
A0A8L2QEI7 (UniProtKB/TrEMBL), A0A8I6A1A4 (UniProtKB/TrEMBL)
- Sequence:
MLARRKPVLPALTINPTIAEGPSPTSEGASEAHLVDLQKKLEELDLDEQQRKRLEAFLTQKAKV GELKDDDFERISELGAGNGGVVTKARHRPSGLIMARKLIHLEIKPAVRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEDILGKVSIAVLRGLAYLREKHQIMH RDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEASFGRPVVDGADGEPHSVSPRPRPPGRPISVGHGMDSRPAMAIF ELLDYIVNEPPPKLPSGVFSSDFQEFVNKCLIKNPAERADLKLLTNHAFIKRSEGEDVDFAGWLCRTLRLKQPSTPTRTAV
hide sequence
Ensembl Acc Id:
ENSRNOP00000027272 ⟸ ENSRNOT00000027272
RefSeq Acc Id:
XP_038935737 ⟸ XM_039079809
- Peptide Label:
isoform X4
- UniProtKB:
A6K8C1 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000080213 ⟸ ENSRNOT00000102029
Ensembl Acc Id:
ENSRNOP00000092750 ⟸ ENSRNOT00000102006
Ensembl Acc Id:
ENSRNOP00000085974 ⟸ ENSRNOT00000096038
Ensembl Acc Id:
ENSRNOP00000092716 ⟸ ENSRNOT00000107951
RefSeq Acc Id:
XP_063120247 ⟸ XM_063264177
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I5ZPN3 (UniProtKB/TrEMBL), A6K8C1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120246 ⟸ XM_063264176
- Peptide Label:
isoform X1
- UniProtKB:
A6K8C1 (UniProtKB/TrEMBL)
RGD ID: 13694989
Promoter ID: EPDNEW_R5514
Type: initiation region
Name: Map2k2_1
Description: mitogen activated protein kinase kinase 2
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 11,478,475 - 11,478,535 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Map2k2
mitogen activated protein kinase kinase 2
Name updated
70584
APPROVED
Note Type
Note
Reference
gene_function
phosphorylates both threonine and tyrosine residues on Mapk kinases
61657
gene_regulation
regulated by a protooncogene cRaf-1
729046